Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 88 (16 Oct 2019)
Sequence version 4 (27 Jul 2011)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Transmembrane protein KIAA1109

Gene

Kiaa1109

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Transmembrane protein KIAA1109Curated
Alternative name(s):
Fragile site-associated protein homolog
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Kiaa1109
Synonyms:Fsa, Kiaa1371
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:2444631 4932438A13Rik

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei27 – 47HelicalSequence analysisAdd BLAST21

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003175561 – 5005Transmembrane protein KIAA1109Add BLAST5005

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1301PhosphoserineBy similarity1
Modified residuei1305PhosphoserineBy similarity1
Modified residuei1323PhosphoserineCombined sources1
Modified residuei1325PhosphothreonineBy similarity1
Modified residuei1355PhosphoserineCombined sources1
Modified residuei1406PhosphoserineBy similarity1
Modified residuei1805PhosphoserineCombined sources1
Modified residuei1808PhosphoserineCombined sources1
Modified residuei2601PhosphoserineCombined sources1
Modified residuei2603PhosphoserineBy similarity1
Modified residuei2755PhosphoserineCombined sources1
Modified residuei3562PhosphoserineBy similarity1
Modified residuei3653PhosphoserineCombined sources1
Modified residuei4124PhosphoserineCombined sources1
Isoform 3 (identifier: A2AAE1-3)
Modified residuei3577PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
A2AAE1

MaxQB - The MaxQuant DataBase

More...
MaxQBi
A2AAE1

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
A2AAE1

PeptideAtlas

More...
PeptideAtlasi
A2AAE1

PRoteomics IDEntifications database

More...
PRIDEi
A2AAE1

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
A2AAE1

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
A2AAE1

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
A2AAE1

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in testis and ovary. Weakly or not expressed in other tissues.1 Publication

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed during spermatogenesis and adipogenesis.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000037270 Expressed in 270 organ(s), highest expression level in retina

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
A2AAE1 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
A2AAE1 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
230823, 4 interactors

Protein interaction database and analysis system

More...
IntActi
A2AAE1, 5 interactors

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000060199

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi772 – 779Poly-Ser8
Compositional biasi1154 – 1157Poly-Ser4
Compositional biasi1226 – 1391Ser-richAdd BLAST166
Compositional biasi1417 – 1421Poly-Lys5
Compositional biasi1544 – 1547Poly-Ser4
Compositional biasi1991 – 1994Poly-Pro4
Compositional biasi3838 – 3841Poly-Lys4
Compositional biasi4110 – 4234Ser-richAdd BLAST125

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3596 Eukaryota
ENOG410XT7P LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00640000091487

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
A2AAE1

Identification of Orthologs from Complete Genome Data

More...
OMAi
WKNVLYT

Database of Orthologous Groups

More...
OrthoDBi
77777at2759

TreeFam database of animal gene trees

More...
TreeFami
TF105915

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR018863 Fragile_site-assoc_C
IPR033616 KIAA1109

The PANTHER Classification System

More...
PANTHERi
PTHR31640 PTHR31640, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF10479 FSA_C, 2 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM01220 FSA_C, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: A2AAE1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDQRKNDSIV PSITQLEDFL TEHNSNVVWL LVATILSCGW IIYLTYYNSR
60 70 80 90 100
NVGLILTLVL NRLYKHGYIH IGSFSFSVLS GKVMVREIYY ITEDMSIRIQ
110 120 130 140 150
DGFIIFRWWK MYNPKQKQHD PKAETRLYIT VNDFEFHVYN RSDLYGRLQE
160 170 180 190 200
LFGLEPTIIP PKKDDDKTRE NGRTRTQSKI ERVKVKTESQ DPTSSWRSLI
210 220 230 240 250
PVIKVNVSTG RLAFGNHYQP QTLCINFDDA FLTYTTKPPS SHLDQFMHIV
260 270 280 290 300
KGKLENVRVM LVPSPRYVGL QNDEPPRLMG EGFVVLQSND VDLYYYMDEP
310 320 330 340 350
GLVPEETEES TEGDISSEDC KLQDLPPCWG LDIVCGKGTD FNYGPWADRQ
360 370 380 390 400
RDCLWKFFFP PDYQVLKVSE IAQPGRPRQI LAFELRMNII TDATIDLLFT
410 420 430 440 450
KNRETNAVHV NVGAGSYLEI NIPMTVDENG YTPAIKGQLL HVDATTSMQY
460 470 480 490 500
RTLLEAEMLA FHINASYPRI WNMPQTWQCE LEVYKATYHF IFAQKNFFTD
510 520 530 540 550
LIQDWSSDNA PDIFSFVPYT WNFKIMFHQF EMIWAANQHN WIDCSTKQQE
560 570 580 590 600
NVYLAACGET LNIDFSLPFT DFVPATCNTR FSLRGEDVDL HLFLPDCHPS
610 620 630 640 650
KYSLFMLVKN CHPNKMVPET GIPAECQSGQ KTVKPKWRNV TQEKAGWVEC
660 670 680 690 700
WTVPSVMLTI DYTWHPIYPQ KADEQLKQSL SEMEETMLSV LRPAQKTSER
710 720 730 740 750
VVSSPSMSPR PPVDPSELPP DKLHVEMELS PDSQITLYGP LLNAFLCIKE
760 770 780 790 800
NYFGEDDMYM DFEEVISSPV LSLSTSSSSG WTAVGMDNDK RENESSAKSI
810 820 830 840 850
HPLALRPWDI TVLVNLYKVH GRLPVHGTTD GPECPTAFLE RLCFEMKKGF
860 870 880 890 900
RETMLQLVLS PLNVFVSDNY QQRPPVDEVL REGHINLSGL QLRAHAMFSA
910 920 930 940 950
EGLPLGSDSL EYAWLIDVQA GSLTAKVTAP QLACLLEWGQ TFVFHVVCRE
960 970 980 990 1000
YELERPKSVI VCQHGIDRRF CESKLSCIPG PCPTSDDLKY TMTRLAIDGS
1010 1020 1030 1040 1050
DIYIVEHGCA TNIKMGAVRI ANCNLHNQSV GEGISAAIQD FQVRQYIEQL
1060 1070 1080 1090 1100
NNCRIGLQPA VLRRAYWLEA GSANLGLITV DIALAADHHS KHEAQRHFLE
1110 1120 1130 1140 1150
THDARTKRLW FLWPDDTLKN KRCRNKCGCL GGCRFFGGTV TGLDFFKLEE
1160 1170 1180 1190 1200
LTPSSSSAFS STSAESDMYY GQSLLQPGEW IITKEIPKTV DGNVNSMKRK
1210 1220 1230 1240 1250
EWENKSVGIE GERKTQHLSL QVPLRSHSSS SSSEENSSSS AAQPLLAGEK
1260 1270 1280 1290 1300
ESPSSAADDH SVQKDLLHSA RRDDGQASVP TEISGTSPVS PNTQDKSVGQ
1310 1320 1330 1340 1350
SPLRSPLKRQ ASVCSTRLGS TKSLTAAFYG DKQPVTVGVQ FSSDVSRSDE
1360 1370 1380 1390 1400
NVLDSPKQRR SFGSFPYTPS ADSNSFHQYR SMDSSMSMAD SEAYFSAAEE
1410 1420 1430 1440 1450
FEPISSDEGP GTYPGRKKKK KQMQQIDYSR GSIYHSVEGP LAVHGEGITD
1460 1470 1480 1490 1500
PRTLPFKTHP SQASFVSALG GEDEVIEHVY IVEGEKRGES EQVTSQQPVM
1510 1520 1530 1540 1550
SCYHTYLTQF QVINWSVKHP TNKRTSKSSL HRPLDLDTPT SEESSSSFEQ
1560 1570 1580 1590 1600
LCVPTFKVIK QGLTANSLLD RGMQLSGSTS NTPYTPLDKK IVDTTDDETL
1610 1620 1630 1640 1650
TEEWTLDQPV AQTKTTAIVE VKGTVDVVLT PLVAEALDRY IEAMVHRVST
1660 1670 1680 1690 1700
RHPAAIVDDL HTKVLREAVQ NSKTTFSENL SPKQDIRGTK TEHPMIGTTN
1710 1720 1730 1740 1750
QGQIQTNVTT KQDNVTIKGL QANVSIPKVN LCLLQASVEE SPATVPSRSV
1760 1770 1780 1790 1800
THVSLVALCF DRIATQVRMN RGVVEETANN VDAGKTSNFD RYVHASKMQP
1810 1820 1830 1840 1850
QSSGSLRSNA GAEKGKEIAA KLNIHRVHGQ LRGLDTTDIG TCAITAIPFE
1860 1870 1880 1890 1900
KSKVLFTLEE LDEFTFVDET DQQAIPDVTR IGPSQEKWGW IMFECGLENL
1910 1920 1930 1940 1950
TIKGGRQSGA VLYNSFGIMG KNSVTERGGV LTSNNSSDSP TGSGYNTDVS
1960 1970 1980 1990 2000
DDNLPCDRTS PSSDINGNSV SDEQDEGVES DDLKKDLPLM PPPPDSCSMK
2010 2020 2030 2040 2050
LTIKEIWFSF AAPTNVRSPA HAFSRQLNLL STATPAVGAW LVPIDQLKSS
2060 2070 2080 2090 2100
LNKLETEGTL RICAVMGCIM TEALENKSVH FPLRSKYNRL TKVARFLQEN
2110 2120 2130 2140 2150
PSCLLCNILH HYLHQANYSI IDDATMSDGL PALVTLKKGL VALARQWMKF
2160 2170 2180 2190 2200
IVVTPAFKGV SLHRPAQPLK PPATVDQEHE EGLGLDNGGG LQSDTSADGA
2210 2220 2230 2240 2250
EFEFDAATVS EHTMLLEGTA NRPPPGSSGP VTGAEIMRKL SKTHTHSDSA
2260 2270 2280 2290 2300
LKIKGIHPYH SLSYTSGDTA TDSPVHVGRA GMPVKESPRK ESLLSYLTGS
2310 2320 2330 2340 2350
FPSLHNLLEG TPQRSSAAVK SSSLTRTGNT VATDMLSEHP LLSEPSSVSF
2360 2370 2380 2390 2400
YNWMSNAVGN RGSVVQESPV TKSGHNSLPT GVAPNLPTIP SASDFNTVLS
2410 2420 2430 2440 2450
SDQNTLDGTH SQHSTSQDDV AGVEEANQGF PAVQLADAQV VFKPLLSHTG
2460 2470 2480 2490 2500
IQSQDTMPLC YRMYFGEHLS FSGTLDCLRA DIVDSDTAKD RKGKRARRQG
2510 2520 2530 2540 2550
HVNLPPLEFK PALMLETFSI SAVVMEKSVC TPQNSTSALS FHDLNKRYYN
2560 2570 2580 2590 2600
TFHCNFTISC QSISQHVDMA LVRLIHQFST MIDDIKATQT DIKLSRYTAG
2610 2620 2630 2640 2650
SASPTPTFKT RKHRDFRSSD FSRSSRGSLN GGNRVNNAKN KRANNENNKK
2660 2670 2680 2690 2700
ESRNKNSLGR SERRTSKVSR KGSKDVVDHM TIHMDDSDSI TVSEQSEPSA
2710 2720 2730 2740 2750
ECWQNMYKLL NFYSLISDPT GILEKSSETF GPAGVRSPTE PTCRVVFENE
2760 2770 2780 2790 2800
QDNNSLTKTQ RKRSLVTSEP QHVTLIVFGI GMVNRTHLEA DIGGLTMESE
2810 2820 2830 2840 2850
LKRIHGSFTL KEKMKDVLHQ KMTETCATAH IGGVNIVLLE GITPNIQLED
2860 2870 2880 2890 2900
FPTSPTSTAK QEFLTVVKCS IAKSQALYSA QRGLKTNNAA VFKVGAISIN
2910 2920 2930 2940 2950
IPQHPATLHS MMVRSSHQLS KQISDLIRQP STAPQPMKED IATPLPSEKT
2960 2970 2980 2990 3000
PTSVNQTPIE TNEFPQLPEG LEKKPIVLKF SAMLDGIAIG AALLPSLKAE
3010 3020 3030 3040 3050
YKMGRMRSHG MTGAQTRFTF ELPNHRLRFT SKVSATDMST IPPSASLNLP
3060 3070 3080 3090 3100
PVTMSGKYIM EEHDSYSDQV WSIDELPSKQ GYYLQGNYLR CVAEVGSFEH
3110 3120 3130 3140 3150
NLTTDLLNHL VFVQKVFMKE VNEVIQKVSG GEQPIPLWNE HDGTTDGDKP
3160 3170 3180 3190 3200
KILLYSLNLQ FKGIQVTATT PSMRAVRFET GLIELELSNR LQTKASPGSS
3210 3220 3230 3240 3250
SYLKLFGKCQ VDLNLALGQI VKHQVYEEAG SDFHQVAYFK TRIGLRNALR
3260 3270 3280 3290 3300
EEISGSSDRE AVLITLNRPI VYAQPVAFDR AVLFWLNYKA AYDNWNEQRM
3310 3320 3330 3340 3350
ALHKDIHMAT KEVVDMLPGI QQTSAQAFGT LFLQLTVNDL GICLPITNTA
3360 3370 3380 3390 3400
QSNHTGDLDT GSALVLTIES TLITACSSES LVSKGHFKNF CIRFADGFET
3410 3420 3430 3440 3450
SWDDWKPEIR GDLVMNACVV PDGTYEVCSR TTGQAAAESS SAGTWTLNVL
3460 3470 3480 3490 3500
WKMCGIDVHM DPNIGKRLNA LGNTLTTLTG EEDIDDIADL NSVNIADLSD
3510 3520 3530 3540 3550
EDEVDTMSPT IHTEAVDYRR QGTSSSQPGE LRGRKIMKRL VDIRELNEQA
3560 3570 3580 3590 3600
KVIDDLKKLG ASEGTINQEI QRYQQLESVA VNDIRRDVRK KLRRSSMRAA
3610 3620 3630 3640 3650
SLKDKWGLGY KPSYSRSKSI SASGRPPLKR MERASSRIGE TDELPEIRVD
3660 3670 3680 3690 3700
AASPGPRVTF NIQDTFPEET ELDLLSVTIE GPSHYSSNSE GSCSVFSSPK
3710 3720 3730 3740 3750
TTGGFSPSVP FQSEDGRRDD SLSSTSEDSE KDEKDEDRER ERFYIYRKPS
3760 3770 3780 3790 3800
HTSRKKATGF AAVHQLLTER WPTTPVNRSL SGTATERNID FELDIRVEID
3810 3820 3830 3840 3850
SGKCVLHPTT LLQEHDDISL RRSYDRSSRS LDQDSPSKKK KFQTNYASTT
3860 3870 3880 3890 3900
HLMTGKKVPS SLQTKPSDLE TTVFYIPGVD VKLHYNSKTL KTESPNASRG
3910 3920 3930 3940 3950
SSLPRTLSKE SKLYGMKDSA ASPSPSPLPC TVQSKTNTLL PPQPPPIPSA
3960 3970 3980 3990 4000
KGKGSGGVKT AKLYAWVALQ SLPEEMVISP CLLDFLEKAL ETIPITPIER
4010 4020 4030 4040 4050
NYTAVSSQDE DMGHFDIPDP MEESTTSLVS SSTSAYSSFP VDVVVYVRVQ
4060 4070 4080 4090 4100
PSQIKFSCLP VSRVECMLKL PSLDLVFSSN RGELETLGTT YPAETVSPGS
4110 4120 4130 4140 4150
NAPQTGAKTS ASKAGMPGSS GLGSPLGRSR HSSSQSDLTG SSSSSSGLSF
4160 4170 4180 4190 4200
TACMSDFSLY VFHPYGAGKQ KSTVSGLTSG SGGLGNVDEE PTSVTGRKDS
4210 4220 4230 4240 4250
LSINLEFVKV SLSRIRRSGG ASFFESQSVS KSTSKMDTTL INISAVCDIG
4260 4270 4280 4290 4300
SASFKYDMRR LSEILAFPRA WYRRSIARRL FLGDQTVNLP TSGPGTPDSI
4310 4320 4330 4340 4350
EGVSQHLSPE SSRKAYCRTW DQPSQSASFT HMPQSPNVFN EHMTNNTMSP
4360 4370 4380 4390 4400
GTAAQSLKSP ASIRSRSVSD SSVPRRDSIS KTSTPVNKSN KAASQQGTPW
4410 4420 4430 4440 4450
ETLVVFAINL KQLNVQMNMS NVMGNTTWTT SGLKSQGRLS VGSNRDREIS
4460 4470 4480 4490 4500
MSVGLGRSQL DSKGGVVGGT IDVNALEMVA HISEHPNQQP NHKIQITMGS
4510 4520 4530 4540 4550
TESRVDYMGS SILMGIFSNA DLKLQDEWKV NLYNALDSSM TDKSEIFVHG
4560 4570 4580 4590 4600
DLKWDIFQVM ISRSTTPDLI KIGMKLQEFF TQQFDTSKRA LSTWGPVPYL
4610 4620 4630 4640 4650
PPKTMTNNLE KNSQEQLLDA AHHRHWPGVL KVVSGCHISL FQVPLPEDGM
4660 4670 4680 4690 4700
QFGGSMSLHG NHMTLACFHG PNFRSKSWAL FHLEEPNIAF WTEAQKIWED
4710 4720 4730 4740 4750
GSSDHSTYIV QTLDFHLGHN TMVTKPCGAL ESPMATITKI TRRRHENPPH
4760 4770 4780 4790 4800
GVASVKEWFN YVTATRNEEL NLLRNVDANN TENSTTVKNS SLLSGFRGGS
4810 4820 4830 4840 4850
SYNHETETIF ALPRMQLEFK SIHVQEPQEP SLQDASLKPK VECSVVTEFT
4860 4870 4880 4890 4900
DHICVTMDAE LIMFLHDLVS AYLKEKEKAI FPPRILSTRP GQKCPLIIHD
4910 4920 4930 4940 4950
DSSSDRDRED SITYTTVDWR DFMCNTWHLE PTLRLISWTG RKIDPVGVDY
4960 4970 4980 4990 5000
ILQKLGFHHA RTTIPKWLQR GVMDPLDKVL SVLIKKLGTA LQDEKEKKGK

DKEEH
Length:5,005
Mass (Da):555,365
Last modified:July 27, 2011 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iF77D939A6D681E8C
GO
Isoform 2 (identifier: A2AAE1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     3665-3665: T → TLKNTVWGSSPQSRSPGEGYFQ

Note: No experimental confirmation available.
Show »
Length:5,026
Mass (Da):557,672
Checksum:iD192131CFD69FBD9
GO
Isoform 3 (identifier: A2AAE1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     3513-3513: T → TSSDGSSVSGDGHKLTFGQRLVNHLLGLAPPNQRYSVPAEYLCDSEMRGSPQSSQSHLKACRAHSWGN
     3665-3665: T → TLKNTVWGSSPQSRSPGEGYFQ
     3915-3949: Missing.

Note: No experimental confirmation available.Combined sources
Show »
Length:5,058
Mass (Da):561,341
Checksum:iDD523C0050F75937
GO
Isoform 4 (identifier: A2AAE1-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-386: Missing.
     871-871: Missing.

Note: No experimental confirmation available.
Show »
Length:4,618
Mass (Da):510,348
Checksum:iF48EF71448356766
GO
Isoform 5 (identifier: A2AAE1-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     872-877: QRPPVD → VMSNDI
     878-5005: Missing.

Show »
Length:877
Mass (Da):100,985
Checksum:iC1F159D5BA103E2B
GO
Isoform 6 (identifier: A2AAE1-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     3915-3949: Missing.

Note: No experimental confirmation available.
Show »
Length:4,970
Mass (Da):551,841
Checksum:iE9C64486593719FA
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A1D5RMC4A0A1D5RMC4_MOUSE
RIKEN cDNA 4932438A13 gene
4932438A13Rik
2,864Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A2AB97A2AB97_MOUSE
RIKEN cDNA 4932438A13 gene
4932438A13Rik
1,507Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6YAT5F6YAT5_MOUSE
RIKEN cDNA 4932438A13 gene
4932438A13Rik
1,586Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6RPM4F6RPM4_MOUSE
RIKEN cDNA 4932438A13 gene
4932438A13Rik
1,711Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RI50D6RI50_MOUSE
RIKEN cDNA 4932438A13 gene
4932438A13Rik
329Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6YB09F6YB09_MOUSE
RIKEN cDNA 4932438A13 gene
4932438A13Rik
227Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6Q4Y5F6Q4Y5_MOUSE
RIKEN cDNA 4932438A13 gene
4932438A13Rik
243Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH27125 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence AAH79623 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence BAC31019 differs from that shown. Reason: Frameshift.Curated
The sequence BAC31019 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence BAC35104 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence BAD90190 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated
The sequence CAM28060 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence CAM28069 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti293L → I in BAE28401 (PubMed:16141072).Curated1
Sequence conflicti314D → E in BAE28401 (PubMed:16141072).Curated1
Sequence conflicti391T → A in BAE28401 (PubMed:16141072).Curated1
Sequence conflicti706S → C in BAE28401 (PubMed:16141072).Curated1
Sequence conflicti707M → T in BAE28401 (PubMed:16141072).Curated1
Sequence conflicti997I → V in BAD90190 (Ref. 3) Curated1
Sequence conflicti997I → V in AAH34738 (PubMed:15489334).Curated1
Sequence conflicti4100S → N in BAD32378 (PubMed:15368895).Curated1
Sequence conflicti4450S → R in AAH27125 (PubMed:15489334).Curated1
Sequence conflicti4451M → V in AAH27125 (PubMed:15489334).Curated1
Sequence conflicti4582Q → K in BAC35104 (PubMed:16141072).Curated1
Sequence conflicti4606T → A in BAD32378 (PubMed:15368895).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0310321 – 386Missing in isoform 4. 1 PublicationAdd BLAST386
Alternative sequenceiVSP_031033871Missing in isoform 4. 1 Publication1
Alternative sequenceiVSP_031034872 – 877QRPPVD → VMSNDI in isoform 5. 1 Publication6
Alternative sequenceiVSP_031035878 – 5005Missing in isoform 5. 1 PublicationAdd BLAST4128
Alternative sequenceiVSP_0310363513T → TSSDGSSVSGDGHKLTFGQR LVNHLLGLAPPNQRYSVPAE YLCDSEMRGSPQSSQSHLKA CRAHSWGN in isoform 3. 1 Publication1
Alternative sequenceiVSP_0310373665T → TLKNTVWGSSPQSRSPGEGY FQ in isoform 2 and isoform 3. 2 Publications1
Alternative sequenceiVSP_0310383915 – 3949Missing in isoform 3 and isoform 6. 2 PublicationsAdd BLAST35

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK028716 mRNA Translation: BAC26080.1
AK041642 mRNA Translation: BAC31019.1 Sequence problems.
AK052702 mRNA Translation: BAC35104.1 Different initiation.
AK134811 mRNA Translation: BAE22295.1
AK148181 mRNA Translation: BAE28401.1
AL627102 Genomic DNA No translation available.
AL691425, AL645759, AL662823 Genomic DNA Translation: CAM18175.4
AL662823, AL645759, AL691425 Genomic DNA Translation: CAM18416.3
AL645759, AL662823, AL691425 Genomic DNA Translation: CAM24476.3
AL645753, AL645806 Genomic DNA Translation: CAM28060.1 Sequence problems.
AL645753, AL645806 Genomic DNA Translation: CAM28062.1
AL645806, AL645753 Genomic DNA Translation: CAM28069.1 Sequence problems.
AL645806, AL645753 Genomic DNA Translation: CAM28070.1
AK220265 mRNA Translation: BAD90190.1 Different initiation.
BC027125 mRNA Translation: AAH27125.3 Different initiation.
BC034738 mRNA Translation: AAH34738.1
BC079623 mRNA Translation: AAH79623.1 Different initiation.
AK173100 mRNA Translation: BAD32378.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS50894.1 [A2AAE1-1]

NCBI Reference Sequences

More...
RefSeqi
NP_766267.2, NM_172679.2 [A2AAE1-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000057272; ENSMUSP00000060199; ENSMUSG00000037270 [A2AAE1-1]
ENSMUST00000152564; ENSMUSP00000117808; ENSMUSG00000037270 [A2AAE1-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
229227

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:229227

UCSC genome browser

More...
UCSCi
uc008ozw.2 mouse [A2AAE1-5]
uc008pab.2 mouse [A2AAE1-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK028716 mRNA Translation: BAC26080.1
AK041642 mRNA Translation: BAC31019.1 Sequence problems.
AK052702 mRNA Translation: BAC35104.1 Different initiation.
AK134811 mRNA Translation: BAE22295.1
AK148181 mRNA Translation: BAE28401.1
AL627102 Genomic DNA No translation available.
AL691425, AL645759, AL662823 Genomic DNA Translation: CAM18175.4
AL662823, AL645759, AL691425 Genomic DNA Translation: CAM18416.3
AL645759, AL662823, AL691425 Genomic DNA Translation: CAM24476.3
AL645753, AL645806 Genomic DNA Translation: CAM28060.1 Sequence problems.
AL645753, AL645806 Genomic DNA Translation: CAM28062.1
AL645806, AL645753 Genomic DNA Translation: CAM28069.1 Sequence problems.
AL645806, AL645753 Genomic DNA Translation: CAM28070.1
AK220265 mRNA Translation: BAD90190.1 Different initiation.
BC027125 mRNA Translation: AAH27125.3 Different initiation.
BC034738 mRNA Translation: AAH34738.1
BC079623 mRNA Translation: AAH79623.1 Different initiation.
AK173100 mRNA Translation: BAD32378.1
CCDSiCCDS50894.1 [A2AAE1-1]
RefSeqiNP_766267.2, NM_172679.2 [A2AAE1-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi230823, 4 interactors
IntActiA2AAE1, 5 interactors
STRINGi10090.ENSMUSP00000060199

PTM databases

iPTMnetiA2AAE1
PhosphoSitePlusiA2AAE1
SwissPalmiA2AAE1

Proteomic databases

jPOSTiA2AAE1
MaxQBiA2AAE1
PaxDbiA2AAE1
PeptideAtlasiA2AAE1
PRIDEiA2AAE1

Genome annotation databases

EnsembliENSMUST00000057272; ENSMUSP00000060199; ENSMUSG00000037270 [A2AAE1-1]
ENSMUST00000152564; ENSMUSP00000117808; ENSMUSG00000037270 [A2AAE1-1]
GeneIDi229227
KEGGimmu:229227
UCSCiuc008ozw.2 mouse [A2AAE1-5]
uc008pab.2 mouse [A2AAE1-1]

Organism-specific databases

MGIiMGI:2444631 4932438A13Rik

Rodent Unidentified Gene-Encoded large proteins database

More...
Rougei
Search...
Search...

Phylogenomic databases

eggNOGiKOG3596 Eukaryota
ENOG410XT7P LUCA
GeneTreeiENSGT00640000091487
InParanoidiA2AAE1
OMAiWKNVLYT
OrthoDBi77777at2759
TreeFamiTF105915

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
4932438A13Rik mouse

Protein Ontology

More...
PROi
PR:A2AAE1

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000037270 Expressed in 270 organ(s), highest expression level in retina
ExpressionAtlasiA2AAE1 baseline and differential
GenevisibleiA2AAE1 MM

Family and domain databases

InterProiView protein in InterPro
IPR018863 Fragile_site-assoc_C
IPR033616 KIAA1109
PANTHERiPTHR31640 PTHR31640, 1 hit
PfamiView protein in Pfam
PF10479 FSA_C, 2 hits
SMARTiView protein in SMART
SM01220 FSA_C, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiK1109_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: A2AAE1
Secondary accession number(s): A2AAD2
, A2AAD4, E9Q376, Q05BP8, Q3UG08, Q3UYB7, Q571C4, Q69ZR8, Q6AXD9, Q8BWF1, Q8BY77, Q8CEA4, Q8R0A8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 5, 2008
Last sequence update: July 27, 2011
Last modified: October 16, 2019
This is version 88 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again