Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 100 (13 Feb 2019)
Sequence version 1 (23 Jan 2007)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Protein FAM170A

Gene

FAM170A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Acts as a nuclear transcription factor that positively regulates the expression of heat shock genes. Binds to heat shock promoter elements (HSE).1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri228 – 252C2H2-type; degenerateAdd BLAST25

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator, DNA-binding
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein FAM170A
Alternative name(s):
Zinc finger domain-containing protein
Zinc finger protein ZNFD
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:FAM170A
Synonyms:ZNFD
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000164334.15

Human Gene Nomenclature Database

More...
HGNCi
HGNC:27963 FAM170A

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_A1A519

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000164334

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162387167

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
FAM170A

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003261101 – 330Protein FAM170AAdd BLAST330

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei217PhosphothreonineBy similarity1
Modified residuei315PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
A1A519

PRoteomics IDEntifications database

More...
PRIDEi
A1A519

ProteomicsDB human proteome resource

More...
ProteomicsDBi
100
101 [A1A519-2]
102 [A1A519-3]
103 [A1A519-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
A1A519

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
A1A519

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed strongly in testis and brain and weakly in prostate, spleen, pancreas and uterus.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000164334 Expressed in 30 organ(s), highest expression level in testis

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
A1A519 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
A1A519 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA037900
HPA037902

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
130989, 15 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000334285

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
A1A519

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi272 – 306Glu-richAdd BLAST35

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The N-terminus is necessary for nuclear localization. The C-terminus is necessary for transcriptional activity.

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the FAM170 family.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri228 – 252C2H2-type; degenerateAdd BLAST25

Keywords - Domaini

Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IGZX Eukaryota
ENOG4111C5N LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000162220

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000050239

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG060499

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
A1A519

Identification of Orthologs from Complete Genome Data

More...
OMAi
PWSQCPG

Database of Orthologous Groups

More...
OrthoDBi
1142827at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
A1A519

TreeFam database of animal gene trees

More...
TreeFami
TF337124

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR033376 FAM170A

The PANTHER Classification System

More...
PANTHERi
PTHR33517:SF3 PTHR33517:SF3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: A1A519-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKRRQKRKHL ENEESQETAE KGGGMSKSQE DALQPGSTRV AKGWSQGVGE
60 70 80 90 100
VTSTSEYCSC VSSSRKLIHS GIQRIHRDSP QPQSPLAQVQ ERGETPPRSQ
110 120 130 140 150
HVSLSSYSSY KTCVSSLCVN KEERGMKIYY MQVQMNKGVA VSWETEETLE
160 170 180 190 200
SLEKQPRMEE VTLSEVVRVG TPPSDVSTRN LLSDSEPSGE EKEHEERTES
210 220 230 240 250
DSLPGSPTVE DTPRAKTPDW LVTMENGFRC MACCRVFTTM EALQEHVQFG
260 270 280 290 300
IREGFSCHVF HLTMAQLTGN MESESTQDEQ EEENGNEKEE EEKPEAKEEE
310 320 330
GQPTEEDLGL RRSWSQCPGC VFHSPKDRNS
Length:330
Mass (Da):37,158
Last modified:January 23, 2007 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iDAE7F2D1E96D90AD
GO
Isoform 2 (identifier: A1A519-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     330-330: Missing.

Show »
Length:329
Mass (Da):37,071
Checksum:i37F2D1E96D90ADD0
GO
Isoform 3 (identifier: A1A519-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     24-70: Missing.
     330-330: Missing.

Show »
Length:282
Mass (Da):32,141
Checksum:i180D027ADCAE164B
GO
Isoform 4 (identifier: A1A519-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     25-71: Missing.
     258-291: HVFHLTMAQLTGNMESESTQDEQEEENGNEKEEE → PKMSRRRKMEMRRRRKRNQKQRRRRGSPQKKTLA
     292-330: Missing.

Note: No experimental confirmation available.
Show »
Length:244
Mass (Da):28,231
Checksum:i8DBA5A1B1AC7031B
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6RIE9D6RIE9_HUMAN
Protein FAM170A
FAM170A
283Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A2VCN0A2VCN0_HUMAN
FAM170A protein
FAM170A
186Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH40622 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_047312173P → S. Corresponds to variant dbSNP:rs328694Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_03255624 – 70Missing in isoform 3. 1 PublicationAdd BLAST47
Alternative sequenceiVSP_03547525 – 71Missing in isoform 4. 1 PublicationAdd BLAST47
Alternative sequenceiVSP_035476258 – 291HVFHL…EKEEE → PKMSRRRKMEMRRRRKRNQK QRRRRGSPQKKTLA in isoform 4. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_035477292 – 330Missing in isoform 4. 1 PublicationAdd BLAST39
Alternative sequenceiVSP_032557330Missing in isoform 2 and isoform 3. 3 Publications1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY692447 mRNA Translation: AAU04855.1
AF427126 mRNA Translation: AAP97296.1
AC010409 Genomic DNA No translation available.
BC040622 mRNA Translation: AAH40622.1 Different initiation.
BC128243 mRNA Translation: AAI28244.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS43353.1 [A1A519-2]
CCDS54889.1 [A1A519-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001157463.1, NM_001163991.1 [A1A519-3]
NP_877438.2, NM_182761.3 [A1A519-2]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.713304

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000335286; ENSP00000334285; ENSG00000164334 [A1A519-2]
ENST00000379555; ENSP00000368873; ENSG00000164334 [A1A519-3]
ENST00000515256; ENSP00000422684; ENSG00000164334 [A1A519-1]
ENST00000613773; ENSP00000482552; ENSG00000164334 [A1A519-2]
ENST00000620555; ENSP00000483075; ENSG00000164334 [A1A519-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
340069

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:340069

UCSC genome browser

More...
UCSCi
uc003ksm.3 human [A1A519-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY692447 mRNA Translation: AAU04855.1
AF427126 mRNA Translation: AAP97296.1
AC010409 Genomic DNA No translation available.
BC040622 mRNA Translation: AAH40622.1 Different initiation.
BC128243 mRNA Translation: AAI28244.1
CCDSiCCDS43353.1 [A1A519-2]
CCDS54889.1 [A1A519-3]
RefSeqiNP_001157463.1, NM_001163991.1 [A1A519-3]
NP_877438.2, NM_182761.3 [A1A519-2]
UniGeneiHs.713304

3D structure databases

ProteinModelPortaliA1A519
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi130989, 15 interactors
STRINGi9606.ENSP00000334285

PTM databases

iPTMnetiA1A519
PhosphoSitePlusiA1A519

Polymorphism and mutation databases

BioMutaiFAM170A

Proteomic databases

PaxDbiA1A519
PRIDEiA1A519
ProteomicsDBi100
101 [A1A519-2]
102 [A1A519-3]
103 [A1A519-4]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000335286; ENSP00000334285; ENSG00000164334 [A1A519-2]
ENST00000379555; ENSP00000368873; ENSG00000164334 [A1A519-3]
ENST00000515256; ENSP00000422684; ENSG00000164334 [A1A519-1]
ENST00000613773; ENSP00000482552; ENSG00000164334 [A1A519-2]
ENST00000620555; ENSP00000483075; ENSG00000164334 [A1A519-3]
GeneIDi340069
KEGGihsa:340069
UCSCiuc003ksm.3 human [A1A519-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
340069
EuPathDBiHostDB:ENSG00000164334.15

GeneCards: human genes, protein and diseases

More...
GeneCardsi
FAM170A
HGNCiHGNC:27963 FAM170A
HPAiHPA037900
HPA037902
neXtProtiNX_A1A519
OpenTargetsiENSG00000164334
PharmGKBiPA162387167

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IGZX Eukaryota
ENOG4111C5N LUCA
GeneTreeiENSGT00940000162220
HOGENOMiHOG000050239
HOVERGENiHBG060499
InParanoidiA1A519
OMAiPWSQCPG
OrthoDBi1142827at2759
PhylomeDBiA1A519
TreeFamiTF337124

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
340069

Protein Ontology

More...
PROi
PR:A1A519

Gene expression databases

BgeeiENSG00000164334 Expressed in 30 organ(s), highest expression level in testis
ExpressionAtlasiA1A519 baseline and differential
GenevisibleiA1A519 HS

Family and domain databases

InterProiView protein in InterPro
IPR033376 FAM170A
PANTHERiPTHR33517:SF3 PTHR33517:SF3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiF170A_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: A1A519
Secondary accession number(s): Q66LM8, Q7Z4V2, Q8IW94
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: January 23, 2007
Last modified: February 13, 2019
This is version 100 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again