Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 65 (13 Feb 2019)
Sequence version 1 (20 Feb 2007)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Coiled-coil domain-containing protein 183

Gene

Ccdc183

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Coiled-coil domain-containing protein 183
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Ccdc183
Synonyms:Kiaa1984
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1924308 Ccdc183

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002934661 – 534Coiled-coil domain-containing protein 183Add BLAST534

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
A2AJB1

PRoteomics IDEntifications database

More...
PRIDEi
A2AJB1

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
A2AJB1

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
A2AJB1

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000026940 Expressed in 31 organ(s), highest expression level in testis

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000028309

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
A2AJB1

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili10 – 54Sequence analysisAdd BLAST45
Coiled coili136 – 209Sequence analysisAdd BLAST74
Coiled coili321 – 406Sequence analysisAdd BLAST86

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi530 – 534Poly-Lys5

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410II7I Eukaryota
ENOG410YH5U LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000153116

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000050237

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG058359

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
A2AJB1

Identification of Orthologs from Complete Genome Data

More...
OMAi
CSHLWDI

Database of Orthologous Groups

More...
OrthoDBi
622819at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
A2AJB1

TreeFam database of animal gene trees

More...
TreeFami
TF324955

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: A2AJB1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKVHNEAAVE AQITELRTIT RLQEQCRALQ IQGVKEKTAQ NKATMGILRS
60 70 80 90 100
NLRRGAQDWA LAKKHDQWTI SKACGKDTSM RLAHGRSTLE VAREKLRKYV
110 120 130 140 150
FDRVNTHNIL IHLVRRRGQK LESLQLELAS LRNQPDATKD ELRQLQIIRQ
160 170 180 190 200
LENNIEKTVI KITTSQNIHT LYKVLLDYLK KVLAEYPTEL DKLQNLVANY
210 220 230 240 250
CSELSDMTVM SQDAMMITDE VKRNMRQGEA TFIEERRARE NRLNQQKKLI
260 270 280 290 300
DKIHTKETSE KYRRGRRDLD FPSNLMTMEN VKVKKRKTSV ADIQYQTKVT
310 320 330 340 350
TLVERVKSAV QCSHLWDIAG RFLAQKNTEE NLELQMEDCE ERRTQLEALM
360 370 380 390 400
KKLELEEAVL KFHQTPSAVG FNSIQKKMKN MLEEEEARLK QAQNNMNKGQ
410 420 430 440 450
QLLLVIQTGI DNLYIRLIGI TLPTFQKEIA VSNTLDVYGK LDYCEGKLIY
460 470 480 490 500
LAERMQTLSR NEEVDTKVRD TLESSTLKEK HNTRITFEDP EEDMIETFQF
510 520 530
ADVDHSYVPS RAEIKKQAQQ LIEAKLKGAK KKKK
Length:534
Mass (Da):62,117
Last modified:February 20, 2007 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i515198BAE8E833CD
GO
Isoform 2 (identifier: A2AJB1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-206: Missing.
     496-534: ETFQFADVDHSYVPSRAEIKKQAQQLIEAKLKGAKKKKK → GEALHAGHRKMEKDDKNNSCN

Note: No experimental confirmation available.
Show »
Length:310
Mass (Da):36,178
Checksum:i03C1BBE82F0C9C0E
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0264851 – 206Missing in isoform 2. 1 PublicationAdd BLAST206
Alternative sequenceiVSP_026486496 – 534ETFQF…KKKKK → GEALHAGHRKMEKDDKNNSC N in isoform 2. 1 PublicationAdd BLAST39

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK014983 mRNA Translation: BAB29653.1
AL732590 Genomic DNA No translation available.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS50533.1 [A2AJB1-1]

NCBI Reference Sequences

More...
RefSeqi
NP_084135.1, NM_029859.1 [A2AJB1-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Mm.478493

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000028309; ENSMUSP00000028309; ENSMUSG00000026940 [A2AJB1-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
77058

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:77058

UCSC genome browser

More...
UCSCi
uc008isv.2 mouse [A2AJB1-2]
uc012bsc.1 mouse [A2AJB1-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK014983 mRNA Translation: BAB29653.1
AL732590 Genomic DNA No translation available.
CCDSiCCDS50533.1 [A2AJB1-1]
RefSeqiNP_084135.1, NM_029859.1 [A2AJB1-1]
UniGeneiMm.478493

3D structure databases

SMRiA2AJB1
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000028309

PTM databases

iPTMnetiA2AJB1
PhosphoSitePlusiA2AJB1

Proteomic databases

PaxDbiA2AJB1
PRIDEiA2AJB1

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000028309; ENSMUSP00000028309; ENSMUSG00000026940 [A2AJB1-1]
GeneIDi77058
KEGGimmu:77058
UCSCiuc008isv.2 mouse [A2AJB1-2]
uc012bsc.1 mouse [A2AJB1-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
84960
MGIiMGI:1924308 Ccdc183

Rodent Unidentified Gene-Encoded large proteins database

More...
Rougei
Search...

Phylogenomic databases

eggNOGiENOG410II7I Eukaryota
ENOG410YH5U LUCA
GeneTreeiENSGT00940000153116
HOGENOMiHOG000050237
HOVERGENiHBG058359
InParanoidiA2AJB1
OMAiCSHLWDI
OrthoDBi622819at2759
PhylomeDBiA2AJB1
TreeFamiTF324955

Miscellaneous databases

Protein Ontology

More...
PROi
PR:A2AJB1

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000026940 Expressed in 31 organ(s), highest expression level in testis

Family and domain databases

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCC183_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: A2AJB1
Secondary accession number(s): Q9D5S3
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 10, 2007
Last sequence update: February 20, 2007
Last modified: February 13, 2019
This is version 65 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again