Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 35 (29 Sep 2021)
Sequence version 1 (20 Jan 2016)
Previous versions | rss
Add a publicationFeedback
Protein

Indole-3-pyruvate monooxygenase YUCCA1

Gene

YUCCA1

Organism
Oryza sativa subsp. japonica (Rice)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Involved in auxin biosynthesis (PubMed:17220367, PubMed:29740464).

Converts the indole-3-pyruvic acid (IPA) produced by the TAA family to indole-3-acetic acid (IAA) (Probable). Functions downstream of TAR2 in auxin biosynthesis (PubMed:29740464).

Functions upstream of WOX11, a transcription factor that promotes the development of crown roots (PubMed:29740464).

1 Publication2 Publications

Miscellaneous

Calli overexpressing YUCCA1 exhibit high levels of auxin, low regeneration frequency, overgrowing roots, and abnormal root morphology (PubMed:17220367, PubMed:29740464). Plants silencing YUCCA1 exhibit severe dwarfism, inhibition of shoot elongation and root formation and elongation (PubMed:17220367).2 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

FADCurated

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi21 – 26FADSequence analysis6
Nucleotide bindingi184 – 189NADPSequence analysis6

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionMonooxygenase, Oxidoreductase
LigandFAD, Flavoprotein, NADP

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes for plant species

More...
PlantReactomei
R-OSA-1119486, IAA biosynthesis I

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Indole-3-pyruvate monooxygenase YUCCA1Curated (EC:1.14.13.1681 Publication)
Short name:
OsYUCCA12 Publications
Alternative name(s):
Flavin-containing monooxygenase YUCCA1Curated
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:YUCCA12 Publications
Ordered Locus Names:Os01g0645400Imported, LOC_Os01g45760Curated
ORF Names:P0707D10.26Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiOryza sativa subsp. japonica (Rice)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri39947 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliopsidaLiliopsidaPoalesPoaceaeBOP cladeOryzoideaeOryzeaeOryzinaeOryzaOryza sativa
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000059680 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1
  • UP000000763 Componenti: Chromosome 1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00004452791 – 406Indole-3-pyruvate monooxygenase YUCCA1Add BLAST406

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
A0A0P0V5U9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in coleoptile tips, root tips, leaf blade tips, shoot apical meristem, vasculature of stems and flowers.1 Publication

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
4530.OS01T0645400-02

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the FMO family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1399, Eukaryota

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_006909_2_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
A0A0P0V5U9

Identification of Orthologs from Complete Genome Data

More...
OMAi
TWRHRTY

Database of Orthologous Groups

More...
OrthoDBi
405736at2759

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.50.50.60, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR036188, FAD/NAD-bd_sf
IPR020946, Flavin_mOase-like

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00743, FMO-like, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF51905, SSF51905, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: A0A0P0V5U9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDNKPAQERR ETWVPGAVIV GAGPSGLAAA ACLAARGVPA TVLERSDSLA
60 70 80 90 100
STWRHRMYDR LALHLPKRFC ELPLLPFPEE YPTYPSKDQF VAYMEAYAAA
110 120 130 140 150
AGVAPRFGAT VEEAAFDAAV GAWRVRLDGG EVLMARWLVV ATGENAEPRV
160 170 180 190 200
PDFPGMQKFA GCAMHTSEYK SGEQFAGKKV LVVGCGNSGM EVSLDLCRHG
210 220 230 240 250
AKPSMVVRNT VHVLPREMFG LSTFGIAMAL LRWLPVQLVD RFLLTAAHLI
260 270 280 290 300
LGNTGQFGLR RPKTGPIELK NLTGRTPVLD VGTLDHIKSG KIKVVGAVKE
310 320 330 340 350
MTRQGVRFTD GKEEQFDTII LATGYRSNVP SWLKDAGDLF TREGISKVPF
360 370 380 390 400
PNSWRGRNGL YTVGFTQRGL LGTSSDALNV AKDIHCQWRE RDRSAINVLE

ISNSSF
Length:406
Mass (Da):44,388
Last modified:January 20, 2016 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i432622B7DA6F4F1C
GO
Isoform 2 (identifier: A0A0P0V5U9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     335-406: DAGDLFTREG...NVLEISNSSF → VKQSVTHSCSFYFSFCPHCTILLLVIYISR

Show »
Length:364
Mass (Da):39,852
Checksum:iBD53A81BC91EF22A
GO

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAH91211 differs from that shown. Reason: Erroneous gene model prediction.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_059850335 – 406DAGDL…SNSSF → VKQSVTHSCSFYFSFCPHCT ILLLVIYISR in isoform 2. Add BLAST72

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AP002910 Genomic DNA Translation: BAD68007.1
AP008207 Genomic DNA Translation: BAH91211.1 Sequence problems.
AP014957 Genomic DNA Translation: BAS73400.1
AP014957 Genomic DNA Translation: BAS73401.1
AK105488 mRNA Translation: BAG97267.1

NCBI Reference Sequences

More...
RefSeqi
XP_015643006.1, XM_015787520.1 [A0A0P0V5U9-1]

Genome annotation databases

Ensembl plant genome annotation project

More...
EnsemblPlantsi
Os01t0645400-01; Os01t0645400-01; Os01g0645400 [A0A0P0V5U9-2]
Os01t0645400-02; Os01t0645400-02; Os01g0645400 [A0A0P0V5U9-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
9269185

Gramene; a comparative resource for plants

More...
Gramenei
Os01t0645400-01; Os01t0645400-01; Os01g0645400 [A0A0P0V5U9-2]
Os01t0645400-02; Os01t0645400-02; Os01g0645400 [A0A0P0V5U9-1]

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
osa:9269185

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AP002910 Genomic DNA Translation: BAD68007.1
AP008207 Genomic DNA Translation: BAH91211.1 Sequence problems.
AP014957 Genomic DNA Translation: BAS73400.1
AP014957 Genomic DNA Translation: BAS73401.1
AK105488 mRNA Translation: BAG97267.1
RefSeqiXP_015643006.1, XM_015787520.1 [A0A0P0V5U9-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

STRINGi4530.OS01T0645400-02

Proteomic databases

PaxDbiA0A0P0V5U9

Genome annotation databases

EnsemblPlantsiOs01t0645400-01; Os01t0645400-01; Os01g0645400 [A0A0P0V5U9-2]
Os01t0645400-02; Os01t0645400-02; Os01g0645400 [A0A0P0V5U9-1]
GeneIDi9269185
GrameneiOs01t0645400-01; Os01t0645400-01; Os01g0645400 [A0A0P0V5U9-2]
Os01t0645400-02; Os01t0645400-02; Os01g0645400 [A0A0P0V5U9-1]
KEGGiosa:9269185

Phylogenomic databases

eggNOGiKOG1399, Eukaryota
HOGENOMiCLU_006909_2_0_1
InParanoidiA0A0P0V5U9
OMAiTWRHRTY
OrthoDBi405736at2759

Enzyme and pathway databases

PlantReactomeiR-OSA-1119486, IAA biosynthesis I

Family and domain databases

Gene3Di3.50.50.60, 1 hit
InterProiView protein in InterPro
IPR036188, FAD/NAD-bd_sf
IPR020946, Flavin_mOase-like
PfamiView protein in Pfam
PF00743, FMO-like, 1 hit
SUPFAMiSSF51905, SSF51905, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiYUC1_ORYSJ
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: A0A0P0V5U9
Secondary accession number(s): C7IW71, Q5VRB9
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 10, 2018
Last sequence update: January 20, 2016
Last modified: September 29, 2021
This is version 35 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Oryza sativa (rice)
    Index of Oryza sativa entries and their corresponding gene designations
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again