Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 113 (13 Feb 2019)
Sequence version 1 (06 Feb 2007)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Kinesin-like protein unc-104

Gene

unc-104

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Required for presynaptic maturation, has a role in axonal transport of dense-core vesicles carrying synaptic vesicle precursors, components required for the morphological transformation of axonal growth cones to mature boutons.2 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi97 – 104ATPPROSITE-ProRule annotation8

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • ATPase activity Source: GO_Central
  • ATP binding Source: UniProtKB-KW
  • ATP-dependent microtubule motor activity, plus-end-directed Source: GO_Central
  • GTP-dependent protein binding Source: UniProtKB
  • microtubule binding Source: GO_Central
  • microtubule motor activity Source: GO_Central

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionMotor protein
Biological processProtein transport, Transport
LigandATP-binding, Nucleotide-binding

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Kinesin-like protein unc-104
Alternative name(s):
Protein immaculate connections
Short name:
DUnc104
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:unc-104
Synonyms:imac1 Publication
ORF Names:CG8566
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiDrosophila melanogaster (Fruit fly)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri7227 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraHolometabolaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000803 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2R

Organism-specific databases

Drosophila genome database

More...
FlyBasei
FBgn0267002 unc-104

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell projection, Cytoplasm, Cytoskeleton, Microtubule

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Flies prevent nerve endings from transforming to synaptic boutons: growth cones become constricted but remain within contact fields as thin processes that lack varicosities or boutons. Mutant embryos die at late stage, they are paralyzed and lacked the coordinated muscle peristalsis required for hatching.1 Publication

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002994961 – 1670Kinesin-like protein unc-104Add BLAST1670

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1406Phosphothreonine1 Publication1
Modified residuei1416Phosphoserine1 Publication1
Modified residuei1419Phosphothreonine1 Publication1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PRoteomics IDEntifications database

More...
PRIDEi
A1ZAJ2

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
A1ZAJ2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in muscles.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
FBgn0267002 Expressed in 25 organ(s), highest expression level in head

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
A1ZAJ2 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
A1ZAJ2 DM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Monomer (By similarity). Interacts with Arl8 (PubMed:30174114).By similarity1 Publication

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
62585, 2 interactors

Protein interaction database and analysis system

More...
IntActi
A1ZAJ2, 5 interactors

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
A1ZAJ2

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
A1ZAJ2

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini3 – 351Kinesin motorPROSITE-ProRule annotationAdd BLAST349
Domaini499 – 565FHASequence analysisAdd BLAST67
Domaini1537 – 1635PHPROSITE-ProRule annotationAdd BLAST99

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili358 – 436Sequence analysisAdd BLAST79
Coiled coili576 – 674Sequence analysisAdd BLAST99

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Kinesin family. Unc-104 subfamily.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil

Phylogenomic databases

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000168546

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
A1ZAJ2

KEGG Orthology (KO)

More...
KOi
K10392

Database for complete collections of gene phylogenies

More...
PhylomeDBi
A1ZAJ2

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00060 FHA, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.30.29.30, 1 hit
3.40.850.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000253 FHA_dom
IPR022164 Kinesin-like
IPR027640 Kinesin-like_fam
IPR022140 Kinesin-like_KIF1-typ
IPR032405 Kinesin_assoc
IPR019821 Kinesin_motor_CS
IPR001752 Kinesin_motor_dom
IPR036961 Kinesin_motor_dom_sf
IPR027417 P-loop_NTPase
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
IPR008984 SMAD_FHA_dom_sf

The PANTHER Classification System

More...
PANTHERi
PTHR24115 PTHR24115, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF12473 DUF3694, 1 hit
PF00498 FHA, 1 hit
PF12423 KIF1B, 1 hit
PF00225 Kinesin, 1 hit
PF16183 Kinesin_assoc, 2 hits
PF00169 PH, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00380 KINESINHEAVY

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00240 FHA, 1 hit
SM00129 KISc, 1 hit
SM00233 PH, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF49879 SSF49879, 1 hit
SSF52540 SSF52540, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00411 KINESIN_MOTOR_1, 1 hit
PS50067 KINESIN_MOTOR_2, 1 hit
PS50003 PH_DOMAIN, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform B (identifier: A1ZAJ2-1) [UniParc]FASTAAdd to basket
Also known as: C

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSSVKVAVRV RPFNSREIAR ESKCIIEMAG ATTAITNPKV PPNTSDSVKR
60 70 80 90 100
FNFDYSYWSH DHHDADFSTQ SMVYKDIGEE MLQHSFDGYN VCIFAYGQTG
110 120 130 140 150
AGKSYTMMGR QEEQQEGIIP MICKDLFTRI QDTETDDLKY SVEVSYMEIY
160 170 180 190 200
CERVRDLLNP KNKGNLRVRE HPLLGPYVED LSKLAVTDYQ DIHDLIDEGN
210 220 230 240 250
KARTVAATNM NETSSRSHAV FTIFFTQRRH DLMTNLTTEK VSKISLVDLA
260 270 280 290 300
GSERADSTGA KGTRLKEGAN INKSLTTLGK VISALAEVAS KKKNTKKADF
310 320 330 340 350
IPYRDSALTW LLRENLGGNS KTAMIAAISP ADINYDETLS TLRYADRAKQ
360 370 380 390 400
IVCKAVVNED ANAKLIRELK EEIQKLRDLL KAEGIEVQEE DELTKSTVIK
410 420 430 440 450
SPTKSRNRNG STTEMAVDQL QASEKLIAEL NETWEEKLKR TEEIRVQREA
460 470 480 490 500
VFAEMGVAVK EDGITVGVFS PKKTPHLVNL NEDPNLSECL LYYIKEGLTR
510 520 530 540 550
LGTHEANVPQ DIQLSGSHIL KEHCTFENKN STVTLLPHKD AIIYVNGRKL
560 570 580 590 600
VEPEVLKTGS RVILGKNHVF RFTNPEQARE LRDKIETENE AENEVEKTDT
610 620 630 640 650
QQVDWNFAQC ELLEKQGIDL KAEMKKRLDN LEEQYKREKL QADQQFEEQR
660 670 680 690 700
KTYEARIDAL QKQVEEQSMT MSMYSSYSPE DFHQEEDVYT NPMYESCWTA
710 720 730 740 750
REAGLAAWAF RKWRYHQFTS LRDDLWGNAI FLKEANAISV ELKKKVQFQF
760 770 780 790 800
TLLTDTLYSP LPPELASTVA PVHQEDEFGA PPVSKTLVAV EVTDTKNGAT
810 820 830 840 850
HHWSLEKLRQ RLELMREMYH NEAEMSPTSP DYNVESLTGG DPFYDRFPWF
860 870 880 890 900
RMVGRSFIYL SNLLYPVPLV HKVAIVNERG DVRGYLRIAV QPVLDEESID
910 920 930 940 950
FNNGVKQSAR LVFNEDDAKP KYRALNEKDD VQRYIDNGGL DSKLEELEDV
960 970 980 990 1000
DSGRGIDSNS ASECHENSEE PGEHLQVGKE FTFRVTVLQA TGIGAEYADI
1010 1020 1030 1040 1050
FCQFNFLHRH EEAFSTEPVK NSASGAPLGF YHVQNITVPV TKSFIEYLKT
1060 1070 1080 1090 1100
QPIMFKIFGH YQTHPLHKDA KQDFVSRPPP RRMLPPSIPI SQPVRSPKFG
1110 1120 1130 1140 1150
PLPCAPTSTV LAKHDVLVWF EICELAPNGE YVPSVVEHSD DLPCRGLFLL
1160 1170 1180 1190 1200
HQGIQRRIRI TIVHEPTTEV KWKDINELVV GRIRNTPESS DEQDEDACVL
1210 1220 1230 1240 1250
SLGLFPGEAL EVPGDDRSFY RFEAAWDSSL HNSALLNRVS QGGETIYITL
1260 1270 1280 1290 1300
SAYLELENCA RPAIITKDLS MVIYGRDART GPRSLKHLFS GQYRNPEANR
1310 1320 1330 1340 1350
LTGVYELALR RASEAGSPGV QRRQRRVLDT SSTYVRGEEN LHGWRPRGDS
1360 1370 1380 1390 1400
LIFDHQWELE KLTRLEEVGR MRHLLLLRER LGMDTNPNPT TKTEKDVCNL
1410 1420 1430 1440 1450
AARAATSPVH MVIPQSPQTP VKDPQQIIPE REYNQREQDL MLKCLKLVQG
1460 1470 1480 1490 1500
RYTKSEANDT QTQSDVSPSD EGCADMTVSC ISSNSMENNK FVIRRRLCSP
1510 1520 1530 1540 1550
DRADAPNGWE APAPATQPAL PLRLYVPELE EIRVSPVVAR KGLLNVLEHG
1560 1570 1580 1590 1600
GSGWKKRWVI VRRPYVFIYR SEKDPVERAV LNLATAHVEC SEDQAAMVKI
1610 1620 1630 1640 1650
PNTFSVVTKH RGYLLQTLGD KEVHDWLYAI NPLLAGQIKS RLARRTLEPA
1660 1670
SQTASQIQAT NAANANSASK
Length:1,670
Mass (Da):189,345
Last modified:February 6, 2007 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i263A8EF721B214E0
GO
Isoform D (identifier: A1ZAJ2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     809-809: R → RYRLELMRQIYNVESPPSSMLFDTSGMEALSGWISPPSQHPGQQAQLLPLEPPVESERGRLTLANLIPSR

Note: No experimental confirmation available.
Show »
Length:1,739
Mass (Da):197,046
Checksum:i9D6D4A0B034F00FA
GO
Isoform E (identifier: A1ZAJ2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     390-390: E → GPDGKVVCEKRDANK

Note: No experimental confirmation available.
Show »
Length:1,684
Mass (Da):190,814
Checksum:i1080A07AB127B160
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0B4K767A0A0B4K767_DROME
Uncoordinated-104, isoform F
unc-104 1B, bris, DmCG8566, DmDUnc104, Dmel\CG8566
1,675Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0B4K7D4A0A0B4K7D4_DROME
Uncoordinated-104, isoform G
unc-104 1B, bris, DmCG8566, DmDUnc104, Dmel\CG8566
1,681Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A126GUN3A0A126GUN3_DROME
Uncoordinated-104, isoform I
unc-104 1B, bris, DmCG8566, DmDUnc104, Dmel\CG8566
1,661Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0B4KF91A0A0B4KF91_DROME
Uncoordinated-104, isoform H
unc-104 1B, bris, DmCG8566, DmDUnc104, Dmel\CG8566
1,673Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti288V → VS in AAF74192 (Ref. 1) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_030268390E → GPDGKVVCEKRDANK in isoform E. Curated1
Alternative sequenceiVSP_030269809R → RYRLELMRQIYNVESPPSSM LFDTSGMEALSGWISPPSQH PGQQAQLLPLEPPVESERGR LTLANLIPSR in isoform D. Curated1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF247761 mRNA Translation: AAF74192.1
AE013599 Genomic DNA Translation: AAF57957.3
AE013599 Genomic DNA Translation: AAM70884.2
AE013599 Genomic DNA Translation: AAM70886.2
AE013599 Genomic DNA Translation: ABV53825.1

NCBI Reference Sequences

More...
RefSeqi
NP_001097346.1, NM_001103876.3 [A1ZAJ2-3]
NP_611155.3, NM_137311.5 [A1ZAJ2-2]
NP_725607.2, NM_166190.4 [A1ZAJ2-1]
NP_725610.2, NM_166192.4 [A1ZAJ2-1]

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
FBtr0087079; FBpp0086227; FBgn0267002 [A1ZAJ2-2]
FBtr0113087; FBpp0112000; FBgn0267002 [A1ZAJ2-1]
FBtr0113088; FBpp0112001; FBgn0267002 [A1ZAJ2-1]
FBtr0113089; FBpp0112002; FBgn0267002 [A1ZAJ2-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
36876

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
dme:Dmel_CG8566

UCSC genome browser

More...
UCSCi
CG8566-RB d. melanogaster [A1ZAJ2-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF247761 mRNA Translation: AAF74192.1
AE013599 Genomic DNA Translation: AAF57957.3
AE013599 Genomic DNA Translation: AAM70884.2
AE013599 Genomic DNA Translation: AAM70886.2
AE013599 Genomic DNA Translation: ABV53825.1
RefSeqiNP_001097346.1, NM_001103876.3 [A1ZAJ2-3]
NP_611155.3, NM_137311.5 [A1ZAJ2-2]
NP_725607.2, NM_166190.4 [A1ZAJ2-1]
NP_725610.2, NM_166192.4 [A1ZAJ2-1]

3D structure databases

ProteinModelPortaliA1ZAJ2
SMRiA1ZAJ2
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi62585, 2 interactors
IntActiA1ZAJ2, 5 interactors

PTM databases

iPTMnetiA1ZAJ2

Proteomic databases

PRIDEiA1ZAJ2

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblMetazoaiFBtr0087079; FBpp0086227; FBgn0267002 [A1ZAJ2-2]
FBtr0113087; FBpp0112000; FBgn0267002 [A1ZAJ2-1]
FBtr0113088; FBpp0112001; FBgn0267002 [A1ZAJ2-1]
FBtr0113089; FBpp0112002; FBgn0267002 [A1ZAJ2-3]
GeneIDi36876
KEGGidme:Dmel_CG8566
UCSCiCG8566-RB d. melanogaster [A1ZAJ2-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
36876
FlyBaseiFBgn0267002 unc-104

Phylogenomic databases

GeneTreeiENSGT00940000168546
InParanoidiA1ZAJ2
KOiK10392
PhylomeDBiA1ZAJ2

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
36876

Protein Ontology

More...
PROi
PR:A1ZAJ2

Gene expression databases

BgeeiFBgn0267002 Expressed in 25 organ(s), highest expression level in head
ExpressionAtlasiA1ZAJ2 baseline and differential
GenevisibleiA1ZAJ2 DM

Family and domain databases

CDDicd00060 FHA, 1 hit
Gene3Di2.30.29.30, 1 hit
3.40.850.10, 1 hit
InterProiView protein in InterPro
IPR000253 FHA_dom
IPR022164 Kinesin-like
IPR027640 Kinesin-like_fam
IPR022140 Kinesin-like_KIF1-typ
IPR032405 Kinesin_assoc
IPR019821 Kinesin_motor_CS
IPR001752 Kinesin_motor_dom
IPR036961 Kinesin_motor_dom_sf
IPR027417 P-loop_NTPase
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
IPR008984 SMAD_FHA_dom_sf
PANTHERiPTHR24115 PTHR24115, 1 hit
PfamiView protein in Pfam
PF12473 DUF3694, 1 hit
PF00498 FHA, 1 hit
PF12423 KIF1B, 1 hit
PF00225 Kinesin, 1 hit
PF16183 Kinesin_assoc, 2 hits
PF00169 PH, 1 hit
PRINTSiPR00380 KINESINHEAVY
SMARTiView protein in SMART
SM00240 FHA, 1 hit
SM00129 KISc, 1 hit
SM00233 PH, 1 hit
SUPFAMiSSF49879 SSF49879, 1 hit
SSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS00411 KINESIN_MOTOR_1, 1 hit
PS50067 KINESIN_MOTOR_2, 1 hit
PS50003 PH_DOMAIN, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiKIF1A_DROME
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: A1ZAJ2
Secondary accession number(s): A8DX00, A8DYG5, Q9NBL1
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 11, 2007
Last sequence update: February 6, 2007
Last modified: February 13, 2019
This is version 113 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again