Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 89 (08 May 2019)
Sequence version 1 (23 Jan 2007)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Coiled-coil domain-containing protein 189

Gene

CCDC189

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Coiled-coil domain-containing protein 189
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CCDC189
Synonyms:C16orf93
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 16

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:28078 CCDC189

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
618318 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_A1A4V9

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000196118

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA164716879

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
CCDC189

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003218421 – 331Coiled-coil domain-containing protein 189Add BLAST331

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei34PhosphoserineBy similarity1

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQB - The MaxQuant DataBase

More...
MaxQBi
A1A4V9

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
A1A4V9

PRoteomics IDEntifications database

More...
PRIDEi
A1A4V9

ProteomicsDB human proteome resource

More...
ProteomicsDBi
95
96 [A1A4V9-2]
97 [A1A4V9-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
A1A4V9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
A1A4V9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000196118 Expressed in 143 organ(s), highest expression level in right uterine tube

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
A1A4V9 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
A1A4V9 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA041806
HPA046289

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
124769, 2 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000437532

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili286 – 317Sequence analysisAdd BLAST32

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IQKE Eukaryota
ENOG4111H80 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154323

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000067914

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
A1A4V9

Database of Orthologous Groups

More...
OrthoDBi
1491476at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
A1A4V9

TreeFam database of animal gene trees

More...
TreeFami
TF343725

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR032727 CLAMP

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF14769 CLAMP, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: A1A4V9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLNRKTSHFL GMRVQSELEH LSELRREAGK DRSSVHGSAA RTRASVRTQW
60 70 80 90 100
TTAAAAKADE DPGANLFPPP LPRPRICMWK YLDVHSMHQL EKTTNAEMRE
110 120 130 140 150
VLAELLELGC PEQSLRDAIT LDLFCHALIF CRQQGFSLEQ TSAACALLQD
160 170 180 190 200
LHKACIATPL GNVEECYRYF TSVLFCHGVR RPPFSIDLFK EEQLLALEDY
210 220 230 240 250
VVNTYFRHFK LYKYVFTPQV RLDLSLTYMG LQPPKLWPES ETEKEESKEM
260 270 280 290 300
EEQAVTPQKE ELETVAPPEP EPSHIHVLRA YIKTQVNKEL EQLQGLVEER
310 320 330
LKASEERLSS KLTALERPFQ LPPGKGKSKT K
Length:331
Mass (Da):37,921
Last modified:January 23, 2007 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i1E91B401106D6CDC
GO
Isoform 2 (identifier: A1A4V9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-68: MLNRKTSHFL...DEDPGANLFP → MASYSGFSGLLEIRYGPGHRSCLPQFAFFPQ

Note: No experimental confirmation available.
Show »
Length:294
Mass (Da):33,880
Checksum:i032937134F1D6436
GO
Isoform 3 (identifier: A1A4V9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-228: Missing.

Note: No experimental confirmation available.
Show »
Length:103
Mass (Da):11,755
Checksum:iFFED79797497A42B
GO
Isoform 4 (identifier: A1A4V9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     157-176: ATPLGNVEECYRYFTSVLFC → GERGQLPGLSPREKRNRAWH
     177-330: Missing.

Note: No experimental confirmation available.
Show »
Length:177
Mass (Da):19,995
Checksum:iD0D63D4D5581458F
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H3BTQ9H3BTQ9_HUMAN
Coiled-coil domain-containing prote...
CCDC189
396Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H7A8F5H7A8_HUMAN
Coiled-coil domain-containing prote...
CCDC189
71Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YGC5H0YGC5_HUMAN
Coiled-coil domain-containing prote...
CCDC189
145Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BNW1H3BNW1_HUMAN
Coiled-coil domain-containing prote...
CCDC189
91Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti244K → E in AAH92491 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0318071 – 228Missing in isoform 3. 1 PublicationAdd BLAST228
Alternative sequenceiVSP_0318081 – 68MLNRK…ANLFP → MASYSGFSGLLEIRYGPGHR SCLPQFAFFPQ in isoform 2. 1 PublicationAdd BLAST68
Alternative sequenceiVSP_045828157 – 176ATPLG…SVLFC → GERGQLPGLSPREKRNRAWH in isoform 4. 1 PublicationAdd BLAST20
Alternative sequenceiVSP_045829177 – 330Missing in isoform 4. 1 PublicationAdd BLAST154

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AC106886 Genomic DNA No translation available.
CH471192 Genomic DNA Translation: EAW52202.1
CH471192 Genomic DNA Translation: EAW52206.1
BC073881 mRNA No translation available.
BC092491 mRNA Translation: AAH92491.1
BC128128 mRNA Translation: AAI28129.1
BC128129 mRNA Translation: AAI28130.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS32434.2 [A1A4V9-1]
CCDS55993.1 [A1A4V9-4]

NCBI Reference Sequences

More...
RefSeqi
NP_001014979.2, NM_001014979.2 [A1A4V9-1]
NP_001182549.1, NM_001195620.1 [A1A4V9-4]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000543610; ENSP00000437532; ENSG00000196118 [A1A4V9-1]
ENST00000545825; ENSP00000441164; ENSG00000196118 [A1A4V9-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
90835

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:90835

UCSC genome browser

More...
UCSCi
uc002dzm.4 human [A1A4V9-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC106886 Genomic DNA No translation available.
CH471192 Genomic DNA Translation: EAW52202.1
CH471192 Genomic DNA Translation: EAW52206.1
BC073881 mRNA No translation available.
BC092491 mRNA Translation: AAH92491.1
BC128128 mRNA Translation: AAI28129.1
BC128129 mRNA Translation: AAI28130.1
CCDSiCCDS32434.2 [A1A4V9-1]
CCDS55993.1 [A1A4V9-4]
RefSeqiNP_001014979.2, NM_001014979.2 [A1A4V9-1]
NP_001182549.1, NM_001195620.1 [A1A4V9-4]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi124769, 2 interactors
STRINGi9606.ENSP00000437532

PTM databases

iPTMnetiA1A4V9
PhosphoSitePlusiA1A4V9

Polymorphism and mutation databases

BioMutaiCCDC189

Proteomic databases

MaxQBiA1A4V9
PaxDbiA1A4V9
PRIDEiA1A4V9
ProteomicsDBi95
96 [A1A4V9-2]
97 [A1A4V9-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000543610; ENSP00000437532; ENSG00000196118 [A1A4V9-1]
ENST00000545825; ENSP00000441164; ENSG00000196118 [A1A4V9-4]
GeneIDi90835
KEGGihsa:90835
UCSCiuc002dzm.4 human [A1A4V9-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
90835

GeneCards: human genes, protein and diseases

More...
GeneCardsi
CCDC189
HGNCiHGNC:28078 CCDC189
HPAiHPA041806
HPA046289
MIMi618318 gene
neXtProtiNX_A1A4V9
OpenTargetsiENSG00000196118
PharmGKBiPA164716879

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IQKE Eukaryota
ENOG4111H80 LUCA
GeneTreeiENSGT00940000154323
HOGENOMiHOG000067914
InParanoidiA1A4V9
OrthoDBi1491476at2759
PhylomeDBiA1A4V9
TreeFamiTF343725

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
CCDC189 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
90835

Protein Ontology

More...
PROi
PR:A1A4V9

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000196118 Expressed in 143 organ(s), highest expression level in right uterine tube
ExpressionAtlasiA1A4V9 baseline and differential
GenevisibleiA1A4V9 HS

Family and domain databases

InterProiView protein in InterPro
IPR032727 CLAMP
PfamiView protein in Pfam
PF14769 CLAMP, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCC189_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: A1A4V9
Secondary accession number(s): A1A4V8, F5GX13, Q569G2
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: January 23, 2007
Last modified: May 8, 2019
This is version 89 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again