Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Coiled-coil domain-containing protein 189

Gene

CCDC189

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Coiled-coil domain-containing protein 189
Gene namesi
Name:CCDC189
Synonyms:C16orf93
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

EuPathDBiHostDB:ENSG00000196118.11
HGNCiHGNC:28078 CCDC189
neXtProtiNX_A1A4V9

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000196118
PharmGKBiPA164716879

Polymorphism and mutation databases

BioMutaiC16orf93

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003218421 – 331Coiled-coil domain-containing protein 189Add BLAST331

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei34PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiA1A4V9
PaxDbiA1A4V9
PRIDEiA1A4V9
ProteomicsDBi95
96 [A1A4V9-2]
97 [A1A4V9-3]

PTM databases

iPTMnetiA1A4V9
PhosphoSitePlusiA1A4V9

Expressioni

Gene expression databases

BgeeiENSG00000196118 Expressed in 143 organ(s), highest expression level in right uterine tube
ExpressionAtlasiA1A4V9 baseline and differential
GenevisibleiA1A4V9 HS

Organism-specific databases

HPAiHPA041806
HPA046289

Interactioni

Protein-protein interaction databases

BioGridi124769, 2 interactors

Structurei

3D structure databases

ProteinModelPortaliA1A4V9
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili286 – 317Sequence analysisAdd BLAST32

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IQKE Eukaryota
ENOG4111H80 LUCA
GeneTreeiENSGT00390000017659
HOGENOMiHOG000067914
InParanoidiA1A4V9
PhylomeDBiA1A4V9
TreeFamiTF343725

Family and domain databases

InterProiView protein in InterPro
IPR032727 CLAMP
PfamiView protein in Pfam
PF14769 CLAMP, 1 hit

Sequences (4+)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 4 potential isoforms that are computationally mapped.iShow all

Isoform 1 (identifier: A1A4V9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLNRKTSHFL GMRVQSELEH LSELRREAGK DRSSVHGSAA RTRASVRTQW
60 70 80 90 100
TTAAAAKADE DPGANLFPPP LPRPRICMWK YLDVHSMHQL EKTTNAEMRE
110 120 130 140 150
VLAELLELGC PEQSLRDAIT LDLFCHALIF CRQQGFSLEQ TSAACALLQD
160 170 180 190 200
LHKACIATPL GNVEECYRYF TSVLFCHGVR RPPFSIDLFK EEQLLALEDY
210 220 230 240 250
VVNTYFRHFK LYKYVFTPQV RLDLSLTYMG LQPPKLWPES ETEKEESKEM
260 270 280 290 300
EEQAVTPQKE ELETVAPPEP EPSHIHVLRA YIKTQVNKEL EQLQGLVEER
310 320 330
LKASEERLSS KLTALERPFQ LPPGKGKSKT K
Length:331
Mass (Da):37,921
Last modified:January 23, 2007 - v1
Checksum:i1E91B401106D6CDC
GO
Isoform 2 (identifier: A1A4V9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-68: MLNRKTSHFL...DEDPGANLFP → MASYSGFSGLLEIRYGPGHRSCLPQFAFFPQ

Note: No experimental confirmation available.
Show »
Length:294
Mass (Da):33,880
Checksum:i032937134F1D6436
GO
Isoform 3 (identifier: A1A4V9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-228: Missing.

Note: No experimental confirmation available.
Show »
Length:103
Mass (Da):11,755
Checksum:iFFED79797497A42B
GO
Isoform 4 (identifier: A1A4V9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     157-176: ATPLGNVEECYRYFTSVLFC → GERGQLPGLSPREKRNRAWH
     177-330: Missing.

Note: No experimental confirmation available.
Show »
Length:177
Mass (Da):19,995
Checksum:iD0D63D4D5581458F
GO

Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H3BTQ9H3BTQ9_HUMAN
Coiled-coil domain-containing prote...
CCDC189
396Annotation score:
H0YGC5H0YGC5_HUMAN
Coiled-coil domain-containing prote...
CCDC189
145Annotation score:
F5H7A8F5H7A8_HUMAN
Coiled-coil domain-containing prote...
CCDC189
71Annotation score:
H3BNW1H3BNW1_HUMAN
Coiled-coil domain-containing prote...
CCDC189
91Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti244K → E in AAH92491 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0318071 – 228Missing in isoform 3. 1 PublicationAdd BLAST228
Alternative sequenceiVSP_0318081 – 68MLNRK…ANLFP → MASYSGFSGLLEIRYGPGHR SCLPQFAFFPQ in isoform 2. 1 PublicationAdd BLAST68
Alternative sequenceiVSP_045828157 – 176ATPLG…SVLFC → GERGQLPGLSPREKRNRAWH in isoform 4. 1 PublicationAdd BLAST20
Alternative sequenceiVSP_045829177 – 330Missing in isoform 4. 1 PublicationAdd BLAST154

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC106886 Genomic DNA No translation available.
CH471192 Genomic DNA Translation: EAW52202.1
CH471192 Genomic DNA Translation: EAW52206.1
BC073881 mRNA No translation available.
BC092491 mRNA Translation: AAH92491.1
BC128128 mRNA Translation: AAI28129.1
BC128129 mRNA Translation: AAI28130.1
CCDSiCCDS32434.2 [A1A4V9-1]
CCDS55993.1 [A1A4V9-4]
RefSeqiNP_001014979.2, NM_001014979.2 [A1A4V9-1]
NP_001182549.1, NM_001195620.1 [A1A4V9-4]
UniGeneiHs.724010

Genome annotation databases

EnsembliENST00000543610; ENSP00000437532; ENSG00000196118 [A1A4V9-1]
ENST00000545825; ENSP00000441164; ENSG00000196118 [A1A4V9-4]
GeneIDi90835
KEGGihsa:90835
UCSCiuc002dzm.4 human [A1A4V9-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiCC189_HUMAN
AccessioniPrimary (citable) accession number: A1A4V9
Secondary accession number(s): A1A4V8, F5GX13, Q569G2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: January 23, 2007
Last modified: September 12, 2018
This is version 85 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again