Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Uncharacterized protein C1orf226

Gene

C1orf226

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Uncharacterized protein C1orf226
Gene namesi
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000239887.4
HGNCiHGNC:34351 C1orf226
neXtProtiNX_A1L170

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000239887
PharmGKBiPA164717033

Polymorphism and mutation databases

BioMutaiC1orf226

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003346791 – 272Uncharacterized protein C1orf226Add BLAST272

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei222PhosphoserineCombined sources1
Modified residuei223PhosphoserineCombined sources1
Modified residuei249PhosphoserineCombined sources1
Modified residuei258PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiA1L170
MaxQBiA1L170
PaxDbiA1L170
PRIDEiA1L170
ProteomicsDBi134
135 [A1L170-2]

PTM databases

iPTMnetiA1L170
PhosphoSitePlusiA1L170

Expressioni

Gene expression databases

BgeeiENSG00000239887 Expressed in 125 organ(s), highest expression level in oocyte
CleanExiHS_C1orf226
ExpressionAtlasiA1L170 baseline and differential
GenevisibleiA1L170 HS

Organism-specific databases

HPAiHPA052251

Interactioni

Protein-protein interaction databases

BioGridi134762, 14 interactors
IntActiA1L170, 5 interactors
STRINGi9606.ENSP00000413150

Structurei

3D structure databases

ProteinModelPortaliA1L170
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Phylogenomic databases

eggNOGiENOG410IK4X Eukaryota
ENOG410ZKK2 LUCA
GeneTreeiENSGT00510000049665
HOGENOMiHOG000069901
HOVERGENiHBG107570
InParanoidiA1L170
OMAiGHYVKCV
OrthoDBiEOG091G0KY5
PhylomeDBiA1L170
TreeFamiTF343380

Family and domain databases

InterProiView protein in InterPro
IPR027851 DUF4628
PfamiView protein in Pfam
PF15429 DUF4628, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.iShow all

Isoform 1 (identifier: A1L170-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MFENLNTALT PKLQASRSFP HLSKPVAPGS APLGSGEPGG PGLWVGSSQH
60 70 80 90 100
LKNLGKAMGA KVNDFLRRKE PSSLGSVGVT EINKTAGAQL ASGTDAAPEA
110 120 130 140 150
WLEDERSVLQ ETFPRLDPPP PITRKRTPRA LKTTQDMLIS SQPVLSSLEY
160 170 180 190 200
GTEPSPGQAQ DSAPTAQPDV PADASQPEAT MEREERGKVL PNGEVSLSVP
210 220 230 240 250
DLIHKDSQDE SKLKMTECRR ASSPSLIERN GFKLSLSPIS LAESWEDGSP
260 270
PPQARTSSLD NEGPHPDLLS FE
Length:272
Mass (Da):29,057
Last modified:February 6, 2007 - v1
Checksum:i01D9EA3C6AD46ED1
GO
Isoform 2 (identifier: A1L170-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLVLVAQAGGDTLKVTGHYVKCVFLLFVSHLLSEPLSRTVDHGM

Show »
Length:315
Mass (Da):33,692
Checksum:iA8427EBBC4D507F7
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8W6W0F8W6W0_HUMAN
Uncharacterized protein C1orf226
C1orf226
171Annotation score:

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0407911M → MLVLVAQAGGDTLKVTGHYV KCVFLLFVSHLLSEPLSRTV DHGM in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK293907 mRNA Translation: BAG57292.1
AL512785 Genomic DNA No translation available.
BC127743 mRNA Translation: AAI27744.1
BC127744 mRNA Translation: AAI27745.1
CCDSiCCDS44268.1 [A1L170-2]
CCDS53422.1 [A1L170-1]
RefSeqiNP_001078844.1, NM_001085375.1 [A1L170-1]
NP_001128712.1, NM_001135240.1 [A1L170-2]
UniGeneiHs.447011

Genome annotation databases

EnsembliENST00000426197; ENSP00000413150; ENSG00000239887 [A1L170-2]
ENST00000458626; ENSP00000437071; ENSG00000239887 [A1L170-1]
GeneIDi400793
KEGGihsa:400793
UCSCiuc001gby.2 human [A1L170-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiCA226_HUMAN
AccessioniPrimary (citable) accession number: A1L170
Secondary accession number(s): B4DF31
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 20, 2008
Last sequence update: February 6, 2007
Last modified: September 12, 2018
This is version 88 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again