UniProtKB - A0A0G2JN95 (A0A0G2JN95_HUMAN)

BLAST

>tr|A0A0G2JN95|A0A0G2JN95_HUMAN Cysteine-rich motor neuron 1 protein (Fragment) OS=Homo sapiens OX=9606 GN=CRIM1 PE=1 SV=1
CPGSIVQGVCGCCYTCASQRNESCGGTFGIYGTCDRGLRCVIRPPLNGDSLTEYEAGVCE

Align
Format
Add to basket Added to basket
History
Entry version 15 (18 Jul 2018)
Sequence version 1 (22 Jul 2015)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

Submitted name:

Cysteine-rich motor neuron 1 protein

Gene

CRIM1

Organism

Homo sapiens (Human)

Status

Unreviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

GO - Molecular functionⁱ

insulin-like growth factor binding Source: InterPro

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

regulation of cell growth Source: InterPro

View the complete GO annotation on QuickGO ...

Names & Taxonomyⁱ

Protein namesⁱ	Submitted name: Cysteine-rich motor neuron 1 proteinImported
Gene namesⁱ	Name:CRIM1Imported
Organismⁱ	Homo sapiens (Human)Imported
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 2

Organism-specific databases

Human Gene Nomenclature Database More...HGNCⁱ	HGNC:2359 CRIM1

HGNCⁱ

HGNC:2359 CRIM1

Subcellular locationⁱ

GO - Cellular component

PTM / Processingⁱ

Proteomic databases

PeptideAtlas More...PeptideAtlasⁱ	A0A0G2JN95

PeptideAtlasⁱ

A0A0G2JN95

Interactionⁱ

GO - Molecular functionⁱ

insulin-like growth factor binding Source: InterPro

View the complete GO annotation on QuickGO ...

Structureⁱ

3D structure databases

ProteinModelPortalⁱ	A0A0G2JN95
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Family & Domainsⁱ

Domains and Repeats

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Domainⁱ	1 – 60	IGFBP N-terminalInterPro annotationAdd BLAST		60

Family and domain databases

InterProⁱ	View protein in InterPro IPR009030 Growth_fac_rcpt_cys_sf IPR000867 IGFBP-like IPR011390 IGFBP_rP_mac25
PANTHERⁱ	PTHR14186 PTHR14186, 1 hit
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF00219 IGFBP, 1 hit
SUPFAMⁱ	SSF57184 SSF57184, 1 hit
PROSITEⁱ	View protein in PROSITE PS51323 IGFBP_N_2, 1 hit

Sequence (1+)ⁱ

Sequence statusⁱ: Fragment.

This entry has 1 described isoform and 6 potential isoforms that are computationally mapped.Show all Align All

A0A0G2JN95-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
CPGSIVQGVC GCCYTCASQR NESCGGTFGI YGTCDRGLRC VIRPPLNGDS 
        60
LTEYEAGVCE

Length:60

Mass (Da):6,271

Last modified:July 22, 2015 - v1

Checksum:ⁱEFEB36B331730197

Computationally mapped potential isoform sequencesⁱ

There are 6 potential isoforms mapped to this entry.BLAST Align Show all Add to basket

Entry	Entry name	Protein names	Gene names	Length	Annotation

Q9NZV1	CRIM1_HUMAN	Cysteine-rich motor neuron 1 protei... Cysteine-rich motor neuron 1 protein, CRIM-1 (Cysteine-rich repeat-containing protein S52) [Cleaved into: Processed cysteine-rich motor neuron 1 protein]	CRIM1 S52, UNQ1886/PRO4330	1,036	Annotation score:
Q53TH9	Q53TH9_HUMAN	Cysteine-rich motor neuron 1 protei... Cysteine-rich motor neuron 1 protein	CRIM1	110	Annotation score:
H7C2T6	H7C2T6_HUMAN	Cysteine-rich motor neuron 1 protei... Cysteine-rich motor neuron 1 protein	CRIM1	222	Annotation score:
H7C458	H7C458_HUMAN	Cysteine-rich motor neuron 1 protei... Cysteine-rich motor neuron 1 protein	CRIM1	55	Annotation score:
A0A0G2JN98	A0A0G2JN98_HUMAN	Cysteine-rich motor neuron 1 protei... Cysteine-rich motor neuron 1 protein	CRIM1	51	Annotation score:
H7C1Z0	H7C1Z0_HUMAN	Cysteine-rich motor neuron 1 protei... Cysteine-rich motor neuron 1 protein	CRIM1	175	Annotation score:

Experimental Info

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Non-terminal residueⁱ	1	Imported		1
Non-terminal residueⁱ	60	Imported		1

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AC009414 Genomic DNA No translation available.

Select the link destinations:
EMBLⁱ
GenBankⁱ
DDBJⁱ

Links Updated

AC009414 Genomic DNA No translation available.

Genome annotation databases

Ensemblⁱ	ENST00000613124; ENSP00000480932; ENSG00000277354

Ensemblⁱ

ENST00000613124; ENSP00000480932; ENSG00000277354

Protein	Similar proteins		Species	Score	Length	Source
A0A0G2JN95	Uncharacterized protein		PONAB		161	UniRef100_K7ETU6
Uncharacterized protein CRIM1 (Fragment)		HUMAN		763
Cysteine-rich motor neuron 1 protein (Fragment)		HUMAN		110
Uncharacterized protein CRIM1 (Fragment)		HUMAN		161
cDNA FLJ51320, highly similar to Cysteine-rich motor neuron 1 protein		HUMAN		165
+2

Protein	Similar proteins		Species	Score	Length	Source
A0A0G2JN95	Cysteine-rich motor neuron 1 protein		HUMAN		1036	UniRef90_Q9NZV1
Cysteine rich transmembrane BMP regulator 1 (Chordin-like)		PANTR		1042
Uncharacterized protein		RHIRO		1041
Uncharacterized protein		RHIBE		1041
Uncharacterized protein		PAPAN		1040
+51

Protein	Similar proteins		Species	Score	Length	Source
A0A0G2JN95	Cysteine-rich motor neuron 1 protein		HUMAN		1036	UniRef50_Q9NZV1
Cysteine-rich motor neuron 1 protein		MOUSE		1037
Cysteine-rich motor neuron 1 protein		CHICK		1048
Cysteine-rich motor neuron 1 protein		DANRE		1027
Cysteine rich transmembrane BMP regulator 1 (Chordin-like)		PANTR		1042
+438

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AC009414 Genomic DNA No translation available.

Select the link destinations:
EMBLⁱ
GenBankⁱ
DDBJⁱ

Links Updated

AC009414 Genomic DNA No translation available.

3D structure databases

ProteinModelPortalⁱ	A0A0G2JN95
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Proteomic databases

PeptideAtlasⁱ	A0A0G2JN95

PeptideAtlasⁱ

A0A0G2JN95

Protocols and materials databases

Structural Biology Knowledgebase	Search...

Structural Biology Knowledgebase

Search...

Genome annotation databases

Ensemblⁱ	ENST00000613124; ENSP00000480932; ENSG00000277354

Ensemblⁱ

ENST00000613124; ENSP00000480932; ENSG00000277354

Organism-specific databases

HGNCⁱ	HGNC:2359 CRIM1
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Miscellaneous databases

ChiTaRSⁱ	CRIM1 human

ChiTaRSⁱ

CRIM1 human

Family and domain databases

InterProⁱ	View protein in InterPro IPR009030 Growth_fac_rcpt_cys_sf IPR000867 IGFBP-like IPR011390 IGFBP_rP_mac25
PANTHERⁱ	PTHR14186 PTHR14186, 1 hit
Pfamⁱ	View protein in Pfam PF00219 IGFBP, 1 hit
SUPFAMⁱ	SSF57184 SSF57184, 1 hit
PROSITEⁱ	View protein in PROSITE PS51323 IGFBP_N_2, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	A0A0G2JN95_HUMAN
Accessionⁱ	A0A0G2JN95Primary (citable) accession number: A0A0G2JN95
Entry historyⁱ	Integrated into UniProtKB/TrEMBL:	July 22, 2015
	Last sequence update:	July 22, 2015
	Last modified:	July 18, 2018
	This is version 15 of the entry and version 1 of the sequence. See complete history.
Entry statusⁱ	Unreviewed (UniProtKB/TrEMBL)
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

Complete proteome, Proteomics identificationCombined sources, Reference proteomeImported

UniProtKB - A0A0G2JN95 (A0A0G2JN95_HUMAN)

Your basket is currently empty. ⁱ

Cysteine-rich motor neuron 1 protein

CRIM1

Select a section on the left to see content.

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Organism-specific databases

Subcellular locationⁱ

Extracellular region or secreted

PTM / Processingⁱ

Proteomic databases

Interactionⁱ

GO - Molecular functionⁱ

Structureⁱ

3D structure databases

Family & Domainsⁱ

Domains and Repeats

Family and domain databases

Sequence (1+)ⁱ

Computationally mapped potential isoform sequencesⁱ

Experimental Info

Sequence databases

Genome annotation databases

Similar proteinsⁱ

Cross-referencesⁱ

Sequence databases

3D structure databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Miscellaneous databases

Family and domain databases

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ

UniProt is an ELIXIR core data resource

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - A0A0G2JN95 (A0A0G2JN95_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Cysteine-rich motor neuron 1 protein

CRIM1

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Proteomic databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Family and domain databases

Experimental Info

Sequence databases

Genome annotation databases

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Miscellaneous databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

PTM / Processingⁱ

Interactionⁱ

GO - Molecular functionⁱ

Structureⁱ

Family & Domainsⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ