Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Dual specificity protein phosphatase lip-1

Gene

lip-1

Organism
Caenorhabditis elegans
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Dephosphorylates MAP kinase mpk-1.4 Publications

Catalytic activityi

Protein tyrosine phosphate + H2O = protein tyrosine + phosphate.1 Publication
[a protein]-serine/threonine phosphate + H2O = [a protein]-serine/threonine + phosphate.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei271Phosphocysteine intermediateBy similarity1

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionHydrolase, Protein phosphatase
Biological processCell cycle, Cell division, Differentiation, Meiosis, Mitosis, Oogenesis

Enzyme and pathway databases

ReactomeiR-CEL-112409. RAF-independent MAPK1/3 activation.
R-CEL-202670. ERKs are inactivated.
R-CEL-5675221. Negative regulation of MAPK pathway.
SignaLinkiO44128.

Names & Taxonomyi

Protein namesi
Recommended name:
Dual specificity protein phosphatase lip-1Curated (EC:3.1.3.161 Publication, EC:3.1.3.481 Publication)
Alternative name(s):
Lateral signaling-induced phosphatase 1Imported
Mitogen-activated protein kinase phosphatase lip-1Curated
Short name:
MAP kinase phosphatase lip-1By similarity
Gene namesi
Name:lip-1Imported
ORF Names:C05B10.1Imported
OrganismiCaenorhabditis elegansImported
Taxonomic identifieri6239 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaNematodaChromadoreaRhabditidaRhabditoideaRhabditidaePeloderinaeCaenorhabditis
Proteomesi
  • UP000001940 Componenti: Chromosome IV

Organism-specific databases

WormBaseiC05B10.1a; CE31151; WBGene00003043; lip-1.
C05B10.1b; CE49310; WBGene00003043; lip-1.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Disruption phenotypei

Pachytene exit and oocyte development are accelerated (PubMed:12169634, PubMed:21901106). These are associated with the accumulation of smaller oocytes in the proximal gonadal arm, the misalignment of oocytes in multiple rows, a premature nucleolus breakdown and an abnormal mpk-1 phosphorylation after pachytene exit and in diakinesis oocytes (PubMed:12169634, PubMed:21901106). 53 percent of mutants have endomitotic oocytes (PubMed:12169634). Embryo development is arrested before morphogenesis resulting in 50 percent embryonic lethality (PubMed:12169634). In adults, but not in larvae, reduced number of germ cells in the mitotic region of the gonad (PubMed:16319922). Moderate increase in the number of apoptotic corpses in the germline which is further enhanced following gamma irradiation (PubMed:21901106). Increased egl-1 mRNA expression in response to gamma irradiation (PubMed:21901106). Increased cep-1 expression in early pachytene germ cells (PubMed:21901106). Increased life span (PubMed:20624915). Increased MAP kinase activity (PubMed:11161219). Reduced levels of mpk-1 isoform b associated with an increase in mpk-1 isoform b phosphorylation (PubMed:21901106). In lip-1 and let-23, lip-1 and sem-5, and lip-1 and mpk-1 double mutants, normal vulva induction is restored (PubMed:11161219). In lip-1 and mpk-1 double mutants, normal oocyte development and fertility are restored (PubMed:12169634). lip-1 and puf-8 double mutant produces only sperm and has abnormal mpk-1 phosphorylation in the transition zone at the permissive temperature of 20 degrees Celsius. At the restrictive temperature of 25 degrees Celsius, has proximal germline tumors with high levels of mpk-1 phosphorylation (PubMed:22820175).6 Publications

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi59 – 60RR → AA: Loss of MAPK1/3 dephosphorylation. 1 Publication2
Mutagenesisi310P → L in zh32; at the restrictive temperature of 25 degrees Celsius, 87 percent of mutants have endomitotic oocytes. 1 Publication1

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00004424941 – 381Dual specificity protein phosphatase lip-1CuratedAdd BLAST381

Proteomic databases

EPDiV6CIV8.
PeptideAtlasiO44128.

Expressioni

Tissue specificityi

Expressed in vulva cell precursors. Expression is increased in P5.p and P7.p and their descendants during vulva induction. Expressed in syncytium hyp7 (PubMed:11161219). Expressed in germline cells (PubMed:12169634, PubMed:16319922).3 Publications

Developmental stagei

Expressed at low level in the proximal mitotic region and transition zone of germline cells and at the pachytene stage of meiotic prophase I.2 Publications

Gene expression databases

BgeeiWBGene00003043.
ExpressionAtlasiV6CIV8. baseline.

Interactioni

Protein-protein interaction databases

IntActiV6CIV8. 1 interactor.

Structurei

3D structure databases

ProteinModelPortaliV6CIV8.
SMRiV6CIV8.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini184 – 326Tyrosine-protein phosphataseSequence analysisAdd BLAST143

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni56 – 68KIM1 PublicationAdd BLAST13

Domaini

The KIM (kinase interacting motif) region may be involved in the binding to MAP kinases.1 Publication

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG1717. Eukaryota.
COG2453. LUCA.
GeneTreeiENSGT00760000118902.
HOGENOMiHOG000114628.
InParanoidiO44128.
KOiK04459.
OMAiRIFHERS.
OrthoDBiEOG091G0249.

Family and domain databases

CDDicd00127. DSPc. 1 hit.
Gene3Di3.40.250.10. 1 hit.
3.90.190.10. 1 hit.
InterProiView protein in InterPro
IPR020417. Atypical_DUSP.
IPR000340. Dual-sp_phosphatase_cat-dom.
IPR024950. DUSP.
IPR008343. MKP.
IPR029021. Prot-tyrosine_phosphatase-like.
IPR036873. Rhodanese-like_dom_sf.
IPR000387. TYR_PHOSPHATASE_dom.
IPR020422. TYR_PHOSPHATASE_DUAL_dom.
PANTHERiPTHR10159. PTHR10159. 1 hit.
PfamiView protein in Pfam
PF00782. DSPc. 1 hit.
PRINTSiPR01908. ADSPHPHTASE.
PR01764. MAPKPHPHTASE.
SMARTiView protein in SMART
SM00195. DSPc. 1 hit.
SUPFAMiSSF52799. SSF52799. 1 hit.
PROSITEiView protein in PROSITE
PS50056. TYR_PHOSPHATASE_2. 1 hit.
PS50054. TYR_PHOSPHATASE_DUAL. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform bImported (identifier: V6CIV8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTTHLPSTSQ NGEEISAEQF NRIFHERNVI VLDCRSNGDS VKRANRFFCS
60 70 80 90 100
LRLPALLQRR LMGGSMRLST VPDLKDLNNS PDQCPEVLLI PGDSEQDEQL
110 120 130 140 150
SAALARNLKS NHYRHFVLGE PVKTLLSQFP TLRDAADENW NTTFQMNSMP
160 170 180 190 200
GQASGQQASS GPLLNLNQLR LEGEDQGGKQ RAEFPVKLTN FLYLGNAETA
210 220 230 240 250
KNRDVLKKYS ISHVINVTSN LPNTFEEDPN MRYLRISADD NASHNLTKFF
260 270 280 290 300
PEAISFIDDA RRNDSACLVH CLAGISRSVT ICLAYLMKTE MCTLDSAYEW
310 320 330 340 350
VQKRNASIAP NFHFMGQLTD YEKMLGLNSN RVGTYPSSAP RSPSCAIEAA
360 370 380
AVSQVGGLLT PPPTSCSASP QSSNHSAKSF H
Note: No experimental confirmation available.Curated
Length:381
Mass (Da):42,174
Last modified:February 19, 2014 - v1
Checksum:iC6AB1FBC4A2C47C5
GO
Isoform aImported (identifier: V6CIV8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     334-369: TYPSSAPRSPSCAIEAAAVSQVGGLLTPPPTSCSAS → VSRQAVNFDVHFFCIFKLKKKEENSPESRILAETAV
     370-381: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:369
Mass (Da):41,586
Checksum:i5A13DEA9C5198A17
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_059250334 – 369TYPSS…SCSAS → VSRQAVNFDVHFFCIFKLKK KEENSPESRILAETAV in isoform a. CuratedAdd BLAST36
Alternative sequenceiVSP_059251370 – 381Missing in isoform a. CuratedAdd BLAST12

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BX284604 Genomic DNA. Translation: CCD63076.1.
BX284604 Genomic DNA. Translation: CDK13377.1.
PIRiT32494.
RefSeqiNP_001293707.1. NM_001306778.1.
NP_501053.2. NM_068652.2.
UniGeneiCel.20225.

Genome annotation databases

EnsemblMetazoaiC05B10.1a; C05B10.1a; WBGene00003043. [V6CIV8-2]
C05B10.1b; C05B10.1b; WBGene00003043. [V6CIV8-1]
GeneIDi191704.
KEGGicel:CELE_C05B10.1.

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiDUSL_CAEEL
AccessioniPrimary (citable) accession number: V6CIV8
Secondary accession number(s): O44128
Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 20, 2017
Last sequence update: February 19, 2014
Last modified: January 31, 2018
This is version 38 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programCaenorhabditis annotation project

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Caenorhabditis elegans
    Caenorhabditis elegans: entries, gene names and cross-references to WormBase
  2. SIMILARITY comments
    Index of protein domains and families