UniProtKB - A0A096LNJ5 (A0A096LNJ5_HUMAN)

BLAST

>tr|A0A096LNJ5|A0A096LNJ5_HUMAN Putative bifunctional UDP-N-acetylglucosamine transferase and deubiquitinase ALG13 (Fragment) OS=Homo sapiens OX=9606 GN=ALG13 PE=4 SV=1
XPPLPGFDSCLPVVPDYSCVPPWHPVGTAYGGSSQIHGAINPGPIGCIAPSPPASHYVPQ
ESKTKSLCFWITHLILN

Align
Format
Add to basket Added to basket
History
Entry version 18 (12 Sep 2018)
Sequence version 1 (26 Nov 2014)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

Submitted name:

Putative bifunctional UDP-N-acetylglucosamine transferase and deubiquitinase ALG13

Gene

ALG13

Organism

Homo sapiens (Human)

Status

Unreviewed-Annotation score: -Protein predictedⁱ

Names & Taxonomyⁱ

Protein namesⁱ	Submitted name: Putative bifunctional UDP-N-acetylglucosamine transferase and deubiquitinase ALG13Imported
Gene namesⁱ	Name:ALG13Imported
Organismⁱ	Homo sapiens (Human)Imported
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome X

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000101901.10
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:30881 ALG13

Pathology & Biotechⁱ

Organism-specific databases

Open Targets More...OpenTargetsⁱ	ENSG00000101901

OpenTargetsⁱ

ENSG00000101901

Expressionⁱ

Gene expression databases

Bgeeⁱ	ENSG00000101901 Expressed in 220 organ(s), highest expression level in female gonad
ExpressionAtlasⁱ	A0A096LNJ5 baseline and differential

Structureⁱ

3D structure databases

ProteinModelPortalⁱ	A0A096LNJ5
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Family & Domainsⁱ

Phylogenomic databases

eggNOGⁱ	KOG2605 Eukaryota KOG3349 Eukaryota COG5017 LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00530000063508

Sequence (1+)ⁱ

Sequence statusⁱ: Fragment.

This entry has 1 described isoform and 14 potential isoforms that are computationally mapped.Show all Align All

A0A096LNJ5-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
XPPLPGFDSC LPVVPDYSCV PPWHPVGTAY GGSSQIHGAI NPGPIGCIAP 
        60         70 
SPPASHYVPQ ESKTKSLCFW ITHLILN

Length:77

Mass (Da):8,131

Last modified:November 26, 2014 - v1

Checksum:ⁱ508F54A20C7FB450

Computationally mapped potential isoform sequencesⁱ

There are 14 potential isoforms mapped to this entry.BLAST Align Show all Add to basket

	Entry	Entry name	Protein names	Gene names	Length	Annotation

	Q9NP73	ALG13_HUMAN	Putative bifunctional UDP-N-acetylg... Putative bifunctional UDP-N-acetylglucosamine transferase and deubiquitinase ALG13, EC 2.4.1.141, EC 3.4.19.12 (Asparagine-linked glycosylation 13 homolog) (Glycosyltransferase 28 domain-containing protein 1) (UDP-N-acetylglucosamine transferase subunit ALG13 homolog)	ALG13 CXorf45, GLT28D1, MDS031	1,137	Annotation score:
	A0A087WX43	A0A087WX43_HUMAN	Putative bifunctional UDP-N-acetylg... Putative bifunctional UDP-N-acetylglucosamine transferase and deubiquitinase ALG13	ALG13	133	Annotation score:
	D6RE84	D6RE84_HUMAN	Putative bifunctional UDP-N-acetylg... Putative bifunctional UDP-N-acetylglucosamine transferase and deubiquitinase ALG13	ALG13	159	Annotation score:
	A0A087WTT9	A0A087WTT9_HUMAN	Putative bifunctional UDP-N-acetylg... Putative bifunctional UDP-N-acetylglucosamine transferase and deubiquitinase ALG13	ALG13	171	Annotation score:
	A0A096LNJ4	A0A096LNJ4_HUMAN	Putative bifunctional UDP-N-acetylg... Putative bifunctional UDP-N-acetylglucosamine transferase and deubiquitinase ALG13	ALG13	132	Annotation score:
	A0A096LP10	A0A096LP10_HUMAN	Putative bifunctional UDP-N-acetylg... Putative bifunctional UDP-N-acetylglucosamine transferase and deubiquitinase ALG13	ALG13	162	Annotation score:
	A0A1B0GVW6	A0A1B0GVW6_HUMAN	Putative bifunctional UDP-N-acetylg... Putative bifunctional UDP-N-acetylglucosamine transferase and deubiquitinase ALG13	ALG13	296	Annotation score:
	A0A087WT15	A0A087WT15_HUMAN	Putative bifunctional UDP-N-acetylg... Putative bifunctional UDP-N-acetylglucosamine transferase and deubiquitinase ALG13	ALG13	61	Annotation score:
	A0A096LNL2	A0A096LNL2_HUMAN	Putative bifunctional UDP-N-acetylg... Putative bifunctional UDP-N-acetylglucosamine transferase and deubiquitinase ALG13	ALG13	150	Annotation score:
	A0A096LPI3	A0A096LPI3_HUMAN	Putative bifunctional UDP-N-acetylg... Putative bifunctional UDP-N-acetylglucosamine transferase and deubiquitinase ALG13	ALG13	373	Annotation score:
There are more potential isoformsShow all

Experimental Info

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Non-terminal residueⁱ	1	Imported		1

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AL049563 Genomic DNA No translation available. AL096764 Genomic DNA No translation available.

Select the link destinations:
EMBLⁱ
GenBankⁱ
DDBJⁱ

Links Updated

AL049563 Genomic DNA No translation available.
AL096764 Genomic DNA No translation available.

Genome annotation databases

Ensemblⁱ	ENST00000623310; ENSP00000485071; ENSG00000101901
UCSC genome browser More...UCSCⁱ	uc065ato.1 human

Protein	Similar proteins		Species	Score	Length	Source
A0A096LNJ5	ALG13 isoform 41 (Fragment)		PANTR		76	UniRef100_A0A096LNJ5

Protein	Similar proteins		Species	Score	Length	Source
A0A096LNJ5	ALG13 isoform 41 (Fragment)		PANTR		76	UniRef90_A0A096LNJ5
ALG13 isoform 4 (Fragment)		PONAB		76

Protein	Similar proteins		Species	Score	Length	Source
A0A096LNJ5	ALG13 isoform 41 (Fragment)		PANTR		76	UniRef50_A0A096LNJ5
ALG13 isoform 4 (Fragment)		PONAB		76

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AL049563 Genomic DNA No translation available. AL096764 Genomic DNA No translation available.

Select the link destinations:
EMBLⁱ
GenBankⁱ
DDBJⁱ

Links Updated

AL049563 Genomic DNA No translation available.
AL096764 Genomic DNA No translation available.

3D structure databases

ProteinModelPortalⁱ	A0A096LNJ5
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protocols and materials databases

Structural Biology Knowledgebase	Search...

Structural Biology Knowledgebase

Search...

Genome annotation databases

Ensemblⁱ	ENST00000623310; ENSP00000485071; ENSG00000101901
UCSCⁱ	uc065ato.1 human

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000101901.10
HGNCⁱ	HGNC:30881 ALG13
OpenTargetsⁱ	ENSG00000101901
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	KOG2605 Eukaryota KOG3349 Eukaryota COG5017 LUCA
GeneTreeⁱ	ENSGT00530000063508

Miscellaneous databases

ChiTaRSⁱ	ALG13 human

ChiTaRSⁱ

ALG13 human

Gene expression databases

Bgeeⁱ	ENSG00000101901 Expressed in 220 organ(s), highest expression level in female gonad
ExpressionAtlasⁱ	A0A096LNJ5 baseline and differential

Family and domain databases

ProtoNetⁱ	Search...

ProtoNetⁱ

Search...

Entry informationⁱ

Entry nameⁱ	A0A096LNJ5_HUMAN
Accessionⁱ	A0A096LNJ5Primary (citable) accession number: A0A096LNJ5
Entry historyⁱ	Integrated into UniProtKB/TrEMBL:	November 26, 2014
	Last sequence update:	November 26, 2014
	Last modified:	September 12, 2018
	This is version 18 of the entry and version 1 of the sequence. See complete history.
Entry statusⁱ	Unreviewed (UniProtKB/TrEMBL)
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

Complete proteome, Reference proteomeImported

UniProtKB - A0A096LNJ5 (A0A096LNJ5_HUMAN)

Your basket is currently empty. ⁱ

Putative bifunctional UDP-N-acetylglucosamine transferase and deubiquitinase ALG13

ALG13

Select a section on the left to see content.

Names & Taxonomyⁱ

Organism-specific databases

Pathology & Biotechⁱ

Organism-specific databases

Expressionⁱ

Gene expression databases

Structureⁱ

3D structure databases

Family & Domainsⁱ

Phylogenomic databases

Sequence (1+)ⁱ

Computationally mapped potential isoform sequencesⁱ

Experimental Info

Sequence databases

Genome annotation databases

Similar proteinsⁱ

Cross-referencesⁱ

Sequence databases

3D structure databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Miscellaneous databases

Gene expression databases

Family and domain databases

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ

UniProt is an ELIXIR core data resource

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - A0A096LNJ5 (A0A096LNJ5_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Putative bifunctional UDP-N-acetylglucosamine transferase and deubiquitinase ALG13

ALG13

Select a section on the left to see content.

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Phylogenomic databases

Experimental Info

Sequence databases

Genome annotation databases

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Names & Taxonomyⁱ

Pathology & Biotechⁱ

Expressionⁱ

Structureⁱ

Family & Domainsⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ