Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 113 (08 May 2019)
Sequence version 3 (27 Sep 2017)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Multiple C2 and transmembrane domain-containing protein

Gene

Mctp

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Calcium sensor which is essential for the stabilization of normal baseline neurotransmitter release and for the induction and long-term maintenance of presynaptic homeostatic plasticity (PubMed:28485711).1 Publication

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Ca2+1 PublicationNote: Binds Ca2+ via the C2 domains in absence of phospholipids.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • calcium ion binding Source: UniProtKB

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

LigandCalcium

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Multiple C2 and transmembrane domain-containing proteinCurated
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MctpCombined sources
ORF Names:CG15078
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiDrosophila melanogaster (Fruit fly)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri7227 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraHolometabolaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000803 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2R

Organism-specific databases

Drosophila genome database

More...
FlyBasei
FBgn0034389 Mctp

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei729 – 749HelicalSequence analysisAdd BLAST21
Transmembranei826 – 846HelicalSequence analysisAdd BLAST21

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Mutant flies exhibit impaired homeostatic modulation of presynaptic neurotransmitter release and altered baseline neurotransmitter release transmission.1 Publication

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00004417131 – 912Multiple C2 and transmembrane domain-containing proteinAdd BLAST912

Proteomic databases

PRoteomics IDEntifications database

More...
PRIDEi
A1ZBD6

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Motor neurons (at protein level).1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
FBgn0034389 Expressed in 22 organ(s), highest expression level in arthropod fat body

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
A1ZBD6 baseline and differential

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
7227.FBpp0303040

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
A1ZBD6

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini223 – 319C2 1PROSITE-ProRule annotationAdd BLAST97
Domaini391 – 481C2 2PROSITE-ProRule annotationAdd BLAST91
Domaini524 – 619C2 3PROSITE-ProRule annotationAdd BLAST96

Keywords - Domaini

Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1030 Eukaryota
ENOG410XRQN LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000169787

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
A1ZBD6

Identification of Orthologs from Complete Genome Data

More...
OMAi
VILYCIP

Database for complete collections of gene phylogenies

More...
PhylomeDBi
A1ZBD6

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.40.150, 3 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000008 C2_dom
IPR035892 C2_domain_sf
IPR013583 PRibTrfase_C

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00168 C2, 3 hits
PF08372 PRT_C, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00360 C2DOMAIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00239 C2, 3 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50004 C2, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: A1ZBD6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSRIQYVDQV DQVELDQQQQ PGSSSTVSGS TPPLQISPHG SPSLQQSQRL
60 70 80 90 100
GKHLSKSASE LNGHDCHLSE SPHISPKRAK SAVAQQLAGV SSGGVASGVG
110 120 130 140 150
VLQKTHGFFN NLRHRWSRAK SKDRLGRKSP SDFLEESTDY AADYSSEGSS
160 170 180 190 200
VTHSPRHRST TIGGSPLARE FRATAKMAQV IQRFGGSMEG RIDEHPENGS
210 220 230 240 250
AGCSPPELST QQQLEALQAN ELRRKREAQL RQFVFFQLRV HLKSGSDLVA
260 270 280 290 300
MDKNGLSDPY VKFKVGGRLL HKSRTIHRDL NPVWDEVFIV PIEDPFQPII
310 320 330 340 350
VKVFDYDWGL QDDFMGSAKL DLTQLELGKA EDIHLQLCDS SGNGGSGLGE
360 370 380 390 400
ILINLTLWPR SQEDKEMHFQ RNSKLAESSK RLKSQIWSSV VTILLVKAKD
410 420 430 440 450
LPLAEDGSKL NDTHFKFRLG NEKYKSKSSW TERWLEQFDL HLFDEDQNLE
460 470 480 490 500
IALWNRNTLY GKAIIDLSVF QRENTHGIWK PLEDCPGEVH LMLTISGTTA
510 520 530 540 550
LETISDLKAF KEDPREAQLL RERYKFLRCL QNLRDVGHLT VKVFGATGLA
560 570 580 590 600
AADIGGKSDP FCVLELGNAR LQTQTEYKTL TPNWNKIFTF NVKDITQVLE
610 620 630 640 650
ITVFDEDRDH RVEFLGKLVI PLLRIKSGVK RWYTLKDKNL CVRAKGNSPQ
660 670 680 690 700
IQLELTVVWS EIRAVCRALQ PKEEKLIQQE AKFKRQLFLR NVNRLKEIIM
710 720 730 740 750
DILDAARYVQ SCFEWESPVR SSIAFVFWIV ACVYGDLETV PLVLLLIILK
760 770 780 790 800
NWLVRLITGT TDAAAHYDYE YDEDDDDDKE KEEKKSIKER LQAIQEVSQT
810 820 830 840 850
VQNTIGYLAS LGESTINTFN FSVPELTWLA VVLLLGAILV LHFVPLRWLL
860 870 880 890 900
LFWGLMKFSR RLLRPNTIPN NELLDFLSRV PDNEEINQYR ELPPSAPTDQ
910
TRNNPKKKLK GS
Length:912
Mass (Da):103,506
Last modified:September 27, 2017 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iDEFD111068739693
GO
Isoform 2 (identifier: A1ZBD6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-2: MS → MLAGIGHVMQPLHLANSFKSSKNSERPQASVLCHRINKIFPVTA

Show »
Length:954
Mass (Da):108,099
Checksum:iBC43FAB5C21A5903
GO
Isoform 3 (identifier: A1ZBD6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     218-236: Missing.

Show »
Length:893
Mass (Da):101,087
Checksum:i462744BEBCDC1C1D
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q7JZN2Q7JZN2_DROME
Multiple C2 domain and transmembran...
Mctp CG33146, CG33148, Dmel\CG15078, DmMCTP, mctp
596Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AGB93610 differs from that shown. Reason: Erroneous gene model prediction.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0590951 – 2MS → MLAGIGHVMQPLHLANSFKS SKNSERPQASVLCHRINKIF PVTA in isoform 2. 2
Alternative sequenceiVSP_059096218 – 236Missing in isoform 3. Add BLAST19

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AE013599 Genomic DNA Translation: AAO41353.3
AE013599 Genomic DNA Translation: AHN56385.1
AE013599 Genomic DNA Translation: AGB93610.1 Sequence problems.
AE013599 Genomic DNA Translation: ABI31105.2
AE013599 Genomic DNA Translation: ALI30186.1

NCBI Reference Sequences

More...
RefSeqi
NP_001036559.2, NM_001043094.2 [A1ZBD6-2]
NP_001261078.1, NM_001274149.1
NP_001286590.1, NM_001299661.1 [A1ZBD6-3]
NP_001303357.1, NM_001316428.1 [A1ZBD6-1]
NP_611372.3, NM_137528.5 [A1ZBD6-3]

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
FBtr0110970; FBpp0110270; FBgn0034389 [A1ZBD6-3]
FBtr0330005; FBpp0303040; FBgn0034389 [A1ZBD6-2]
FBtr0345950; FBpp0311864; FBgn0034389 [A1ZBD6-3]
FBtr0346955; FBpp0312419; FBgn0034389 [A1ZBD6-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
37165

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
dme:Dmel_CG15078

UCSC genome browser

More...
UCSCi
CG15078-RA d. melanogaster [A1ZBD6-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AE013599 Genomic DNA Translation: AAO41353.3
AE013599 Genomic DNA Translation: AHN56385.1
AE013599 Genomic DNA Translation: AGB93610.1 Sequence problems.
AE013599 Genomic DNA Translation: ABI31105.2
AE013599 Genomic DNA Translation: ALI30186.1
RefSeqiNP_001036559.2, NM_001043094.2 [A1ZBD6-2]
NP_001261078.1, NM_001274149.1
NP_001286590.1, NM_001299661.1 [A1ZBD6-3]
NP_001303357.1, NM_001316428.1 [A1ZBD6-1]
NP_611372.3, NM_137528.5 [A1ZBD6-3]

3D structure databases

SMRiA1ZBD6
ModBaseiSearch...

Protein-protein interaction databases

STRINGi7227.FBpp0303040

Proteomic databases

PRIDEiA1ZBD6

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblMetazoaiFBtr0110970; FBpp0110270; FBgn0034389 [A1ZBD6-3]
FBtr0330005; FBpp0303040; FBgn0034389 [A1ZBD6-2]
FBtr0345950; FBpp0311864; FBgn0034389 [A1ZBD6-3]
FBtr0346955; FBpp0312419; FBgn0034389 [A1ZBD6-1]
GeneIDi37165
KEGGidme:Dmel_CG15078
UCSCiCG15078-RA d. melanogaster [A1ZBD6-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
37165
FlyBaseiFBgn0034389 Mctp

Phylogenomic databases

eggNOGiKOG1030 Eukaryota
ENOG410XRQN LUCA
GeneTreeiENSGT00940000169787
InParanoidiA1ZBD6
OMAiVILYCIP
PhylomeDBiA1ZBD6

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
37165

Protein Ontology

More...
PROi
PR:A1ZBD6

Gene expression databases

BgeeiFBgn0034389 Expressed in 22 organ(s), highest expression level in arthropod fat body
ExpressionAtlasiA1ZBD6 baseline and differential

Family and domain databases

Gene3Di2.60.40.150, 3 hits
InterProiView protein in InterPro
IPR000008 C2_dom
IPR035892 C2_domain_sf
IPR013583 PRibTrfase_C
PfamiView protein in Pfam
PF00168 C2, 3 hits
PF08372 PRT_C, 1 hit
PRINTSiPR00360 C2DOMAIN
SMARTiView protein in SMART
SM00239 C2, 3 hits
PROSITEiView protein in PROSITE
PS50004 C2, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMCTP_DROME
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: A1ZBD6
Secondary accession number(s): A0A0B4KEZ6, A0A0C4DHG8, A0A126GUP9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 27, 2017
Last sequence update: September 27, 2017
Last modified: May 8, 2019
This is version 113 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again