Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 92 (08 May 2019)
Sequence version 1 (06 Feb 2007)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Uncharacterized protein C1orf226

Gene

C1orf226

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Uncharacterized protein C1orf226
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:34351 C1orf226

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_A1L170

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
400793

Open Targets

More...
OpenTargetsi
ENSG00000239887

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA164717033

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
C1orf226

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003346791 – 272Uncharacterized protein C1orf226Add BLAST272

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei222PhosphoserineCombined sources1
Modified residuei223PhosphoserineCombined sources1
Modified residuei249PhosphoserineCombined sources1
Modified residuei258PhosphoserineCombined sources1

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
A1L170

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
A1L170

MaxQB - The MaxQuant DataBase

More...
MaxQBi
A1L170

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
A1L170

PRoteomics IDEntifications database

More...
PRIDEi
A1L170

ProteomicsDB human proteome resource

More...
ProteomicsDBi
134
135 [A1L170-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
A1L170

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
A1L170

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000239887 Expressed in 125 organ(s), highest expression level in oocyte

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
A1L170 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
A1L170 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA052251

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
134762, 15 interactors

Protein interaction database and analysis system

More...
IntActi
A1L170, 5 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000413150

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IK4X Eukaryota
ENOG410ZKK2 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00510000046975

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000069901

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
A1L170

Identification of Orthologs from Complete Genome Data

More...
OMAi
GHYVKCV

Database of Orthologous Groups

More...
OrthoDBi
1123753at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
A1L170

TreeFam database of animal gene trees

More...
TreeFami
TF343380

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR027851 DUF4628

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF15429 DUF4628, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: A1L170-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MFENLNTALT PKLQASRSFP HLSKPVAPGS APLGSGEPGG PGLWVGSSQH
60 70 80 90 100
LKNLGKAMGA KVNDFLRRKE PSSLGSVGVT EINKTAGAQL ASGTDAAPEA
110 120 130 140 150
WLEDERSVLQ ETFPRLDPPP PITRKRTPRA LKTTQDMLIS SQPVLSSLEY
160 170 180 190 200
GTEPSPGQAQ DSAPTAQPDV PADASQPEAT MEREERGKVL PNGEVSLSVP
210 220 230 240 250
DLIHKDSQDE SKLKMTECRR ASSPSLIERN GFKLSLSPIS LAESWEDGSP
260 270
PPQARTSSLD NEGPHPDLLS FE
Length:272
Mass (Da):29,057
Last modified:February 6, 2007 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i01D9EA3C6AD46ED1
GO
Isoform 2 (identifier: A1L170-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLVLVAQAGGDTLKVTGHYVKCVFLLFVSHLLSEPLSRTVDHGM

Show »
Length:315
Mass (Da):33,692
Checksum:iA8427EBBC4D507F7
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8W6W0F8W6W0_HUMAN
Uncharacterized protein C1orf226
C1orf226
171Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0407911M → MLVLVAQAGGDTLKVTGHYV KCVFLLFVSHLLSEPLSRTV DHGM in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK293907 mRNA Translation: BAG57292.1
AL512785 Genomic DNA No translation available.
BC127743 mRNA Translation: AAI27744.1
BC127744 mRNA Translation: AAI27745.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS44268.1 [A1L170-2]
CCDS53422.1 [A1L170-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001078844.1, NM_001085375.1 [A1L170-1]
NP_001128712.1, NM_001135240.1 [A1L170-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000426197; ENSP00000413150; ENSG00000239887 [A1L170-2]
ENST00000458626; ENSP00000437071; ENSG00000239887 [A1L170-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
400793

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:400793

UCSC genome browser

More...
UCSCi
uc001gby.2 human [A1L170-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK293907 mRNA Translation: BAG57292.1
AL512785 Genomic DNA No translation available.
BC127743 mRNA Translation: AAI27744.1
BC127744 mRNA Translation: AAI27745.1
CCDSiCCDS44268.1 [A1L170-2]
CCDS53422.1 [A1L170-1]
RefSeqiNP_001078844.1, NM_001085375.1 [A1L170-1]
NP_001128712.1, NM_001135240.1 [A1L170-2]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi134762, 15 interactors
IntActiA1L170, 5 interactors
STRINGi9606.ENSP00000413150

PTM databases

iPTMnetiA1L170
PhosphoSitePlusiA1L170

Polymorphism and mutation databases

BioMutaiC1orf226

Proteomic databases

EPDiA1L170
jPOSTiA1L170
MaxQBiA1L170
PaxDbiA1L170
PRIDEiA1L170
ProteomicsDBi134
135 [A1L170-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000426197; ENSP00000413150; ENSG00000239887 [A1L170-2]
ENST00000458626; ENSP00000437071; ENSG00000239887 [A1L170-1]
GeneIDi400793
KEGGihsa:400793
UCSCiuc001gby.2 human [A1L170-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
400793
DisGeNETi400793

GeneCards: human genes, protein and diseases

More...
GeneCardsi
C1orf226
HGNCiHGNC:34351 C1orf226
HPAiHPA052251
neXtProtiNX_A1L170
OpenTargetsiENSG00000239887
PharmGKBiPA164717033

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IK4X Eukaryota
ENOG410ZKK2 LUCA
GeneTreeiENSGT00510000046975
HOGENOMiHOG000069901
InParanoidiA1L170
OMAiGHYVKCV
OrthoDBi1123753at2759
PhylomeDBiA1L170
TreeFamiTF343380

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
400793

Protein Ontology

More...
PROi
PR:A1L170

Gene expression databases

BgeeiENSG00000239887 Expressed in 125 organ(s), highest expression level in oocyte
ExpressionAtlasiA1L170 baseline and differential
GenevisibleiA1L170 HS

Family and domain databases

InterProiView protein in InterPro
IPR027851 DUF4628
PfamiView protein in Pfam
PF15429 DUF4628, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCA226_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: A1L170
Secondary accession number(s): B4DF31
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 20, 2008
Last sequence update: February 6, 2007
Last modified: May 8, 2019
This is version 92 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again