Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 103 (13 Feb 2019)
Sequence version 1 (20 Feb 2007)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

NADPH-dependent diflavin oxidoreductase 1

Gene

Ndor1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Component of the cytosolic iron-sulfur (Fe-S) protein assembly (CIA) machinery. Required for the maturation of extramitochondrial Fe-S proteins. Part of an electron transfer chain functioning in an early step of cytosolic Fe-S biogenesis. Transfers electrons from NADPH to the Fe/S cluster of CIAPIN1.UniRule annotation

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Protein has several cofactor binding sites:

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei132FMNUniRule annotation1
Binding sitei350FADUniRule annotation1
Binding sitei461NADPUniRule annotation1
Binding sitei559NADPUniRule annotation1
Binding sitei597FADUniRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi12 – 17FMNUniRule annotation6
Nucleotide bindingi59 – 62FMNUniRule annotation4
Nucleotide bindingi97 – 106FMNUniRule annotation10
Nucleotide bindingi382 – 385FADUniRule annotation4
Nucleotide bindingi416 – 419FADUniRule annotation4
Nucleotide bindingi516 – 517NADPUniRule annotation2
Nucleotide bindingi522 – 526NADPUniRule annotation5

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionOxidoreductase
LigandFAD, Flavoprotein, FMN, NADP

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
NADPH-dependent diflavin oxidoreductase 1UniRule annotation (EC:1.18.1.-UniRule annotation)
Alternative name(s):
NADPH-dependent FMN and FAD-containing oxidoreductaseUniRule annotation
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Ndor1UniRule annotation
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1926047 Ndor1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003195401 – 598NADPH-dependent diflavin oxidoreductase 1Add BLAST598

Proteomic databases

MaxQB - The MaxQuant DataBase

More...
MaxQBi
A2AI05

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
A2AI05

PeptideAtlas

More...
PeptideAtlasi
A2AI05

PRoteomics IDEntifications database

More...
PRIDEi
A2AI05

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
A2AI05

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
A2AI05

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000006471 Expressed in 190 organ(s), highest expression level in zone of skin

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
A2AI05 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
A2AI05 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with CIAPIN1. Interacts with DCPS.UniRule annotation

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000109989

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
A2AI05

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
A2AI05

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini6 – 150Flavodoxin-likeUniRule annotationAdd BLAST145
Domaini206 – 448FAD-binding FR-typeUniRule annotationAdd BLAST243

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the NADPH-dependent diflavin oxidoreductase NDOR1 family.UniRule annotation
In the N-terminal section; belongs to the flavodoxin family.UniRule annotation
In the C-terminal section; belongs to the flavoprotein pyridine nucleotide cytochrome reductase family.UniRule annotation

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1159 Eukaryota
COG0369 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00930000151050

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000173033

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG104950

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
A2AI05

Identification of Orthologs from Complete Genome Data

More...
OMAi
FEMMPLI

Database of Orthologous Groups

More...
OrthoDBi
318396at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
A2AI05

TreeFam database of animal gene trees

More...
TreeFami
TF105716

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.990.10, 1 hit
3.40.50.360, 1 hit
3.40.50.80, 1 hit

HAMAP database of protein families

More...
HAMAPi
MF_03178 NDOR1, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR003097 CysJ-like_FAD-binding
IPR017927 FAD-bd_FR_type
IPR001094 Flavdoxin-like
IPR008254 Flavodoxin/NO_synth
IPR001709 Flavoprot_Pyr_Nucl_cyt_Rdtase
IPR029039 Flavoprotein-like_sf
IPR039261 FNR_nucleotide-bd
IPR023173 NADPH_Cyt_P450_Rdtase_alpha
IPR028879 NDOR1
IPR001433 OxRdtase_FAD/NAD-bd
IPR017938 Riboflavin_synthase-like_b-brl

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00667 FAD_binding_1, 1 hit
PF00258 Flavodoxin_1, 1 hit
PF00175 NAD_binding_1, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00369 FLAVODOXIN
PR00371 FPNCR

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF52218 SSF52218, 1 hit
SSF52343 SSF52343, 1 hit
SSF63380 SSF63380, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51384 FAD_FR, 1 hit
PS50902 FLAVODOXIN_LIKE, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: A2AI05-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MQVPQLLVLF GSQTGTAQDE AERLGREARR RRLGCRVQAL DSYSVANLIR
60 70 80 90 100
EPLVIFVCAT TGQGDPPDNM KNFWRFIFRK SLPSSSLCQM DFAVLGLGDS
110 120 130 140 150
SYAKFNFVAK KLHRRLLQLG GSALLPPCLG DDQHELGPDA AIDPWVGDLW
160 170 180 190 200
EKIMVMYPVP LDIPEIPHGV PLPSKFIFQF LQEVPSIGAE ELNIASSAPQ
210 220 230 240 250
TPPSELQPFL APVITNQRVT GPQHFQDVRL IEFDITDSNI SFAAGDVVFI
260 270 280 290 300
LPSNSEAHTQ QFCQVLCLDP NQFFTLKPRE PGVPDPPGLP QPCTVWNLVS
310 320 330 340 350
QYLDIASVPR RSFFELLACL SQHALEREKL LELSSARGQE ELWEYCSRPR
360 370 380 390 400
RTILEVLCDF PHTAGAIPPD YLLDLIPRIR PRAFSIASSL LAHPRRLQIL
410 420 430 440 450
VAVVKYQTRL KEPRHGLCSS WLASLNPGQA GPVRVPLWVR PGSLVFPKTP
460 470 480 490 500
DTPIIMVGAG TGVAPFRAAI QERVAHGQTG NFLFFGCRQR DQDFYWQTEW
510 520 530 540 550
QKLEQKGWLT LVTAFSREQE QKVYVQHRLR ELGPLVWELL DGQGAYFYLA
560 570 580 590
GNAKYLPTDV SEALMSIFQE EGRLSTADAS AYLARLQQTL RFQTETWA
Note: Gene prediction based on EST data.
Length:598
Mass (Da):67,183
Last modified:February 20, 2007 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i7B621663EEE85FED
GO
Isoform 2 (identifier: A2AI05-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     104-171: KFNFVAKKLHRRLLQLGGSALLPPCLGDDQHELGPDAAIDPWVGDLWEKIMVMYPVPLDIPEIPHGVP → N

Show »
Length:531
Mass (Da):59,749
Checksum:i973A680C3DB10F46
GO
Isoform 3 (identifier: A2AI05-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-45: MQVPQLLVLFGSQTGTAQDEAERLGREARRRRLGCRVQALDSYSV → MRCREGTDQGCQRPYIYLCLVLE
     481-488: NFLFFGCR → EYWSSKAV
     489-598: Missing.

Show »
Length:466
Mass (Da):51,869
Checksum:i4AC0553432F989B3
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A2I3BQN1A0A2I3BQN1_MOUSE
NADPH-dependent diflavin oxidoreduc...
Ndor1
662Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6XCS1F6XCS1_MOUSE
NADPH-dependent diflavin oxidoreduc...
Ndor1
225Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E0CXI9E0CXI9_MOUSE
NADPH-dependent diflavin oxidoreduc...
Ndor1
212Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E0CYR1E0CYR1_MOUSE
NADPH-dependent diflavin oxidoreduc...
Ndor1
82Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E0CX27E0CX27_MOUSE
NADPH-dependent diflavin oxidoreduc...
Ndor1
71Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0314881 – 45MQVPQ…DSYSV → MRCREGTDQGCQRPYIYLCL VLE in isoform 3. 1 PublicationAdd BLAST45
Alternative sequenceiVSP_031489104 – 171KFNFV…PHGVP → N in isoform 2. 2 PublicationsAdd BLAST68
Alternative sequenceiVSP_031490481 – 488NFLFFGCR → EYWSSKAV in isoform 3. 1 Publication8
Alternative sequenceiVSP_031491489 – 598Missing in isoform 3. 1 PublicationAdd BLAST110

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK163207 mRNA Translation: BAE37235.1
AK169885 mRNA Translation: BAE41435.1
AL732309 Genomic DNA No translation available.
BC049789 mRNA Translation: AAH49789.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS38069.1 [A2AI05-1]
CCDS57157.1 [A2AI05-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001075945.1, NM_001082476.2 [A2AI05-1]
NP_001239470.1, NM_001252541.1 [A2AI05-2]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Mm.40020

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000100329; ENSMUSP00000097903; ENSMUSG00000006471 [A2AI05-2]
ENSMUST00000114349; ENSMUSP00000109989; ENSMUSG00000006471 [A2AI05-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
78797

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:78797

UCSC genome browser

More...
UCSCi
uc008iqw.2 mouse [A2AI05-1]
uc012brw.2 mouse [A2AI05-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK163207 mRNA Translation: BAE37235.1
AK169885 mRNA Translation: BAE41435.1
AL732309 Genomic DNA No translation available.
BC049789 mRNA Translation: AAH49789.1
CCDSiCCDS38069.1 [A2AI05-1]
CCDS57157.1 [A2AI05-2]
RefSeqiNP_001075945.1, NM_001082476.2 [A2AI05-1]
NP_001239470.1, NM_001252541.1 [A2AI05-2]
UniGeneiMm.40020

3D structure databases

ProteinModelPortaliA2AI05
SMRiA2AI05
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000109989

PTM databases

iPTMnetiA2AI05
PhosphoSitePlusiA2AI05

Proteomic databases

MaxQBiA2AI05
PaxDbiA2AI05
PeptideAtlasiA2AI05
PRIDEiA2AI05

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000100329; ENSMUSP00000097903; ENSMUSG00000006471 [A2AI05-2]
ENSMUST00000114349; ENSMUSP00000109989; ENSMUSG00000006471 [A2AI05-1]
GeneIDi78797
KEGGimmu:78797
UCSCiuc008iqw.2 mouse [A2AI05-1]
uc012brw.2 mouse [A2AI05-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
27158
MGIiMGI:1926047 Ndor1

Phylogenomic databases

eggNOGiKOG1159 Eukaryota
COG0369 LUCA
GeneTreeiENSGT00930000151050
HOGENOMiHOG000173033
HOVERGENiHBG104950
InParanoidiA2AI05
OMAiFEMMPLI
OrthoDBi318396at2759
PhylomeDBiA2AI05
TreeFamiTF105716

Miscellaneous databases

Protein Ontology

More...
PROi
PR:A2AI05

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000006471 Expressed in 190 organ(s), highest expression level in zone of skin
ExpressionAtlasiA2AI05 baseline and differential
GenevisibleiA2AI05 MM

Family and domain databases

Gene3Di1.20.990.10, 1 hit
3.40.50.360, 1 hit
3.40.50.80, 1 hit
HAMAPiMF_03178 NDOR1, 1 hit
InterProiView protein in InterPro
IPR003097 CysJ-like_FAD-binding
IPR017927 FAD-bd_FR_type
IPR001094 Flavdoxin-like
IPR008254 Flavodoxin/NO_synth
IPR001709 Flavoprot_Pyr_Nucl_cyt_Rdtase
IPR029039 Flavoprotein-like_sf
IPR039261 FNR_nucleotide-bd
IPR023173 NADPH_Cyt_P450_Rdtase_alpha
IPR028879 NDOR1
IPR001433 OxRdtase_FAD/NAD-bd
IPR017938 Riboflavin_synthase-like_b-brl
PfamiView protein in Pfam
PF00667 FAD_binding_1, 1 hit
PF00258 Flavodoxin_1, 1 hit
PF00175 NAD_binding_1, 1 hit
PRINTSiPR00369 FLAVODOXIN
PR00371 FPNCR
SUPFAMiSSF52218 SSF52218, 1 hit
SSF52343 SSF52343, 1 hit
SSF63380 SSF63380, 1 hit
PROSITEiView protein in PROSITE
PS51384 FAD_FR, 1 hit
PS50902 FLAVODOXIN_LIKE, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNDOR1_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: A2AI05
Secondary accession number(s): Q3TQZ6, Q80WC5
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: February 20, 2007
Last modified: February 13, 2019
This is version 103 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again