Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 72 (13 Feb 2019)
Sequence version 1 (20 Feb 2007)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Uncharacterized protein KIAA1522

Gene

Kiaa1522

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

  • cell differentiation Source: GO_Central

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Uncharacterized protein KIAA1522
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Kiaa1522
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:2140651 C77080

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003112471 – 1013Uncharacterized protein KIAA1522Add BLAST1013

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei92PhosphoserineCombined sources1
Modified residuei108PhosphotyrosineCombined sources1
Modified residuei136PhosphoserineBy similarity1
Modified residuei143PhosphoserineBy similarity1
Modified residuei159PhosphoserineBy similarity1
Modified residuei160PhosphothreonineBy similarity1
Modified residuei213PhosphoserineCombined sources1
Modified residuei318Asymmetric dimethylarginineCombined sources1
Modified residuei320PhosphoserineBy similarity1
Modified residuei325PhosphoserineCombined sources1
Modified residuei328PhosphoserineCombined sources1
Modified residuei336PhosphoserineBy similarity1
Modified residuei337PhosphoserineBy similarity1
Modified residuei339PhosphoserineBy similarity1
Modified residuei340PhosphoserineBy similarity1
Modified residuei398PhosphoserineBy similarity1
Modified residuei402PhosphoserineCombined sources1
Modified residuei407PhosphoserineCombined sources1
Modified residuei529PhosphothreonineCombined sources1
Modified residuei543PhosphoserineCombined sources1
Modified residuei591PhosphothreonineBy similarity1
Modified residuei610PhosphoserineCombined sources1
Modified residuei667PhosphoserineBy similarity1
Modified residuei671PhosphoserineBy similarity1
Modified residuei838PhosphoserineCombined sources1
Modified residuei842PhosphoserineCombined sources1
Modified residuei848PhosphoserineBy similarity1
Modified residuei909PhosphoserineCombined sources1
Modified residuei952PhosphoserineCombined sources1
Modified residuei959PhosphoserineCombined sources1
Isoform 2 (identifier: A2A7S8-2)
Modified residuei17PhosphoserineCombined sources1

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - PTMi

Methylation, Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
A2A7S8

MaxQB - The MaxQuant DataBase

More...
MaxQBi
A2A7S8

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
A2A7S8

PRoteomics IDEntifications database

More...
PRIDEi
A2A7S8

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
A2A7S8

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
A2A7S8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000050390 Expressed in 204 organ(s), highest expression level in saccule of membranous labyrinth

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
A2A7S8 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
A2A7S8 MM

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
A2A7S8

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
A2A7S8

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi152 – 158Poly-Arg7
Compositional biasi311 – 429Ser-richAdd BLAST119
Compositional biasi436 – 963Pro-richAdd BLAST528

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IMX5 Eukaryota
ENOG410YI5V LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154214

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG108037

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
A2A7S8

Identification of Orthologs from Complete Genome Data

More...
OMAi
SAGSWVP

Database of Orthologous Groups

More...
OrthoDBi
315746at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
A2A7S8

TreeFam database of animal gene trees

More...
TreeFami
TF333323

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: A2A7S8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVVFLGRHLP ALLEVFKKGS AKAESDNRQG AGPSQGPGSV GDELQDNVFF
60 70 80 90 100
PSGRPPHLEE LHTQAQEGLR SLQHQERQKL SKGGWDHGDT QSIQSSQTGP
110 120 130 140 150
DEDTISIYSQ KSYMTESSTA EDALSVRSEM IQRRGSTFRP HDSFPKSGKS
160 170 180 190 200
GRRRRERRST VLGLPQHVQK ELGLRNNREA PGTPQPPGSR DAVRIPTVDG
210 220 230 240 250
RPGLALGTGV RVSLQALEAE TEAGTDAEAV IQRHIDRVYH DDTLVGRSTG
260 270 280 290 300
ARPPPLTRPM SLAVPGLTGG AGSPEPLSPA MSISPQATYL SKLIPHAVLP
310 320 330 340 350
PTVDVVALGR SSLRTLSRCS LLSASPASVR SLGRFSSASS PRPRSRNASS
360 370 380 390 400
SSDNWSHSQS SETIVSDGST LSSKGGSEGQ PEGSVASNNV APPPPGGSGR
410 420 430 440 450
GSPSGGSTAE TSDTASIRSS GQLSGRSVSL RKMKRPPPPP RRTYSLHQRG
460 470 480 490 500
SAVPDGPLGL PPKPERKQQP QLPRPPTAGG SSGVGAVSCP PSSAGTWGSG
510 520 530 540 550
LSPGGSRRPP RSPERTLSPS SGYSSQSGTP TLPPKGLAVA PASPGKAQPP
560 570 580 590 600
KPDRVTSLRS PGASVSSSLT SLCSSSSDPT PLDRSGPQMS TPLSDRFVIP
610 620 630 640 650
PHPKVPAPFS PPPSKSKSSN QAAPVLAAPA VAPGQVSTID TSPASPSMPQ
660 670 680 690 700
TTLTPAQESP VASKDESPPP SPPPSYHPPP PPTKKPEVLE EAPPPPEAAV
710 720 730 740 750
EILPDPSWPP PPPPAPEEQD LSMADFPPPE EVFFNAGPEL GPLESCSSEA
760 770 780 790 800
AVPPAASLSQ TPPPAPPPSS GSEPLARLPQ KDSVGKHSGA PREDSGTPLV
810 820 830 840 850
TPSLLQMVRL RSVGASTGIP NPSPGSSAPQ KPLRRALSGR ASPVTAPSSG
860 870 880 890 900
LHAAVRLKAS SLAASESPAS ALPTGIPEAE PRSPQSPASK ASFIFSKGTK
910 920 930 940 950
KLQLERPVSP EAQADLQRNL VAELRSISEH RPPPQAQKKP SKAPPPVARK
960 970 980 990 1000
PSVGVPPPSP SLPRTESLTA PSTNGLPHAE DRTNGELAEN GGVQLAATEK
1010
MGSPGSDPQK KLV
Length:1,013
Mass (Da):104,842
Last modified:February 20, 2007 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i0E7A98C1A1D4382F
GO
Isoform 2 (identifier: A2A7S8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-18: MVVFLGRHLPALLEVFKK → MAARAPPAAP...KAKRAKGKSR

Show »
Length:1,070
Mass (Da):110,654
Checksum:i17A5D33C892BE777
GO
Isoform 3 (identifier: A2A7S8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-113: Missing.

Show »
Length:900
Mass (Da):92,490
Checksum:i6E8A45B9A5DE396F
GO
Isoform 4 (identifier: A2A7S8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-18: MVVFLGRHLPALLEVFKK → MGNSHHKRKAPSGPRTRSFWRFGRSAKRPA

Show »
Length:1,025
Mass (Da):106,209
Checksum:i74AF88E5BC571875
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D3Z0K5D3Z0K5_MOUSE
Expressed sequence C77080
C77080
18Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D3Z770D3Z770_MOUSE
Expressed sequence C77080
C77080
11Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAC98192 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti221T → P in BAE20526 (PubMed:16141072).Curated1
Sequence conflicti231I → L in BAE20526 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0294591 – 113Missing in isoform 3. 1 PublicationAdd BLAST113
Alternative sequenceiVSP_0294601 – 18MVVFL…EVFKK → MAARAPPAAPAADEPGSPGG PPRRKKSRSGLRRAFSWLRG KRRKKKAAGAEGAESTASRA KKADDKAKRAKGKSR in isoform 2. 1 PublicationAdd BLAST18
Alternative sequenceiVSP_0294611 – 18MVVFL…EVFKK → MGNSHHKRKAPSGPRTRSFW RFGRSAKRPA in isoform 4. 1 PublicationAdd BLAST18

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK129382 mRNA Translation: BAC98192.1 Different initiation.
AK038020 mRNA Translation: BAE20526.1
AK154456 mRNA Translation: BAE32598.1
AK154932 mRNA Translation: BAE32933.1
AL606977 Genomic DNA No translation available.
BC031163 mRNA Translation: AAH31163.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS18686.1 [A2A7S8-2]
CCDS71474.1 [A2A7S8-1]
CCDS71475.1 [A2A7S8-4]

NCBI Reference Sequences

More...
RefSeqi
NP_001028361.1, NM_001033189.3 [A2A7S8-2]
NP_001272794.1, NM_001285865.1 [A2A7S8-4]
NP_001272795.1, NM_001285866.1 [A2A7S8-1]
NP_001272796.1, NM_001285867.1 [A2A7S8-3]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Mm.331907

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000052602; ENSMUSP00000062395; ENSMUSG00000050390 [A2A7S8-2]
ENSMUST00000097873; ENSMUSP00000095483; ENSMUSG00000050390 [A2A7S8-4]
ENSMUST00000106051; ENSMUSP00000101666; ENSMUSG00000050390 [A2A7S8-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
97130

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:97130

UCSC genome browser

More...
UCSCi
uc008uwl.2 mouse [A2A7S8-1]
uc008uwm.2 mouse [A2A7S8-4]
uc008uwn.1 mouse [A2A7S8-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK129382 mRNA Translation: BAC98192.1 Different initiation.
AK038020 mRNA Translation: BAE20526.1
AK154456 mRNA Translation: BAE32598.1
AK154932 mRNA Translation: BAE32933.1
AL606977 Genomic DNA No translation available.
BC031163 mRNA Translation: AAH31163.1
CCDSiCCDS18686.1 [A2A7S8-2]
CCDS71474.1 [A2A7S8-1]
CCDS71475.1 [A2A7S8-4]
RefSeqiNP_001028361.1, NM_001033189.3 [A2A7S8-2]
NP_001272794.1, NM_001285865.1 [A2A7S8-4]
NP_001272795.1, NM_001285866.1 [A2A7S8-1]
NP_001272796.1, NM_001285867.1 [A2A7S8-3]
UniGeneiMm.331907

3D structure databases

ProteinModelPortaliA2A7S8
SMRiA2A7S8
ModBaseiSearch...
MobiDBiSearch...

PTM databases

iPTMnetiA2A7S8
PhosphoSitePlusiA2A7S8

Proteomic databases

jPOSTiA2A7S8
MaxQBiA2A7S8
PaxDbiA2A7S8
PRIDEiA2A7S8

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000052602; ENSMUSP00000062395; ENSMUSG00000050390 [A2A7S8-2]
ENSMUST00000097873; ENSMUSP00000095483; ENSMUSG00000050390 [A2A7S8-4]
ENSMUST00000106051; ENSMUSP00000101666; ENSMUSG00000050390 [A2A7S8-1]
GeneIDi97130
KEGGimmu:97130
UCSCiuc008uwl.2 mouse [A2A7S8-1]
uc008uwm.2 mouse [A2A7S8-4]
uc008uwn.1 mouse [A2A7S8-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
97130
MGIiMGI:2140651 C77080

Rodent Unidentified Gene-Encoded large proteins database

More...
Rougei
Search...

Phylogenomic databases

eggNOGiENOG410IMX5 Eukaryota
ENOG410YI5V LUCA
GeneTreeiENSGT00940000154214
HOVERGENiHBG108037
InParanoidiA2A7S8
OMAiSAGSWVP
OrthoDBi315746at2759
PhylomeDBiA2A7S8
TreeFamiTF333323

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
C77080 mouse

Protein Ontology

More...
PROi
PR:A2A7S8

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000050390 Expressed in 204 organ(s), highest expression level in saccule of membranous labyrinth
ExpressionAtlasiA2A7S8 baseline and differential
GenevisibleiA2A7S8 MM

Family and domain databases

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiK1522_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: A2A7S8
Secondary accession number(s): A2A7S9
, Q3U356, Q3U437, Q3V3N0, Q6ZPN9, Q8K0K8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 13, 2007
Last sequence update: February 20, 2007
Last modified: February 13, 2019
This is version 72 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again