Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Transmembrane protein KIAA1109

Gene

Kiaa1109

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

GO - Biological processi

  • adipose tissue development Source: BHF-UCL
  • fat cell differentiation Source: BHF-UCL
  • lipid metabolic process Source: BHF-UCL
  • lipid storage Source: BHF-UCL
  • nucleus localization Source: BHF-UCL
  • regulation of cell growth Source: BHF-UCL
  • spermatogenesis Source: BHF-UCL
  • synaptic vesicle endocytosis Source: GO_Central

Names & Taxonomyi

Protein namesi
Recommended name:
Transmembrane protein KIAA1109Curated
Alternative name(s):
Fragile site-associated protein homolog
Gene namesi
Name:Kiaa1109
Synonyms:Fsa, Kiaa1371
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 3

Organism-specific databases

MGIiMGI:2444631 4932438A13Rik

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei27 – 47HelicalSequence analysisAdd BLAST21

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003175561 – 5005Transmembrane protein KIAA1109Add BLAST5005

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1301PhosphoserineBy similarity1
Modified residuei1305PhosphoserineBy similarity1
Modified residuei1323PhosphoserineCombined sources1
Modified residuei1325PhosphothreonineBy similarity1
Modified residuei1355PhosphoserineCombined sources1
Modified residuei1406PhosphoserineBy similarity1
Modified residuei1805PhosphoserineCombined sources1
Modified residuei1808PhosphoserineCombined sources1
Modified residuei2601PhosphoserineCombined sources1
Modified residuei2603PhosphoserineBy similarity1
Modified residuei2755PhosphoserineCombined sources1
Modified residuei3562PhosphoserineBy similarity1
Modified residuei3653PhosphoserineCombined sources1
Modified residuei4124PhosphoserineCombined sources1
Isoform 3 (identifier: A2AAE1-3)
Modified residuei3577PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiA2AAE1
PaxDbiA2AAE1
PeptideAtlasiA2AAE1
PRIDEiA2AAE1

PTM databases

iPTMnetiA2AAE1
PhosphoSitePlusiA2AAE1

Expressioni

Tissue specificityi

Highly expressed in testis and ovary. Weakly or not expressed in other tissues.1 Publication

Developmental stagei

Expressed during spermatogenesis and adipogenesis.1 Publication

Gene expression databases

BgeeiENSMUSG00000037270 Expressed in 270 organ(s), highest expression level in retina
CleanExiMM_4932438A13RIK
ExpressionAtlasiA2AAE1 baseline and differential
GenevisibleiA2AAE1 MM

Interactioni

Protein-protein interaction databases

BioGridi230823, 4 interactors
IntActiA2AAE1, 5 interactors
STRINGi10090.ENSMUSP00000060199

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi772 – 779Poly-Ser8
Compositional biasi1154 – 1157Poly-Ser4
Compositional biasi1226 – 1391Ser-richAdd BLAST166
Compositional biasi1417 – 1421Poly-Lys5
Compositional biasi1544 – 1547Poly-Ser4
Compositional biasi1991 – 1994Poly-Pro4
Compositional biasi3838 – 3841Poly-Lys4
Compositional biasi4110 – 4234Ser-richAdd BLAST125

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3596 Eukaryota
ENOG410XT7P LUCA
GeneTreeiENSGT00640000091487
HOVERGENiHBG108027
InParanoidiA2AAE1
OMAiVPTTCNT
OrthoDBiEOG091G004E
TreeFamiTF105915

Family and domain databases

InterProiView protein in InterPro
IPR018863 Fragile_site-assoc_C
IPR033616 KIAA1109
PANTHERiPTHR31640 PTHR31640, 1 hit
PfamiView protein in Pfam
PF10479 FSA_C, 2 hits
SMARTiView protein in SMART
SM01220 FSA_C, 1 hit

Sequences (6+)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: A2AAE1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDQRKNDSIV PSITQLEDFL TEHNSNVVWL LVATILSCGW IIYLTYYNSR
60 70 80 90 100
NVGLILTLVL NRLYKHGYIH IGSFSFSVLS GKVMVREIYY ITEDMSIRIQ
110 120 130 140 150
DGFIIFRWWK MYNPKQKQHD PKAETRLYIT VNDFEFHVYN RSDLYGRLQE
160 170 180 190 200
LFGLEPTIIP PKKDDDKTRE NGRTRTQSKI ERVKVKTESQ DPTSSWRSLI
210 220 230 240 250
PVIKVNVSTG RLAFGNHYQP QTLCINFDDA FLTYTTKPPS SHLDQFMHIV
260 270 280 290 300
KGKLENVRVM LVPSPRYVGL QNDEPPRLMG EGFVVLQSND VDLYYYMDEP
310 320 330 340 350
GLVPEETEES TEGDISSEDC KLQDLPPCWG LDIVCGKGTD FNYGPWADRQ
360 370 380 390 400
RDCLWKFFFP PDYQVLKVSE IAQPGRPRQI LAFELRMNII TDATIDLLFT
410 420 430 440 450
KNRETNAVHV NVGAGSYLEI NIPMTVDENG YTPAIKGQLL HVDATTSMQY
460 470 480 490 500
RTLLEAEMLA FHINASYPRI WNMPQTWQCE LEVYKATYHF IFAQKNFFTD
510 520 530 540 550
LIQDWSSDNA PDIFSFVPYT WNFKIMFHQF EMIWAANQHN WIDCSTKQQE
560 570 580 590 600
NVYLAACGET LNIDFSLPFT DFVPATCNTR FSLRGEDVDL HLFLPDCHPS
610 620 630 640 650
KYSLFMLVKN CHPNKMVPET GIPAECQSGQ KTVKPKWRNV TQEKAGWVEC
660 670 680 690 700
WTVPSVMLTI DYTWHPIYPQ KADEQLKQSL SEMEETMLSV LRPAQKTSER
710 720 730 740 750
VVSSPSMSPR PPVDPSELPP DKLHVEMELS PDSQITLYGP LLNAFLCIKE
760 770 780 790 800
NYFGEDDMYM DFEEVISSPV LSLSTSSSSG WTAVGMDNDK RENESSAKSI
810 820 830 840 850
HPLALRPWDI TVLVNLYKVH GRLPVHGTTD GPECPTAFLE RLCFEMKKGF
860 870 880 890 900
RETMLQLVLS PLNVFVSDNY QQRPPVDEVL REGHINLSGL QLRAHAMFSA
910 920 930 940 950
EGLPLGSDSL EYAWLIDVQA GSLTAKVTAP QLACLLEWGQ TFVFHVVCRE
960 970 980 990 1000
YELERPKSVI VCQHGIDRRF CESKLSCIPG PCPTSDDLKY TMTRLAIDGS
1010 1020 1030 1040 1050
DIYIVEHGCA TNIKMGAVRI ANCNLHNQSV GEGISAAIQD FQVRQYIEQL
1060 1070 1080 1090 1100
NNCRIGLQPA VLRRAYWLEA GSANLGLITV DIALAADHHS KHEAQRHFLE
1110 1120 1130 1140 1150
THDARTKRLW FLWPDDTLKN KRCRNKCGCL GGCRFFGGTV TGLDFFKLEE
1160 1170 1180 1190 1200
LTPSSSSAFS STSAESDMYY GQSLLQPGEW IITKEIPKTV DGNVNSMKRK
1210 1220 1230 1240 1250
EWENKSVGIE GERKTQHLSL QVPLRSHSSS SSSEENSSSS AAQPLLAGEK
1260 1270 1280 1290 1300
ESPSSAADDH SVQKDLLHSA RRDDGQASVP TEISGTSPVS PNTQDKSVGQ
1310 1320 1330 1340 1350
SPLRSPLKRQ ASVCSTRLGS TKSLTAAFYG DKQPVTVGVQ FSSDVSRSDE
1360 1370 1380 1390 1400
NVLDSPKQRR SFGSFPYTPS ADSNSFHQYR SMDSSMSMAD SEAYFSAAEE
1410 1420 1430 1440 1450
FEPISSDEGP GTYPGRKKKK KQMQQIDYSR GSIYHSVEGP LAVHGEGITD
1460 1470 1480 1490 1500
PRTLPFKTHP SQASFVSALG GEDEVIEHVY IVEGEKRGES EQVTSQQPVM
1510 1520 1530 1540 1550
SCYHTYLTQF QVINWSVKHP TNKRTSKSSL HRPLDLDTPT SEESSSSFEQ
1560 1570 1580 1590 1600
LCVPTFKVIK QGLTANSLLD RGMQLSGSTS NTPYTPLDKK IVDTTDDETL
1610 1620 1630 1640 1650
TEEWTLDQPV AQTKTTAIVE VKGTVDVVLT PLVAEALDRY IEAMVHRVST
1660 1670 1680 1690 1700
RHPAAIVDDL HTKVLREAVQ NSKTTFSENL SPKQDIRGTK TEHPMIGTTN
1710 1720 1730 1740 1750
QGQIQTNVTT KQDNVTIKGL QANVSIPKVN LCLLQASVEE SPATVPSRSV
1760 1770 1780 1790 1800
THVSLVALCF DRIATQVRMN RGVVEETANN VDAGKTSNFD RYVHASKMQP
1810 1820 1830 1840 1850
QSSGSLRSNA GAEKGKEIAA KLNIHRVHGQ LRGLDTTDIG TCAITAIPFE
1860 1870 1880 1890 1900
KSKVLFTLEE LDEFTFVDET DQQAIPDVTR IGPSQEKWGW IMFECGLENL
1910 1920 1930 1940 1950
TIKGGRQSGA VLYNSFGIMG KNSVTERGGV LTSNNSSDSP TGSGYNTDVS
1960 1970 1980 1990 2000
DDNLPCDRTS PSSDINGNSV SDEQDEGVES DDLKKDLPLM PPPPDSCSMK
2010 2020 2030 2040 2050
LTIKEIWFSF AAPTNVRSPA HAFSRQLNLL STATPAVGAW LVPIDQLKSS
2060 2070 2080 2090 2100
LNKLETEGTL RICAVMGCIM TEALENKSVH FPLRSKYNRL TKVARFLQEN
2110 2120 2130 2140 2150
PSCLLCNILH HYLHQANYSI IDDATMSDGL PALVTLKKGL VALARQWMKF
2160 2170 2180 2190 2200
IVVTPAFKGV SLHRPAQPLK PPATVDQEHE EGLGLDNGGG LQSDTSADGA
2210 2220 2230 2240 2250
EFEFDAATVS EHTMLLEGTA NRPPPGSSGP VTGAEIMRKL SKTHTHSDSA
2260 2270 2280 2290 2300
LKIKGIHPYH SLSYTSGDTA TDSPVHVGRA GMPVKESPRK ESLLSYLTGS
2310 2320 2330 2340 2350
FPSLHNLLEG TPQRSSAAVK SSSLTRTGNT VATDMLSEHP LLSEPSSVSF
2360 2370 2380 2390 2400
YNWMSNAVGN RGSVVQESPV TKSGHNSLPT GVAPNLPTIP SASDFNTVLS
2410 2420 2430 2440 2450
SDQNTLDGTH SQHSTSQDDV AGVEEANQGF PAVQLADAQV VFKPLLSHTG
2460 2470 2480 2490 2500
IQSQDTMPLC YRMYFGEHLS FSGTLDCLRA DIVDSDTAKD RKGKRARRQG
2510 2520 2530 2540 2550
HVNLPPLEFK PALMLETFSI SAVVMEKSVC TPQNSTSALS FHDLNKRYYN
2560 2570 2580 2590 2600
TFHCNFTISC QSISQHVDMA LVRLIHQFST MIDDIKATQT DIKLSRYTAG
2610 2620 2630 2640 2650
SASPTPTFKT RKHRDFRSSD FSRSSRGSLN GGNRVNNAKN KRANNENNKK
2660 2670 2680 2690 2700
ESRNKNSLGR SERRTSKVSR KGSKDVVDHM TIHMDDSDSI TVSEQSEPSA
2710 2720 2730 2740 2750
ECWQNMYKLL NFYSLISDPT GILEKSSETF GPAGVRSPTE PTCRVVFENE
2760 2770 2780 2790 2800
QDNNSLTKTQ RKRSLVTSEP QHVTLIVFGI GMVNRTHLEA DIGGLTMESE
2810 2820 2830 2840 2850
LKRIHGSFTL KEKMKDVLHQ KMTETCATAH IGGVNIVLLE GITPNIQLED
2860 2870 2880 2890 2900
FPTSPTSTAK QEFLTVVKCS IAKSQALYSA QRGLKTNNAA VFKVGAISIN
2910 2920 2930 2940 2950
IPQHPATLHS MMVRSSHQLS KQISDLIRQP STAPQPMKED IATPLPSEKT
2960 2970 2980 2990 3000
PTSVNQTPIE TNEFPQLPEG LEKKPIVLKF SAMLDGIAIG AALLPSLKAE
3010 3020 3030 3040 3050
YKMGRMRSHG MTGAQTRFTF ELPNHRLRFT SKVSATDMST IPPSASLNLP
3060 3070 3080 3090 3100
PVTMSGKYIM EEHDSYSDQV WSIDELPSKQ GYYLQGNYLR CVAEVGSFEH
3110 3120 3130 3140 3150
NLTTDLLNHL VFVQKVFMKE VNEVIQKVSG GEQPIPLWNE HDGTTDGDKP
3160 3170 3180 3190 3200
KILLYSLNLQ FKGIQVTATT PSMRAVRFET GLIELELSNR LQTKASPGSS
3210 3220 3230 3240 3250
SYLKLFGKCQ VDLNLALGQI VKHQVYEEAG SDFHQVAYFK TRIGLRNALR
3260 3270 3280 3290 3300
EEISGSSDRE AVLITLNRPI VYAQPVAFDR AVLFWLNYKA AYDNWNEQRM
3310 3320 3330 3340 3350
ALHKDIHMAT KEVVDMLPGI QQTSAQAFGT LFLQLTVNDL GICLPITNTA
3360 3370 3380 3390 3400
QSNHTGDLDT GSALVLTIES TLITACSSES LVSKGHFKNF CIRFADGFET
3410 3420 3430 3440 3450
SWDDWKPEIR GDLVMNACVV PDGTYEVCSR TTGQAAAESS SAGTWTLNVL
3460 3470 3480 3490 3500
WKMCGIDVHM DPNIGKRLNA LGNTLTTLTG EEDIDDIADL NSVNIADLSD
3510 3520 3530 3540 3550
EDEVDTMSPT IHTEAVDYRR QGTSSSQPGE LRGRKIMKRL VDIRELNEQA
3560 3570 3580 3590 3600
KVIDDLKKLG ASEGTINQEI QRYQQLESVA VNDIRRDVRK KLRRSSMRAA
3610 3620 3630 3640 3650
SLKDKWGLGY KPSYSRSKSI SASGRPPLKR MERASSRIGE TDELPEIRVD
3660 3670 3680 3690 3700
AASPGPRVTF NIQDTFPEET ELDLLSVTIE GPSHYSSNSE GSCSVFSSPK
3710 3720 3730 3740 3750
TTGGFSPSVP FQSEDGRRDD SLSSTSEDSE KDEKDEDRER ERFYIYRKPS
3760 3770 3780 3790 3800
HTSRKKATGF AAVHQLLTER WPTTPVNRSL SGTATERNID FELDIRVEID
3810 3820 3830 3840 3850
SGKCVLHPTT LLQEHDDISL RRSYDRSSRS LDQDSPSKKK KFQTNYASTT
3860 3870 3880 3890 3900
HLMTGKKVPS SLQTKPSDLE TTVFYIPGVD VKLHYNSKTL KTESPNASRG
3910 3920 3930 3940 3950
SSLPRTLSKE SKLYGMKDSA ASPSPSPLPC TVQSKTNTLL PPQPPPIPSA
3960 3970 3980 3990 4000
KGKGSGGVKT AKLYAWVALQ SLPEEMVISP CLLDFLEKAL ETIPITPIER
4010 4020 4030 4040 4050
NYTAVSSQDE DMGHFDIPDP MEESTTSLVS SSTSAYSSFP VDVVVYVRVQ
4060 4070 4080 4090 4100
PSQIKFSCLP VSRVECMLKL PSLDLVFSSN RGELETLGTT YPAETVSPGS
4110 4120 4130 4140 4150
NAPQTGAKTS ASKAGMPGSS GLGSPLGRSR HSSSQSDLTG SSSSSSGLSF
4160 4170 4180 4190 4200
TACMSDFSLY VFHPYGAGKQ KSTVSGLTSG SGGLGNVDEE PTSVTGRKDS
4210 4220 4230 4240 4250
LSINLEFVKV SLSRIRRSGG ASFFESQSVS KSTSKMDTTL INISAVCDIG
4260 4270 4280 4290 4300
SASFKYDMRR LSEILAFPRA WYRRSIARRL FLGDQTVNLP TSGPGTPDSI
4310 4320 4330 4340 4350
EGVSQHLSPE SSRKAYCRTW DQPSQSASFT HMPQSPNVFN EHMTNNTMSP
4360 4370 4380 4390 4400
GTAAQSLKSP ASIRSRSVSD SSVPRRDSIS KTSTPVNKSN KAASQQGTPW
4410 4420 4430 4440 4450
ETLVVFAINL KQLNVQMNMS NVMGNTTWTT SGLKSQGRLS VGSNRDREIS
4460 4470 4480 4490 4500
MSVGLGRSQL DSKGGVVGGT IDVNALEMVA HISEHPNQQP NHKIQITMGS
4510 4520 4530 4540 4550
TESRVDYMGS SILMGIFSNA DLKLQDEWKV NLYNALDSSM TDKSEIFVHG
4560 4570 4580 4590 4600
DLKWDIFQVM ISRSTTPDLI KIGMKLQEFF TQQFDTSKRA LSTWGPVPYL
4610 4620 4630 4640 4650
PPKTMTNNLE KNSQEQLLDA AHHRHWPGVL KVVSGCHISL FQVPLPEDGM
4660 4670 4680 4690 4700
QFGGSMSLHG NHMTLACFHG PNFRSKSWAL FHLEEPNIAF WTEAQKIWED
4710 4720 4730 4740 4750
GSSDHSTYIV QTLDFHLGHN TMVTKPCGAL ESPMATITKI TRRRHENPPH
4760 4770 4780 4790 4800
GVASVKEWFN YVTATRNEEL NLLRNVDANN TENSTTVKNS SLLSGFRGGS
4810 4820 4830 4840 4850
SYNHETETIF ALPRMQLEFK SIHVQEPQEP SLQDASLKPK VECSVVTEFT
4860 4870 4880 4890 4900
DHICVTMDAE LIMFLHDLVS AYLKEKEKAI FPPRILSTRP GQKCPLIIHD
4910 4920 4930 4940 4950
DSSSDRDRED SITYTTVDWR DFMCNTWHLE PTLRLISWTG RKIDPVGVDY
4960 4970 4980 4990 5000
ILQKLGFHHA RTTIPKWLQR GVMDPLDKVL SVLIKKLGTA LQDEKEKKGK

DKEEH
Length:5,005
Mass (Da):555,365
Last modified:July 27, 2011 - v4
Checksum:iF77D939A6D681E8C
GO
Isoform 2 (identifier: A2AAE1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     3665-3665: T → TLKNTVWGSSPQSRSPGEGYFQ

Note: No experimental confirmation available.
Show »
Length:5,026
Mass (Da):557,672
Checksum:iD192131CFD69FBD9
GO
Isoform 3 (identifier: A2AAE1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     3513-3513: T → TSSDGSSVSGDGHKLTFGQRLVNHLLGLAPPNQRYSVPAEYLCDSEMRGSPQSSQSHLKACRAHSWGN
     3665-3665: T → TLKNTVWGSSPQSRSPGEGYFQ
     3915-3949: Missing.

Note: No experimental confirmation available.Combined sources
Show »
Length:5,058
Mass (Da):561,341
Checksum:iDD523C0050F75937
GO
Isoform 4 (identifier: A2AAE1-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-386: Missing.
     871-871: Missing.

Note: No experimental confirmation available.
Show »
Length:4,618
Mass (Da):510,348
Checksum:iF48EF71448356766
GO
Isoform 5 (identifier: A2AAE1-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     872-877: QRPPVD → VMSNDI
     878-5005: Missing.

Show »
Length:877
Mass (Da):100,985
Checksum:iC1F159D5BA103E2B
GO
Isoform 6 (identifier: A2AAE1-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     3915-3949: Missing.

Note: No experimental confirmation available.
Show »
Length:4,970
Mass (Da):551,841
Checksum:iE9C64486593719FA
GO

Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A1D5RMC4A0A1D5RMC4_MOUSE
RIKEN cDNA 4932438A13 gene
4932438A13Rik
2,864Annotation score:
D6RI50D6RI50_MOUSE
RIKEN cDNA 4932438A13 gene
4932438A13Rik
329Annotation score:
A2AB97A2AB97_MOUSE
RIKEN cDNA 4932438A13 gene
4932438A13Rik
1,507Annotation score:
F6YAT5F6YAT5_MOUSE
RIKEN cDNA 4932438A13 gene
4932438A13Rik
1,586Annotation score:
F6RPM4F6RPM4_MOUSE
RIKEN cDNA 4932438A13 gene
4932438A13Rik
1,711Annotation score:
F6Q4Y5F6Q4Y5_MOUSE
RIKEN cDNA 4932438A13 gene
4932438A13Rik
243Annotation score:
F6YB09F6YB09_MOUSE
RIKEN cDNA 4932438A13 gene
4932438A13Rik
227Annotation score:

Sequence cautioni

The sequence AAH27125 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAH79623 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAC31019 differs from that shown. Reason: Frameshift at position 4985.Curated
The sequence BAC31019 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAC35104 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAD90190 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence CAM28060 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence CAM28069 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti293L → I in BAE28401 (PubMed:16141072).Curated1
Sequence conflicti314D → E in BAE28401 (PubMed:16141072).Curated1
Sequence conflicti391T → A in BAE28401 (PubMed:16141072).Curated1
Sequence conflicti706S → C in BAE28401 (PubMed:16141072).Curated1
Sequence conflicti707M → T in BAE28401 (PubMed:16141072).Curated1
Sequence conflicti997I → V in BAD90190 (Ref. 3) Curated1
Sequence conflicti997I → V in AAH34738 (PubMed:15489334).Curated1
Sequence conflicti4100S → N in BAD32378 (PubMed:15368895).Curated1
Sequence conflicti4450S → R in AAH27125 (PubMed:15489334).Curated1
Sequence conflicti4451M → V in AAH27125 (PubMed:15489334).Curated1
Sequence conflicti4582Q → K in BAC35104 (PubMed:16141072).Curated1
Sequence conflicti4606T → A in BAD32378 (PubMed:15368895).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0310321 – 386Missing in isoform 4. 1 PublicationAdd BLAST386
Alternative sequenceiVSP_031033871Missing in isoform 4. 1 Publication1
Alternative sequenceiVSP_031034872 – 877QRPPVD → VMSNDI in isoform 5. 1 Publication6
Alternative sequenceiVSP_031035878 – 5005Missing in isoform 5. 1 PublicationAdd BLAST4128
Alternative sequenceiVSP_0310363513T → TSSDGSSVSGDGHKLTFGQR LVNHLLGLAPPNQRYSVPAE YLCDSEMRGSPQSSQSHLKA CRAHSWGN in isoform 3. 1 Publication1
Alternative sequenceiVSP_0310373665T → TLKNTVWGSSPQSRSPGEGY FQ in isoform 2 and isoform 3. 2 Publications1
Alternative sequenceiVSP_0310383915 – 3949Missing in isoform 3 and isoform 6. 2 PublicationsAdd BLAST35

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK028716 mRNA Translation: BAC26080.1
AK041642 mRNA Translation: BAC31019.1 Sequence problems.
AK052702 mRNA Translation: BAC35104.1 Different initiation.
AK134811 mRNA Translation: BAE22295.1
AK148181 mRNA Translation: BAE28401.1
AL627102 Genomic DNA No translation available.
AL691425, AL645759, AL662823 Genomic DNA Translation: CAM18175.4
AL662823, AL645759, AL691425 Genomic DNA Translation: CAM18416.3
AL645759, AL662823, AL691425 Genomic DNA Translation: CAM24476.3
AL645753, AL645806 Genomic DNA Translation: CAM28060.1 Sequence problems.
AL645753, AL645806 Genomic DNA Translation: CAM28062.1
AL645806, AL645753 Genomic DNA Translation: CAM28069.1 Sequence problems.
AL645806, AL645753 Genomic DNA Translation: CAM28070.1
AK220265 mRNA Translation: BAD90190.1 Different initiation.
BC027125 mRNA Translation: AAH27125.3 Different initiation.
BC034738 mRNA Translation: AAH34738.1
BC079623 mRNA Translation: AAH79623.1 Different initiation.
AK173100 mRNA Translation: BAD32378.1
CCDSiCCDS50894.1 [A2AAE1-1]
RefSeqiNP_766267.2, NM_172679.2 [A2AAE1-1]
UniGeneiMm.207907

Genome annotation databases

EnsembliENSMUST00000057272; ENSMUSP00000060199; ENSMUSG00000037270 [A2AAE1-1]
ENSMUST00000152564; ENSMUSP00000117808; ENSMUSG00000037270 [A2AAE1-1]
GeneIDi229227
KEGGimmu:229227
UCSCiuc008ozw.2 mouse [A2AAE1-5]
uc008pab.2 mouse [A2AAE1-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK028716 mRNA Translation: BAC26080.1
AK041642 mRNA Translation: BAC31019.1 Sequence problems.
AK052702 mRNA Translation: BAC35104.1 Different initiation.
AK134811 mRNA Translation: BAE22295.1
AK148181 mRNA Translation: BAE28401.1
AL627102 Genomic DNA No translation available.
AL691425, AL645759, AL662823 Genomic DNA Translation: CAM18175.4
AL662823, AL645759, AL691425 Genomic DNA Translation: CAM18416.3
AL645759, AL662823, AL691425 Genomic DNA Translation: CAM24476.3
AL645753, AL645806 Genomic DNA Translation: CAM28060.1 Sequence problems.
AL645753, AL645806 Genomic DNA Translation: CAM28062.1
AL645806, AL645753 Genomic DNA Translation: CAM28069.1 Sequence problems.
AL645806, AL645753 Genomic DNA Translation: CAM28070.1
AK220265 mRNA Translation: BAD90190.1 Different initiation.
BC027125 mRNA Translation: AAH27125.3 Different initiation.
BC034738 mRNA Translation: AAH34738.1
BC079623 mRNA Translation: AAH79623.1 Different initiation.
AK173100 mRNA Translation: BAD32378.1
CCDSiCCDS50894.1 [A2AAE1-1]
RefSeqiNP_766267.2, NM_172679.2 [A2AAE1-1]
UniGeneiMm.207907

3D structure databases

ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi230823, 4 interactors
IntActiA2AAE1, 5 interactors
STRINGi10090.ENSMUSP00000060199

PTM databases

iPTMnetiA2AAE1
PhosphoSitePlusiA2AAE1

Proteomic databases

MaxQBiA2AAE1
PaxDbiA2AAE1
PeptideAtlasiA2AAE1
PRIDEiA2AAE1

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000057272; ENSMUSP00000060199; ENSMUSG00000037270 [A2AAE1-1]
ENSMUST00000152564; ENSMUSP00000117808; ENSMUSG00000037270 [A2AAE1-1]
GeneIDi229227
KEGGimmu:229227
UCSCiuc008ozw.2 mouse [A2AAE1-5]
uc008pab.2 mouse [A2AAE1-1]

Organism-specific databases

MGIiMGI:2444631 4932438A13Rik
RougeiSearch...
Search...

Phylogenomic databases

eggNOGiKOG3596 Eukaryota
ENOG410XT7P LUCA
GeneTreeiENSGT00640000091487
HOVERGENiHBG108027
InParanoidiA2AAE1
OMAiVPTTCNT
OrthoDBiEOG091G004E
TreeFamiTF105915

Miscellaneous databases

ChiTaRSi4932438A13Rik mouse
PROiPR:A2AAE1
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000037270 Expressed in 270 organ(s), highest expression level in retina
CleanExiMM_4932438A13RIK
ExpressionAtlasiA2AAE1 baseline and differential
GenevisibleiA2AAE1 MM

Family and domain databases

InterProiView protein in InterPro
IPR018863 Fragile_site-assoc_C
IPR033616 KIAA1109
PANTHERiPTHR31640 PTHR31640, 1 hit
PfamiView protein in Pfam
PF10479 FSA_C, 2 hits
SMARTiView protein in SMART
SM01220 FSA_C, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiK1109_MOUSE
AccessioniPrimary (citable) accession number: A2AAE1
Secondary accession number(s): A2AAD2
, A2AAD4, E9Q376, Q05BP8, Q3UG08, Q3UYB7, Q571C4, Q69ZR8, Q6AXD9, Q8BWF1, Q8BY77, Q8CEA4, Q8R0A8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 5, 2008
Last sequence update: July 27, 2011
Last modified: November 7, 2018
This is version 84 of the entry and version 4 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again