Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 109 (08 May 2019)
Sequence version 3 (27 May 2015)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Anoctamin-9

Gene

ANO9

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Has calcium-dependent phospholipid scramblase activity; scrambles phosphatidylserine, phosphatidylcholine and galactosylceramide (By similarity). Does not exhibit calcium-activated chloride channel (CaCC) activity. Can inhibit the activity of ANO1.By similarity2 Publications

Miscellaneous

The term 'anoctamin' was coined because these channels are anion selective and have eight (OCT) transmembrane segments. There is some dissatisfaction in the field with the Ano nomenclature because it is not certain that all the members of this family are anion channels or have the 8-transmembrane topology.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processLipid transport, Transport

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-2672351 Stimuli-sensing channels

Protein family/group databases

Transport Classification Database

More...
TCDBi
1.A.17.1.5 the calcium-dependent chloride channel (ca-clc) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Anoctamin-9
Alternative name(s):
Transmembrane protein 16J
Tumor protein p53-inducible protein 5
p53-induced gene 5 protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ANO9
Synonyms:PIG5, TMEM16J, TP53I5
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:20679 ANO9

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_A1A5B4

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 198CytoplasmicSequence analysisAdd BLAST198
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei199 – 219HelicalSequence analysisAdd BLAST21
Topological domaini220 – 264ExtracellularSequence analysisAdd BLAST45
Transmembranei265 – 285HelicalSequence analysisAdd BLAST21
Topological domaini286 – 331CytoplasmicSequence analysisAdd BLAST46
Transmembranei332 – 352HelicalSequence analysisAdd BLAST21
Topological domaini353 – 373ExtracellularSequence analysisAdd BLAST21
Transmembranei374 – 394HelicalSequence analysisAdd BLAST21
Topological domaini395 – 423CytoplasmicSequence analysisAdd BLAST29
Transmembranei424 – 444HelicalSequence analysisAdd BLAST21
Topological domaini445 – 552ExtracellularSequence analysisAdd BLAST108
Transmembranei553 – 573HelicalSequence analysisAdd BLAST21
Topological domaini574 – 604CytoplasmicSequence analysisAdd BLAST31
Transmembranei605 – 625HelicalSequence analysisAdd BLAST21
Topological domaini626 – 703ExtracellularSequence analysisAdd BLAST78
Transmembranei704 – 724HelicalSequence analysisAdd BLAST21
Topological domaini725 – 782CytoplasmicSequence analysisAdd BLAST58

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
338440

Open Targets

More...
OpenTargetsi
ENSG00000185101

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA164715791

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ANO9

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002893291 – 782Anoctamin-9Add BLAST782

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi641N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi652N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi674N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi690N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
A1A5B4

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
A1A5B4

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
A1A5B4

PRoteomics IDEntifications database

More...
PRIDEi
A1A5B4

ProteomicsDB human proteome resource

More...
ProteomicsDBi
110
111 [A1A5B4-2]
112 [A1A5B4-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
A1A5B4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
A1A5B4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000185101 Expressed in 125 organ(s), highest expression level in mucosa of transverse colon

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
A1A5B4 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA039948
HPA040112

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
DLG1Q129592EBI-3843564,EBI-357481

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
130747, 1 interactor

Protein interaction database and analysis system

More...
IntActi
A1A5B4, 1 interactor

Molecular INTeraction database

More...
MINTi
A1A5B4

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000332788

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the anoctamin family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2514 Eukaryota
ENOG410XS4S LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000158300

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000006509

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
A1A5B4

KEGG Orthology (KO)

More...
KOi
K19503

Identification of Orthologs from Complete Genome Data

More...
OMAi
INCPDYK

Database of Orthologous Groups

More...
OrthoDBi
1263362at2759

TreeFam database of animal gene trees

More...
TreeFami
TF314265

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR007632 Anoctamin
IPR031290 Anoctamin-9

The PANTHER Classification System

More...
PANTHERi
PTHR12308 PTHR12308, 1 hit
PTHR12308:SF37 PTHR12308:SF37, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF04547 Anoctamin, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: A1A5B4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MQGEESLRIL VEPEGDSFPL MEISTCETEA SEQWDYVLVA QRHTQRDPRQ
60 70 80 90 100
ARQQQFLEEL RRKGFHIKVI RDQKQVFFGI RADNSVFGLY RTLLLEPEGP
110 120 130 140 150
APHAELAAPT TIPVTTSLRI RIVNFVVMNN KTSAGETFED LMKDGVFEAR
160 170 180 190 200
FPLHKGEGRL KKTWARWRHM FREQPVDEIR NYFGEKVALY FVWLGWYTYM
210 220 230 240 250
LVPAALTGLL VFLSGFSLFE ASQISKEICE AHDILMCPLG DHSRRYQRLS
260 270 280 290 300
ETCTFAKLTH LFDNDGTVVF AIFMALWATV FLEIWKRQRA RVVLHWDLYV
310 320 330 340 350
WDEEQEEMAL QLINCPDYKL RPYQHSYLRS TVILVLTLLM ICLMIGMAHV
360 370 380 390 400
LVVYRVLASA LFSSSAVPFL EEQVTTAVVV TGALVHYVTI IIMTKINRCV
410 420 430 440 450
ALKLCDFEMP RTFSERESRF TIRFFTLQFF THFSSLIYIA FILGRINGHP
460 470 480 490 500
GKSTRLAGLW KLEECHASGC MMDLFVQMAI IMGLKQTLSN CVEYLVPWVT
510 520 530 540 550
HKCRSLRASE SGHLPRDPEL RDWRRNYLLN PVNTFSLFDE FMEMMIQYGF
560 570 580 590 600
TTIFVAAFPL APLLALFSNL VEIRLDAIKM VWLQRRLVPR KAKDIGTWLQ
610 620 630 640 650
VLETIGVLAV IANGMVIAFT SEFIPRVVYK YRYSPCLKEG NSTVDCLKGY
660 670 680 690 700
VNHSLSVFHT KDFQDPDGIE GSENVTLCRY RDYRNPPDYN FSEQFWFLLA
710 720 730 740 750
IRLAFVILFE HVALCIKLIA AWFVPDIPQS VKNKVLEVKY QRLREKMWHG
760 770 780
RQRLGGVGAG SRPPMPAHPT PASIFSARST DV
Length:782
Mass (Da):90,333
Last modified:May 27, 2015 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i6A359B63DD92AFF7
GO
Isoform 2 (identifier: A1A5B4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-299: Missing.
     300-305: VWDEEQ → MPAVSE

Show »
Length:483
Mass (Da):55,280
Checksum:i8474676D70D18C37
GO
Isoform 3 (identifier: A1A5B4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     156-186: GEGRLKKTWARWRHMFREQPVDEIRNYFGEK → VRGGPAWRGPWGGTLGWGLSLSVTRARGRDA
     187-782: Missing.

Show »
Length:186
Mass (Da):21,062
Checksum:i0F7746A4039D8C25
GO

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAB84914 differs from that shown. Intron retention.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_05462193L → F2 PublicationsCorresponds to variant dbSNP:rs7395065Ensembl.1
Natural variantiVAR_032617391I → V3 PublicationsCorresponds to variant dbSNP:rs10794324Ensembl.1
Natural variantiVAR_032618399C → R3 PublicationsCorresponds to variant dbSNP:rs10794323Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0364891 – 299Missing in isoform 2. 1 PublicationAdd BLAST299
Alternative sequenceiVSP_036490156 – 186GEGRL…YFGEK → VRGGPAWRGPWGGTLGWGLS LSVTRARGRDA in isoform 3. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_036491187 – 782Missing in isoform 3. 1 PublicationAdd BLAST596
Alternative sequenceiVSP_036492300 – 305VWDEEQ → MPAVSE in isoform 2. 1 Publication6

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK074088 mRNA Translation: BAB84914.1 Sequence problems.
AK096874 mRNA Translation: BAG53386.1
AK303642 mRNA Translation: BAG64646.1
AC138230 Genomic DNA No translation available.
BC128557 mRNA Translation: AAI28558.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS31326.1 [A1A5B4-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001012302.2, NM_001012302.2 [A1A5B4-1]
XP_011518355.1, XM_011520053.2 [A1A5B4-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000332826; ENSP00000332788; ENSG00000185101 [A1A5B4-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
338440

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:338440

UCSC genome browser

More...
UCSCi
uc001lpi.3 human [A1A5B4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK074088 mRNA Translation: BAB84914.1 Sequence problems.
AK096874 mRNA Translation: BAG53386.1
AK303642 mRNA Translation: BAG64646.1
AC138230 Genomic DNA No translation available.
BC128557 mRNA Translation: AAI28558.1
CCDSiCCDS31326.1 [A1A5B4-1]
RefSeqiNP_001012302.2, NM_001012302.2 [A1A5B4-1]
XP_011518355.1, XM_011520053.2 [A1A5B4-2]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi130747, 1 interactor
IntActiA1A5B4, 1 interactor
MINTiA1A5B4
STRINGi9606.ENSP00000332788

Protein family/group databases

TCDBi1.A.17.1.5 the calcium-dependent chloride channel (ca-clc) family

PTM databases

iPTMnetiA1A5B4
PhosphoSitePlusiA1A5B4

Polymorphism and mutation databases

BioMutaiANO9

Proteomic databases

EPDiA1A5B4
jPOSTiA1A5B4
PaxDbiA1A5B4
PRIDEiA1A5B4
ProteomicsDBi110
111 [A1A5B4-2]
112 [A1A5B4-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000332826; ENSP00000332788; ENSG00000185101 [A1A5B4-1]
GeneIDi338440
KEGGihsa:338440
UCSCiuc001lpi.3 human [A1A5B4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
338440
DisGeNETi338440

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ANO9
HGNCiHGNC:20679 ANO9
HPAiHPA039948
HPA040112
neXtProtiNX_A1A5B4
OpenTargetsiENSG00000185101
PharmGKBiPA164715791

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2514 Eukaryota
ENOG410XS4S LUCA
GeneTreeiENSGT00940000158300
HOGENOMiHOG000006509
InParanoidiA1A5B4
KOiK19503
OMAiINCPDYK
OrthoDBi1263362at2759
TreeFamiTF314265

Enzyme and pathway databases

ReactomeiR-HSA-2672351 Stimuli-sensing channels

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ANO9 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
338440

Protein Ontology

More...
PROi
PR:A1A5B4

Gene expression databases

BgeeiENSG00000185101 Expressed in 125 organ(s), highest expression level in mucosa of transverse colon
GenevisibleiA1A5B4 HS

Family and domain databases

InterProiView protein in InterPro
IPR007632 Anoctamin
IPR031290 Anoctamin-9
PANTHERiPTHR12308 PTHR12308, 1 hit
PTHR12308:SF37 PTHR12308:SF37, 1 hit
PfamiView protein in Pfam
PF04547 Anoctamin, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiANO9_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: A1A5B4
Secondary accession number(s): B3KUC4, B4E134, Q8TEN4
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 29, 2007
Last sequence update: May 27, 2015
Last modified: May 8, 2019
This is version 109 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again