Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 108 (16 Jan 2019)
Sequence version 1 (20 Feb 2007)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

FERM domain-containing protein 3

Gene

FRMD3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Putative tumor suppressor gene that may be implicated in the origin and progression of lung cancer.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

  • actomyosin structure organization Source: GO_Central

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
FERM domain-containing protein 3
Alternative name(s):
Band 4.1-like protein 4O
Ovary type protein 4.1
Short name:
4.1O
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:FRMD3
Synonyms:EPB41L4O
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 9

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000172159.15

Human Gene Nomenclature Database

More...
HGNCi
HGNC:24125 FRMD3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
607619 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_A2A2Y4

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei531 – 551HelicalSequence analysisAdd BLAST21

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
257019

Open Targets

More...
OpenTargetsi
ENSG00000172159

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134903920

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
FRMD3

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003180981 – 597FERM domain-containing protein 3Add BLAST597

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
A2A2Y4

MaxQB - The MaxQuant DataBase

More...
MaxQBi
A2A2Y4

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
A2A2Y4

PRoteomics IDEntifications database

More...
PRIDEi
A2A2Y4

ProteomicsDB human proteome resource

More...
ProteomicsDBi
234
235 [A2A2Y4-2]
236 [A2A2Y4-3]
237 [A2A2Y4-4]
238 [A2A2Y4-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
A2A2Y4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
A2A2Y4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ovary-specific.1 Publication

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed in skeletal muscle, lower levels in thymus and brain.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000172159 Expressed in 200 organ(s), highest expression level in secondary oocyte

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
A2A2Y4 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
A2A2Y4 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA017285

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
129190, 13 interactors

Protein interaction database and analysis system

More...
IntActi
A2A2Y4, 16 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000303508

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
A2A2Y4

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
A2A2Y4

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini32 – 312FERMPROSITE-ProRule annotationAdd BLAST281

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3530 Eukaryota
ENOG410XSWH LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000158577

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG057180

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
A2A2Y4

Identification of Orthologs from Complete Genome Data

More...
OMAi
SQEMKCT

Database of Orthologous Groups

More...
OrthoDBi
484046at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
A2A2Y4

TreeFam database of animal gene trees

More...
TreeFami
TF343477

Family and domain databases

Conserved Domains Database

More...
CDDi
cd14473 FERM_B-lobe, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.80.10, 1 hit
2.30.29.30, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR019749 Band_41_domain
IPR000798 Ez/rad/moesin-like
IPR014847 FERM-adjacent
IPR014352 FERM/acyl-CoA-bd_prot_sf
IPR035963 FERM_2
IPR019748 FERM_central
IPR019747 FERM_CS
IPR000299 FERM_domain
IPR018979 FERM_N
IPR018980 FERM_PH-like_C
IPR011993 PH-like_dom_sf
IPR029071 Ubiquitin-like_domsf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF08736 FA, 1 hit
PF09380 FERM_C, 1 hit
PF00373 FERM_M, 1 hit
PF09379 FERM_N, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00935 BAND41
PR00661 ERMFAMILY

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00295 B41, 1 hit
SM01195 FA, 1 hit
SM01196 FERM_C, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47031 SSF47031, 1 hit
SSF54236 SSF54236, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00660 FERM_1, 1 hit
PS50057 FERM_3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: A2A2Y4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MFASCHCVPR GRRTMKMIHF RSSSVKSLSQ EMRCTIRLLD DSEISCHIQR
60 70 80 90 100
ETKGQFLIDH ICNYYSLLEK DYFGIRYVDP EKQRHWLEPN KSIFKQMKTH
110 120 130 140 150
PPYTMCFRVK FYPHEPLKIK EELTRYLLYL QIKRDIFHGR LLCSFSDAAY
160 170 180 190 200
LGACIVQAEL GDYDPDEHPE NYISEFEIFP KQSQKLERKI VEIHKNELRG
210 220 230 240 250
QSPPVAEFNL LLKAHTLETY GVDPHPCKDS TGTTTFLGFT AAGFVVFQGN
260 270 280 290 300
KRIHLIKWPD VCKLKFEGKT FYVIGTQKEK KAMLAFHTST PAACKHLWKC
310 320 330 340 350
GVENQAFYKY AKSSQIKTVS SSKIFFKGSR FRYSGKVAKE VVEASSKIQR
360 370 380 390 400
EPPEVHRANI TQSRSSHSLN KQLIINMEPL QPLLPSPSEQ EEELPLGEGV
410 420 430 440 450
PLPKEENISA PLISSSPVKA AREYEDPPSE EEDKIKEEPL TISELVYNPS
460 470 480 490 500
ASLLPTPVDD DEIDMLFDCP SRLELEREDT DSFEDLEADE NAFLIAEEEE
510 520 530 540 550
LKEARRALSW SYDILTGHIR VNPLVKSFSR LLVVGLGLLL FVFPLLLLLL
560 570 580 590
ESGIDLSFLC EIRQTPEFEQ FHYEYYCPLK EWVAGKVHLI LYMLGCS
Length:597
Mass (Da):68,772
Last modified:February 20, 2007 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i0B11ABBDDDE0AE67
GO
Isoform 2 (identifier: A2A2Y4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     553-597: GIDLSFLCEIRQTPEFEQFHYEYYCPLKEWVAGKVHLILYMLGCS → VSMQ

Show »
Length:556
Mass (Da):63,864
Checksum:iCD62C83272419CC6
GO
Isoform 3 (identifier: A2A2Y4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-194: Missing.
     195-198: KNEL → MVFR
     553-597: GIDLSFLCEIRQTPEFEQFHYEYYCPLKEWVAGKVHLILYMLGCS → VSMQ

Show »
Length:362
Mass (Da):40,685
Checksum:iB91E6436B98ECC42
GO
Isoform 4 (identifier: A2A2Y4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-344: Missing.
     345-398: SSKIQREPPE...EQEEELPLGE → MQAEETKGIG...LGSKVTARNT
     553-597: GIDLSFLCEIRQTPEFEQFHYEYYCPLKEWVAGKVHLILYMLGCS → VSMQ

Note: No experimental confirmation available.
Show »
Length:213
Mass (Da):23,923
Checksum:iBEAE61103185D1D1
GO
Isoform 5 (identifier: A2A2Y4-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-49: MFASCHCVPRGRRTMKMIHFRSSSVKSLSQEMRCTIRLLDDSEISCHIQ → MQLSK

Show »
Length:553
Mass (Da):63,664
Checksum:i38AD8ADC22D97EE8
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q5JV61Q5JV61_HUMAN
FERM domain-containing protein 3
FRMD3
140Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAC04321 differs from that shown. Reason: Erroneous initiation.Curated
The sequence EAW62650 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti248Q → R in AAN52119 (PubMed:12601556).Curated1
Sequence conflicti554I → V in AAN52119 (PubMed:12601556).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_048366485D → Y. Corresponds to variant dbSNP:rs4877747Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0311621 – 344Missing in isoform 4. 1 PublicationAdd BLAST344
Alternative sequenceiVSP_0311631 – 194Missing in isoform 3. 1 PublicationAdd BLAST194
Alternative sequenceiVSP_0311641 – 49MFASC…SCHIQ → MQLSK in isoform 5. 1 PublicationAdd BLAST49
Alternative sequenceiVSP_031165195 – 198KNEL → MVFR in isoform 3. 1 Publication4
Alternative sequenceiVSP_031166345 – 398SSKIQ…LPLGE → MQAEETKGIGITSMAKCLVK IQTRRSLQLHMVNHCNSNVF VRLLRLGSKVTARNT in isoform 4. 1 PublicationAdd BLAST54
Alternative sequenceiVSP_031167553 – 597GIDLS…MLGCS → VSMQ in isoform 2, isoform 3 and isoform 4. 2 PublicationsAdd BLAST45

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY137774 mRNA Translation: AAN52119.1
AK094281 mRNA Translation: BAC04321.1 Different initiation.
AK297722 mRNA Translation: BAG60076.1
EF560742 mRNA Translation: ABQ59052.1
AL161786 Genomic DNA No translation available.
AL137847 Genomic DNA No translation available.
AL450026 Genomic DNA No translation available.
CH471089 Genomic DNA Translation: EAW62647.1
CH471089 Genomic DNA Translation: EAW62649.1
CH471089 Genomic DNA Translation: EAW62650.1 Different initiation.
CH471089 Genomic DNA Translation: EAW62651.1
BC023560 mRNA Translation: AAH23560.1
BC037253 mRNA Translation: AAH37253.1
AK223597 mRNA Translation: BAD97317.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS43840.1 [A2A2Y4-1]
CCDS59131.1 [A2A2Y4-4]
CCDS59132.1 [A2A2Y4-3]
CCDS59133.1 [A2A2Y4-2]
CCDS75852.1 [A2A2Y4-5]

NCBI Reference Sequences

More...
RefSeqi
NP_001231888.1, NM_001244959.1 [A2A2Y4-2]
NP_001231889.1, NM_001244960.1 [A2A2Y4-5]
NP_001231890.1, NM_001244961.1 [A2A2Y4-3]
NP_001231891.1, NM_001244962.1 [A2A2Y4-4]
NP_777598.3, NM_174938.5 [A2A2Y4-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.127535
Hs.743606

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000304195; ENSP00000303508; ENSG00000172159 [A2A2Y4-1]
ENST00000328788; ENSP00000328615; ENSG00000172159 [A2A2Y4-4]
ENST00000376434; ENSP00000365617; ENSG00000172159 [A2A2Y4-3]
ENST00000376438; ENSP00000365621; ENSG00000172159 [A2A2Y4-2]
ENST00000621208; ENSP00000484839; ENSG00000172159 [A2A2Y4-5]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
257019

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:257019

UCSC genome browser

More...
UCSCi
uc004amq.1 human [A2A2Y4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY137774 mRNA Translation: AAN52119.1
AK094281 mRNA Translation: BAC04321.1 Different initiation.
AK297722 mRNA Translation: BAG60076.1
EF560742 mRNA Translation: ABQ59052.1
AL161786 Genomic DNA No translation available.
AL137847 Genomic DNA No translation available.
AL450026 Genomic DNA No translation available.
CH471089 Genomic DNA Translation: EAW62647.1
CH471089 Genomic DNA Translation: EAW62649.1
CH471089 Genomic DNA Translation: EAW62650.1 Different initiation.
CH471089 Genomic DNA Translation: EAW62651.1
BC023560 mRNA Translation: AAH23560.1
BC037253 mRNA Translation: AAH37253.1
AK223597 mRNA Translation: BAD97317.1
CCDSiCCDS43840.1 [A2A2Y4-1]
CCDS59131.1 [A2A2Y4-4]
CCDS59132.1 [A2A2Y4-3]
CCDS59133.1 [A2A2Y4-2]
CCDS75852.1 [A2A2Y4-5]
RefSeqiNP_001231888.1, NM_001244959.1 [A2A2Y4-2]
NP_001231889.1, NM_001244960.1 [A2A2Y4-5]
NP_001231890.1, NM_001244961.1 [A2A2Y4-3]
NP_001231891.1, NM_001244962.1 [A2A2Y4-4]
NP_777598.3, NM_174938.5 [A2A2Y4-1]
UniGeneiHs.127535
Hs.743606

3D structure databases

ProteinModelPortaliA2A2Y4
SMRiA2A2Y4
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi129190, 13 interactors
IntActiA2A2Y4, 16 interactors
STRINGi9606.ENSP00000303508

PTM databases

iPTMnetiA2A2Y4
PhosphoSitePlusiA2A2Y4

Polymorphism and mutation databases

BioMutaiFRMD3

Proteomic databases

jPOSTiA2A2Y4
MaxQBiA2A2Y4
PaxDbiA2A2Y4
PRIDEiA2A2Y4
ProteomicsDBi234
235 [A2A2Y4-2]
236 [A2A2Y4-3]
237 [A2A2Y4-4]
238 [A2A2Y4-5]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
257019
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000304195; ENSP00000303508; ENSG00000172159 [A2A2Y4-1]
ENST00000328788; ENSP00000328615; ENSG00000172159 [A2A2Y4-4]
ENST00000376434; ENSP00000365617; ENSG00000172159 [A2A2Y4-3]
ENST00000376438; ENSP00000365621; ENSG00000172159 [A2A2Y4-2]
ENST00000621208; ENSP00000484839; ENSG00000172159 [A2A2Y4-5]
GeneIDi257019
KEGGihsa:257019
UCSCiuc004amq.1 human [A2A2Y4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
257019
DisGeNETi257019
EuPathDBiHostDB:ENSG00000172159.15

GeneCards: human genes, protein and diseases

More...
GeneCardsi
FRMD3

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0023043
HGNCiHGNC:24125 FRMD3
HPAiHPA017285
MIMi607619 gene
neXtProtiNX_A2A2Y4
OpenTargetsiENSG00000172159
PharmGKBiPA134903920

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3530 Eukaryota
ENOG410XSWH LUCA
GeneTreeiENSGT00940000158577
HOVERGENiHBG057180
InParanoidiA2A2Y4
OMAiSQEMKCT
OrthoDBi484046at2759
PhylomeDBiA2A2Y4
TreeFamiTF343477

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
FRMD3 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
257019

Protein Ontology

More...
PROi
PR:A2A2Y4

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000172159 Expressed in 200 organ(s), highest expression level in secondary oocyte
ExpressionAtlasiA2A2Y4 baseline and differential
GenevisibleiA2A2Y4 HS

Family and domain databases

CDDicd14473 FERM_B-lobe, 1 hit
Gene3Di1.20.80.10, 1 hit
2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR019749 Band_41_domain
IPR000798 Ez/rad/moesin-like
IPR014847 FERM-adjacent
IPR014352 FERM/acyl-CoA-bd_prot_sf
IPR035963 FERM_2
IPR019748 FERM_central
IPR019747 FERM_CS
IPR000299 FERM_domain
IPR018979 FERM_N
IPR018980 FERM_PH-like_C
IPR011993 PH-like_dom_sf
IPR029071 Ubiquitin-like_domsf
PfamiView protein in Pfam
PF08736 FA, 1 hit
PF09380 FERM_C, 1 hit
PF00373 FERM_M, 1 hit
PF09379 FERM_N, 1 hit
PRINTSiPR00935 BAND41
PR00661 ERMFAMILY
SMARTiView protein in SMART
SM00295 B41, 1 hit
SM01195 FA, 1 hit
SM01196 FERM_C, 1 hit
SUPFAMiSSF47031 SSF47031, 1 hit
SSF54236 SSF54236, 1 hit
PROSITEiView protein in PROSITE
PS00660 FERM_1, 1 hit
PS50057 FERM_3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiFRMD3_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: A2A2Y4
Secondary accession number(s): A8MQB0
, B4DN14, Q53EP2, Q5JV59, Q5VZA1, Q86WP8, Q8IZ44, Q8N3Y5, Q8N9L2
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 5, 2008
Last sequence update: February 20, 2007
Last modified: January 16, 2019
This is version 108 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  2. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again