Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 76 (16 Jan 2019)
Sequence version 1 (06 Feb 2007)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Neurexin-3a

Gene

nrxn3a

Organism
Danio rerio (Zebrafish) (Brachydanio rerio)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Neuronal cell surface protein that may be involved in cell recognition and cell adhesion.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi304CalciumBy similarity1
Metal bindingi321Calcium; via carbonyl oxygenBy similarity1
Metal bindingi389Calcium; via carbonyl oxygenBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processAngiogenesis, Cell adhesion
LigandCalcium, Metal-binding

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Neurexin-3a
Alternative name(s):
Neurexin IIIa-alpha
Neurexin-3a-alpha
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:nrxn3a
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiDanio rerio (Zebrafish) (Brachydanio rerio)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri7955 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiActinopterygiiNeopterygiiTeleosteiOstariophysiCypriniformesCyprinidaeDanio
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000437 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Unplaced

Organism-specific databases

Zebrafish Information Network genome database

More...
ZFINi
ZDB-GENE-070206-9 nrxn3a

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini24 – 1622ExtracellularSequence analysisAdd BLAST1599
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei1623 – 1643HelicalSequence analysisAdd BLAST21
Topological domaini1644 – 1697CytoplasmicSequence analysisAdd BLAST54

Keywords - Cellular componenti

Membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 23Sequence analysisAdd BLAST23
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000041254924 – 1697Neurexin-3aAdd BLAST1674

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi198 ↔ 209By similarity
Disulfide bondi203 ↔ 218By similarity
Disulfide bondi220 ↔ 230By similarity
Disulfide bondi419 ↔ 455By similarity
Disulfide bondi625 ↔ 654By similarity
Disulfide bondi662 ↔ 673By similarity
Disulfide bondi667 ↔ 682By similarity
Disulfide bondi684 ↔ 694By similarity
Disulfide bondi1033 ↔ 1061By similarity
Disulfide bondi1077 ↔ 1088By similarity
Disulfide bondi1082 ↔ 1097By similarity
Disulfide bondi1099 ↔ 1109By similarity

Keywords - PTMi

Disulfide bond

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
A1XQX8

PeptideAtlas

More...
PeptideAtlasi
A1XQX8

PRoteomics IDEntifications database

More...
PRIDEi
A1XQX8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

After the very early developmental stages, the expression levels decrease and remain relatively constant until around 24 h, with the onset of an increase of expression that continues till the larval stages.1 Publication

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
7955.ENSDARP00000082612

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
A1XQX8

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
A1XQX8

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini24 – 198Laminin G-like 1PROSITE-ProRule annotationAdd BLAST175
Domaini194 – 231EGF-like 1PROSITE-ProRule annotationAdd BLAST38
Domaini258 – 455Laminin G-like 2PROSITE-ProRule annotationAdd BLAST198
Domaini462 – 654Laminin G-like 3PROSITE-ProRule annotationAdd BLAST193
Domaini658 – 695EGF-like 2PROSITE-ProRule annotationAdd BLAST38
Domaini700 – 872Laminin G-like 4PROSITE-ProRule annotationAdd BLAST173
Domaini886 – 1061Laminin G-like 5PROSITE-ProRule annotationAdd BLAST176
Domaini1073 – 1110EGF-like 3PROSITE-ProRule annotationAdd BLAST38
Domaini1114 – 1314Laminin G-like 6PROSITE-ProRule annotationAdd BLAST201

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi1328 – 1363Thr-richAdd BLAST36
Compositional biasi1444 – 1460Asp-richAdd BLAST17

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the neurexin family.Curated

Keywords - Domaini

EGF-like domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3514 Eukaryota
ENOG410XNU6 LUCA

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000230481

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG052670

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
A1XQX8

KEGG Orthology (KO)

More...
KOi
K07377

Database of Orthologous Groups

More...
OrthoDBi
35129at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
A1XQX8

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR013320 ConA-like_dom_sf
IPR000742 EGF-like_dom
IPR001791 Laminin_G
IPR037440 Neurexin
IPR003585 Neurexin-like
IPR027789 Syndecan/Neurexin_dom

The PANTHER Classification System

More...
PANTHERi
PTHR44287 PTHR44287, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF02210 Laminin_G_2, 6 hits
PF01034 Syndecan, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00294 4.1m, 1 hit
SM00181 EGF, 3 hits
SM00282 LamG, 6 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF49899 SSF49899, 6 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50026 EGF_3, 3 hits
PS50025 LAM_G_DOMAIN, 6 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative promoter usage and alternative splicing. AlignAdd to basket
Note: A number of isoforms, alpha-type and beta-type are produced by alternative promoter usage. Beta-type isoforms differ from alpha-type isoforms in their N-terminus.

This entry has 3 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1a (identifier: A1XQX8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNFFRFPVQL QLLISTVLGP CLGLEFTGLQ GQWARYLRWD ASTRSDLSFQ
60 70 80 90 100
FKTDVSTALI LYFDDGGFCD FLQLMVVEGK LQLQFSIDCA ETTVVSDKRV
110 120 130 140 150
NDSSWHSATL SRYNLRTVLG LDGVSKWAEV RPLRQYMKIV SDLFLGGVPQ
160 170 180 190 200
DIRISVLTLP TVKDLPPFKG IIRELKYNSK EPILLSSQRV RMDIEGICME
210 220 230 240 250
NPCENGGTCS VVDGEPLCDC SKTEYVGRFC NEEANNIPGF AHMMMADQAK
260 270 280 290 300
GKAREENVAT FRGSEFFCYD LSQNPIQSSS DEITLSFKTW QRNGLILHTG
310 320 330 340 350
KSADYVNLAL KDGAVSLVIN LGSGAFEAIV EPVNGKFNDN SWHDVKVTRN
360 370 380 390 400
LRQHSGIGHA MVNKLHCLVT ISVDGILTTT GYTQEDYTML GSDDFFYVGG
410 420 430 440 450
SPSTADLPGS PVSNNFMGCL KEVVYKNNDI RLELSRLARI VDPKMKIQGD
460 470 480 490 500
VVFKCENVAT LDPISFETPE AYISLPKWNT KRMGSISFDF RTTEPNGLIL
510 520 530 540 550
FTHGKPQERK DARSQKNTKV DFFAVELLDG SLYLLLDMGS GTIKVKATQN
560 570 580 590 600
KVNDGAWYHV DIQRDGRSGT ISVNSRRTPF TASGENEILD LEGDMYLGGL
610 620 630 640 650
PDSRGSLILP TELWTAMLNY GYVGCIRDLF IDGRSKDIRQ IAEAQNGAGI
660 670 680 690 700
KPSCNKMSGK QCDSYPCKNK GLCKEGWNRF ICDCTGTGYW SRTCEREASI
710 720 730 740 750
LSYDGSMYMK VVMPTVMHTE AEDVSLRFMS QRAYGLLMAT TSRDSADTLR
760 770 780 790 800
LELDGSRVKL TVNLDCIRIN CNSSKGPETL YAGQKLNDNE WHTVRVIRRG
810 820 830 840 850
KSYKLTVDDD VAEGQMVGDH TRLEFHNIET GVMTERRFVS MIPSSFIGHL
860 870 880 890 900
QSLKFNGLLY IDLCKNGDID FCELNARFGM RSIIADPVTF KSKNSYLSLA
910 920 930 940 950
TLQAYTSMHL FFQFKTTSAD GFILFNSGDG SDFIAVELVK GYIHYVFNLG
960 970 980 990 1000
NGPNVIKGNS ERALHDNQWH NVVITRDNSN VHTLKVDAKA VSQVVNGAKN
1010 1020 1030 1040 1050
LDLKGDLFIA GLGPNMYNNL PKLVASREGF KGCLASVDLN GRLPDLINDA
1060 1070 1080 1090 1100
LFRSGQIERG CEVGFTKADL KGPSTTCQED SCANMGICIQ QWENYTCDCS
1110 1120 1130 1140 1150
MTSYTGTHCN DPGTTYIFGK GGGLISFNWP ANERPSTRTD RLTVGFSTSL
1160 1170 1180 1190 1200
KDGILIRIDS APGLGDYLML HIEQGKIGVT FNIGTADITV QESSTAVNDG
1210 1220 1230 1240 1250
KYHVVRFTRN GGNATLQVDN WAINEHFPSG NSDNERIQMA NKKIPFKYAR
1260 1270 1280 1290 1300
PVEEWLQEKG RQLTIFNTQA TITIGGSDRK RPFQGQLSGL YYNGLKVLNM
1310 1320 1330 1340 1350
AAQGNPNIKI NGSVRLVGEV PAAGSARTTA LPPEMSTAFI ETTTTMSTTT
1360 1370 1380 1390 1400
TRKHRTPPTI QTTDDMVSSA ECSSDDEDFA ECEGHAGGLG GELVFPVIVK
1410 1420 1430 1440 1450
DPLELPSVAT RTPSIPFPPT LTIIETTKES LSMATEAGVP CLSDGGSDDC
1460 1470 1480 1490 1500
GDDDDDDDDD GLMISGYGSG EAYDSNLPPT DDEDFYTTFS LVTDKTLSSS
1510 1520 1530 1540 1550
TFEGGYKAHA PKWGSKDFRP NKVFDSGRTT TASFSPKLSR STTTSTPPKL
1560 1570 1580 1590 1600
PAGKMNHREL KPQPDIVLLP LPTSYEVDNT KMKSPLITSP MFRNVPTAIP
1610 1620 1630 1640 1650
TEPGIRRVPG ASEVVRESSS TTGMVVGIVA AAALCILILL YAMYKYRNRD
1660 1670 1680 1690
EGSYQVDETR NYITNSAQSN GAVMKDKQQS TKSGNKKQKN KDKEYYV
Length:1,697
Mass (Da):187,194
Last modified:February 6, 2007 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iFA961C8C4306CB26
GO
Isoform 2a (identifier: A1XQX8-2) [UniParc]FASTAAdd to basket
Also known as: Soluble form

The sequence of this isoform differs from the canonical sequence as follows:
     1390-1425: GGELVFPVIVKDPLELPSVATRTPSIPFPPTLTIIE → AKNVNAARPLRTAYTWTWQLTYTITPIIVISYVVCS
     1426-1697: Missing.

Note: Produced by alternative splicing.
Show »
Length:1,425
Mass (Da):157,873
Checksum:i1D9123592B7E3C2D
GO
Isoform 1b (identifier: A1XQY0-1) [UniParc]FASTAAdd to basket
The sequence of this isoform can be found in the external entry A1XQY0.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Note: Produced by alternative promoter usage.
Length:672
Mass (Da):72,745
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A1XQY0NR3AB_DANRE
Neurexin-3a-beta
nrxn3a
672Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
X1WBL4X1WBL4_DANRE
Neurexin-3a
nrxn3a
1,111Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F1R040F1R040_DANRE
Neurexin-3a
nrxn3a
261Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F1QRW3F1QRW3_DANRE
Neurexin-3a
nrxn3a
672Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
X1WCH8X1WCH8_DANRE
Neurexin-3a
nrxn3a
469Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
X1WBE7X1WBE7_DANRE
Neurexin-3a
nrxn3a
197Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0417061390 – 1425GGELV…LTIIE → AKNVNAARPLRTAYTWTWQL TYTITPIIVISYVVCS in isoform 2a. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_0417071426 – 1697Missing in isoform 2a. 1 PublicationAdd BLAST272

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
DQ641432 mRNA Translation: ABG25169.1
DQ641433 mRNA Translation: ABG25170.1

NCBI Reference Sequences

More...
RefSeqi
NP_001073478.1, NM_001080009.1 [A1XQX8-2]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Dr.109337
Dr.160520

Genome annotation databases

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
563598

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
dre:563598

Keywords - Coding sequence diversityi

Alternative promoter usage, Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ641432 mRNA Translation: ABG25169.1
DQ641433 mRNA Translation: ABG25170.1
RefSeqiNP_001073478.1, NM_001080009.1 [A1XQX8-2]
UniGeneiDr.109337
Dr.160520

3D structure databases

ProteinModelPortaliA1XQX8
SMRiA1XQX8
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi7955.ENSDARP00000082612

Proteomic databases

PaxDbiA1XQX8
PeptideAtlasiA1XQX8
PRIDEiA1XQX8

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi563598
KEGGidre:563598

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
563598
ZFINiZDB-GENE-070206-9 nrxn3a

Phylogenomic databases

eggNOGiKOG3514 Eukaryota
ENOG410XNU6 LUCA
HOGENOMiHOG000230481
HOVERGENiHBG052670
InParanoidiA1XQX8
KOiK07377
OrthoDBi35129at2759
PhylomeDBiA1XQX8

Family and domain databases

InterProiView protein in InterPro
IPR013320 ConA-like_dom_sf
IPR000742 EGF-like_dom
IPR001791 Laminin_G
IPR037440 Neurexin
IPR003585 Neurexin-like
IPR027789 Syndecan/Neurexin_dom
PANTHERiPTHR44287 PTHR44287, 1 hit
PfamiView protein in Pfam
PF02210 Laminin_G_2, 6 hits
PF01034 Syndecan, 1 hit
SMARTiView protein in SMART
SM00294 4.1m, 1 hit
SM00181 EGF, 3 hits
SM00282 LamG, 6 hits
SUPFAMiSSF49899 SSF49899, 6 hits
PROSITEiView protein in PROSITE
PS50026 EGF_3, 3 hits
PS50025 LAM_G_DOMAIN, 6 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNR3AA_DANRE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: A1XQX8
Secondary accession number(s): A1XQX9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 21, 2011
Last sequence update: February 6, 2007
Last modified: January 16, 2019
This is version 76 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again