Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Mediator of RNA polymerase II transcription subunit 14

Gene

Med14

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator
Biological processTranscription, Transcription regulation

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-212436 Generic Transcription Pathway

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Mediator of RNA polymerase II transcription subunit 14
Alternative name(s):
Cofactor required for Sp1 transcriptional activation subunit 2
Short name:
CRSP complex subunit 2
Mediator complex subunit 14
Thyroid hormone receptor-associated protein complex 170 kDa component
Short name:
Trap170
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Med14
Synonyms:Crsp2, Gm641, Trap170
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1349442 Med14

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003045851 – 1459Mediator of RNA polymerase II transcription subunit 14Add BLAST1459

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei623PhosphoserineBy similarity1
Modified residuei992PhosphoserineBy similarity1
Modified residuei1117PhosphoserineCombined sources1
Modified residuei1124PhosphoserineCombined sources1
Modified residuei1133PhosphoserineCombined sources1
Modified residuei1141PhosphoserineCombined sources1
Modified residuei1149PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
A2ABV5

MaxQB - The MaxQuant DataBase

More...
MaxQBi
A2ABV5

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
A2ABV5

PeptideAtlas

More...
PeptideAtlasi
A2ABV5

PRoteomics IDEntifications database

More...
PRIDEi
A2ABV5

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
A2ABV5

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
A2ABV5

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000064127 Expressed in 294 organ(s), highest expression level in ear

CleanEx database of gene expression profiles

More...
CleanExi
MM_MED14

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
A2ABV5 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
A2ABV5 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of the Mediator complex, which is composed of MED1, MED4, MED6, MED7, MED8, MED9, MED10, MED11, MED12, MED13, MED13L, MED14, MED15, MED16, MED17, MED18, MED19, MED20, MED21, MED22, MED23, MED24, MED25, MED26, MED27, MED29, MED30, MED31, CCNC, CDK8 and CDC2L6/CDK11. The MED12, MED13, CCNC and CDK8 subunits form a distinct module termed the CDK8 module. Mediator containing the CDK8 module is less active than Mediator lacking this module in supporting transcriptional activation. Individual preparations of the Mediator complex lacking one or more distinct subunits have been variously termed ARC, CRSP, DRIP, PC2, SMCC and TRAP. Interacts with AR, ESR1, SREBF1 and STAT2 (By similarity). Interacts with GATA1.By similarity1 Publication

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
205047, 5 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...
ComplexPortali
CPX-3264 Core mediator complex

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
A2ABV5

Protein interaction database and analysis system

More...
IntActi
A2ABV5, 4 interactors

Molecular INTeraction database

More...
MINTi
A2ABV5

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000094239

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
A2ABV5

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni194 – 572Interaction with STAT2By similarityAdd BLAST379
Regioni506 – 830Interaction with SREBF1By similarityAdd BLAST325

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi75 – 79LXXLL motif 15
Motifi1187 – 1191LXXLL motif 25

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi31 – 51Ala-richAdd BLAST21
Compositional biasi1008 – 1170Pro-richAdd BLAST163

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the Mediator complex subunit 14 family.Curated

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1875 Eukaryota
ENOG410XWK4 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000001021

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000045361

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG104308

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
A2ABV5

KEGG Orthology (KO)

More...
KOi
K15156

Identification of Orthologs from Complete Genome Data

More...
OMAi
PGQSPEH

Database of Orthologous Groups

More...
OrthoDBi
1215335at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
A2ABV5

TreeFam database of animal gene trees

More...
TreeFami
TF314388

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR013947 Mediator_Med14

The PANTHER Classification System

More...
PANTHERi
PTHR12809 PTHR12809, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF08638 Med14, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: A2ABV5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAPVQLDNHQ LIPPGGGGGS SGGGGSSSGS ASAPAPPPPA AAVAAAAAAA
60 70 80 90 100
ASPGYRLSTL IEFLLHRAYS ELMVLTDLLP RKSDVERKIE IVQFASRTRQ
110 120 130 140 150
LFVRLLALVK WANDAGKVEK CAMISSFLDQ QAILFVDTAD RLASLARDAL
160 170 180 190 200
VHARLPSFAI PYAIDVLTTG SYPRLPTCIR DKIIPPDPIT KIEKQATLHQ
210 220 230 240 250
LNQILRHRLV TTDLPPQLAN LTVANGRVKF RVEGEFEATL TVMGDDPEVP
260 270 280 290 300
WRLLKLEILV EDKETGDGRA LVHSMQIDFI HQLVQSRLFA DEKPLQDMYN
310 320 330 340 350
CLHCFCLSLQ LEVLHSQTLM LIRERWGDLV QVERYHAGKS LSLSVWNQQV
360 370 380 390 400
LGRKTGTASV HKVTIKIDEN DVSKPLQIFH DPPLPASDSK LVERAMKIDH
410 420 430 440 450
LSIEKLLIDS VHARAHQRLQ ELKAILRSFN ANESSSIETA LPALIVPILE
460 470 480 490 500
PCGNSECLHI FVDLHSGMFQ LMLYGLDPAT LEDMEKSLND DMKRIIPWIQ
510 520 530 540 550
QLKFWLGQQR CKQSIKHLPT ITTETLQLAN YSTHPIGSLS KNKLFIKLTR
560 570 580 590 600
LPQYYIVVEM LEVPNKPTQL SYNYYFMSVS TADREDSPVM ALLLQQFKDN
610 620 630 640 650
IQDLMSYTKT GKQTRTGTKH KLSDDPCPID SKKAKRSGEM CAFNKVLAHF
660 670 680 690 700
VAMCDTNMPF VGLRLELSNL EIPHQGVQVE GDGFNHAIRL LKIPPCKGIS
710 720 730 740 750
EETQKALDRS LLDCTFRLQG RNNRTWVAEL VFANCPLNGT STREQGPSRH
760 770 780 790 800
VYLTYENLLS EPVGGRKVVE MFLNDWSSIA RLYECVLEFA RSLPEIPAHL
810 820 830 840 850
NIFSEVRVYN YRKLILCYGT TKGSSISIQW NSIHQKFHIA LGTVGPNSGC
860 870 880 890 900
SNCHNTILHQ LQEMFNKTPN VVQLLQVLFD TQAPLNAINK LPTVPMLGLT
910 920 930 940 950
QRTNTAYQCF SILPQSSTHI RLAFRNMYCI DIYCRSRGVV AIRDGAYSLF
960 970 980 990 1000
DNSKLVEGFY PAPGLKTFLN MFVDSNQDAR RRSVNEDDNP PSPIGGDMMD
1010 1020 1030 1040 1050
SLISQLQPPQ QQPFPKQPGT SGAYPLTSPP TSYHSTVNQS PSMMHTQSPG
1060 1070 1080 1090 1100
NLHAASSPSG ALRAPSPASF VPTPPPSSHG ISIGPGASFA SPHGTLDPSS
1110 1120 1130 1140 1150
PYTMVSPSGR AGNWPGSPQV SGPSPATRLP GMSPANPSLH SPVPDVSHSP
1160 1170 1180 1190 1200
RAGTSSQTMP TNMPPPRKLP QRSWAASIPT ILTHSALNIL LLPSPTPGLV
1210 1220 1230 1240 1250
PGLAGSYLCS PLERFLGSVI MRRHLQRIIQ QETLQLINSN EPGVIMFKTD
1260 1270 1280 1290 1300
ALKCRVALSP KTNQTLQLKV TPENAGQWKP DELQVLEKFF ETRVAGPPFK
1310 1320 1330 1340 1350
ANTLIAFTKL LGAPTHILRD CVHIMKLELF PDQATQLKWN VQFCLTIPPS
1360 1370 1380 1390 1400
APPIAPPGTP AVVLKSKMLF FLQLTQKTSV PPQEPVSIIV PIIYDMASGT
1410 1420 1430 1440 1450
TQQADIPRQQ NSSVAAPMMV SNILKRFAEM NPPRQGECTI FAAVRDLMAN

LTLPPGGRP
Length:1,459
Mass (Da):160,966
Last modified:February 20, 2007 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iFE61E45E8E99E4E9
GO
Isoform 2 (identifier: A2ABV5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     747-770: PSRHVYLTYENLLSEPVGGRKVVE → KIFHTVFLLMSIFLKVLVTISFFL
     771-1459: Missing.

Note: No experimental confirmation available.
Show »
Length:770
Mass (Da):86,050
Checksum:iAE645E84E4B373E2
GO
Isoform 3 (identifier: A2ABV5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     436-471: SIETALPALIVPILEPCGNSECLHIFVDLHSGMFQL → KHSRAGEMAQQLRVPTALPKVLSSNPINHMVAHNHL
     472-1459: Missing.

Show »
Length:471
Mass (Da):51,942
Checksum:i9E560273E9D3CC85
GO
Isoform 4 (identifier: A2ABV5-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-72: Missing.
     435-1459: Missing.

Note: No experimental confirmation available.
Show »
Length:362
Mass (Da):41,127
Checksum:i2F6672DA26CFE08C
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A2BDP0A2BDP0_MOUSE
Mediator of RNA polymerase II trans...
Med14
798Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A2BDN7A2BDN7_MOUSE
Mediator of RNA polymerase II trans...
Med14
700Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti158F → C in BAE37289 (PubMed:16141072).Curated1
Sequence conflicti346 – 347WN → C in BAA76611 (PubMed:10512684).Curated2

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0280331 – 72Missing in isoform 4. 1 PublicationAdd BLAST72
Alternative sequenceiVSP_028034435 – 1459Missing in isoform 4. 1 PublicationAdd BLAST1025
Alternative sequenceiVSP_028035436 – 471SIETA…GMFQL → KHSRAGEMAQQLRVPTALPK VLSSNPINHMVAHNHL in isoform 3. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_028036472 – 1459Missing in isoform 3. 1 PublicationAdd BLAST988
Alternative sequenceiVSP_028037747 – 770PSRHV…RKVVE → KIFHTVFLLMSIFLKVLVTI SFFL in isoform 2. 1 PublicationAdd BLAST24
Alternative sequenceiVSP_028038771 – 1459Missing in isoform 2. 1 PublicationAdd BLAST689

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB019028 mRNA Translation: BAA76610.1
AB019029 Genomic DNA Translation: BAA76611.1
AK163306 mRNA Translation: BAE37289.1
AL662925, BX000537 Genomic DNA Translation: CAM17981.1
BX000537, AL662925 Genomic DNA Translation: CAM27890.1
BC065072 mRNA Translation: AAH65072.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS40874.1 [A2ABV5-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001041673.1, NM_001048208.1 [A2ABV5-1]
NP_036135.3, NM_012005.3

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Mm.17616

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000096495; ENSMUSP00000094239; ENSMUSG00000064127 [A2ABV5-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
26896

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:26896

UCSC genome browser

More...
UCSCi
uc009sqz.1 mouse [A2ABV5-1]
uc009srd.1 mouse [A2ABV5-3]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB019028 mRNA Translation: BAA76610.1
AB019029 Genomic DNA Translation: BAA76611.1
AK163306 mRNA Translation: BAE37289.1
AL662925, BX000537 Genomic DNA Translation: CAM17981.1
BX000537, AL662925 Genomic DNA Translation: CAM27890.1
BC065072 mRNA Translation: AAH65072.1
CCDSiCCDS40874.1 [A2ABV5-1]
RefSeqiNP_001041673.1, NM_001048208.1 [A2ABV5-1]
NP_036135.3, NM_012005.3
UniGeneiMm.17616

3D structure databases

ProteinModelPortaliA2ABV5
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi205047, 5 interactors
ComplexPortaliCPX-3264 Core mediator complex
CORUMiA2ABV5
IntActiA2ABV5, 4 interactors
MINTiA2ABV5
STRINGi10090.ENSMUSP00000094239

PTM databases

iPTMnetiA2ABV5
PhosphoSitePlusiA2ABV5

Proteomic databases

EPDiA2ABV5
MaxQBiA2ABV5
PaxDbiA2ABV5
PeptideAtlasiA2ABV5
PRIDEiA2ABV5

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000096495; ENSMUSP00000094239; ENSMUSG00000064127 [A2ABV5-1]
GeneIDi26896
KEGGimmu:26896
UCSCiuc009sqz.1 mouse [A2ABV5-1]
uc009srd.1 mouse [A2ABV5-3]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9282
MGIiMGI:1349442 Med14

Phylogenomic databases

eggNOGiKOG1875 Eukaryota
ENOG410XWK4 LUCA
GeneTreeiENSGT00390000001021
HOGENOMiHOG000045361
HOVERGENiHBG104308
InParanoidiA2ABV5
KOiK15156
OMAiPGQSPEH
OrthoDBi1215335at2759
PhylomeDBiA2ABV5
TreeFamiTF314388

Enzyme and pathway databases

ReactomeiR-MMU-212436 Generic Transcription Pathway

Miscellaneous databases

Protein Ontology

More...
PROi
PR:A2ABV5

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000064127 Expressed in 294 organ(s), highest expression level in ear
CleanExiMM_MED14
ExpressionAtlasiA2ABV5 baseline and differential
GenevisibleiA2ABV5 MM

Family and domain databases

InterProiView protein in InterPro
IPR013947 Mediator_Med14
PANTHERiPTHR12809 PTHR12809, 1 hit
PfamiView protein in Pfam
PF08638 Med14, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMED14_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: A2ABV5
Secondary accession number(s): Q3TQU3
, Q6P1H5, Q9R0T1, Q9WTN9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 11, 2007
Last sequence update: February 20, 2007
Last modified: January 16, 2019
This is version 101 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again