Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Mitochondrial uncoupling protein 2

Gene

PUMP2

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

PUMPS are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation. This leads to a decrease in the efficiency of oxidative phosphorylation and an increase in heat production. May be involved in protecting plant cells against oxidative stress damage (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

Keywordsi

Biological processStress response, Transport

Enzyme and pathway databases

ReactomeiR-ATH-167826 The fatty acid cycling model
R-ATH-167827 The proton buffering model

Names & Taxonomyi

Protein namesi
Recommended name:
Mitochondrial uncoupling protein 2
Short name:
AtPUMP2
Gene namesi
Name:PUMP2
Synonyms:UCP2
Ordered Locus Names:At5g58970
ORF Names:K19M22.16
OrganismiArabidopsis thaliana (Mouse-ear cress)
Taxonomic identifieri3702 [NCBI]
Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
Proteomesi
  • UP000006548 Componenti: Chromosome 5

Organism-specific databases

AraportiAT5G58970
TAIRilocus:2154593 AT5G58970

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cell wall Cytoskeleton Vacuole Chloroplast Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertion Graphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei16 – 36Helical; Name=1Sequence analysisAdd BLAST21
Transmembranei73 – 93Helical; Name=2Sequence analysisAdd BLAST21
Transmembranei120 – 140Helical; Name=3Sequence analysisAdd BLAST21
Transmembranei179 – 199Helical; Name=4Sequence analysisAdd BLAST21
Transmembranei220 – 240Helical; Name=5Sequence analysisAdd BLAST21
Transmembranei270 – 290Helical; Name=6Sequence analysisAdd BLAST21

Keywords - Cellular componenti

Membrane, Mitochondrion, Mitochondrion inner membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00004202561 – 305Mitochondrial uncoupling protein 2Add BLAST305

Proteomic databases

PaxDbiQ9ZWG1

Expressioni

Inductioni

By chloramphenicol.1 Publication

Gene expression databases

ExpressionAtlasiQ9ZWG1 baseline and differential
GenevisibleiQ9ZWG1 AT

Interactioni

Protein-protein interaction databases

STRINGi3702.AT5G58970.1

Structurei

3D structure databases

ProteinModelPortaliQ9ZWG1
SMRiQ9ZWG1
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati10 – 104Solcar 1Add BLAST95
Repeati114 – 205Solcar 2Add BLAST92
Repeati214 – 297Solcar 3Add BLAST84

Sequence similaritiesi

Keywords - Domaini

Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG0753 Eukaryota
ENOG410XRV1 LUCA
HOGENOMiHOG000165140
InParanoidiQ9ZWG1
KOiK15103
OMAiLRQWEGQ
OrthoDBiEOG09360HWE
PhylomeDBiQ9ZWG1

Family and domain databases

Gene3Di1.50.40.10, 1 hit
InterProiView protein in InterPro
IPR002030 Mit_uncoupling_UCP-like
IPR018108 Mitochondrial_sb/sol_carrier
IPR023395 Mt_carrier_dom_sf
PfamiView protein in Pfam
PF00153 Mito_carr, 3 hits
PRINTSiPR00784 MTUNCOUPLING
SUPFAMiSSF103506 SSF103506, 1 hit
PROSITEiView protein in PROSITE
PS50920 SOLCAR, 3 hits

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9ZWG1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MADFKPRIEI SFLETFICSA FAACFAELCT IPLDTAKVRL QLQRKIPTGD
60 70 80 90 100
GENLPKYRGS IGTLATIARE EGISGLWKGV IAGLHRQCIY GGLRIGLYEP
110 120 130 140 150
VKTLLVGSDF IGDIPLYQKI LAALLTGAIA IIVANPTDLV KVRLQSEGKL
160 170 180 190 200
PAGVPRRYAG AVDAYFTIVK LEGVSALWTG LGPNIARNAI VNAAELASYD
210 220 230 240 250
QIKETIMKIP FFRDSVLTHL LAGLAAGFFA VCIGSPIDVV KSRMMGDSTY
260 270 280 290 300
RNTVDCFIKT MKTEGIMAFY KGFLPNFTRL GTWNAIMFLT LEQVKKVFLR

EVLYD
Length:305
Mass (Da):33,442
Last modified:May 1, 1999 - v1
Checksum:iB0F6428F758EDCD7
GO
Isoform 2 (identifier: Q9ZWG1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     241-272: KSRMMGDSTYRNTVDCFIKTMKTEGIMAFYKG → SIHFRLLHKSTTRLFGFRLIMCGSAYIYNKFQ
     273-305: Missing.

Note: No experimental confirmation available.
Show »
Length:272
Mass (Da):29,595
Checksum:iFF052F5EB4C1F628
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_044433241 – 272KSRMM…AFYKG → SIHFRLLHKSTTRLFGFRLI MCGSAYIYNKFQ in isoform 2. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_044434273 – 305Missing in isoform 2. 1 PublicationAdd BLAST33

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB021706 mRNA Translation: BAA36222.1
JQ937241 mRNA Translation: AFI41209.1
AB016885 Genomic DNA Translation: BAB09640.1
CP002688 Genomic DNA Translation: AED97124.1
CP002688 Genomic DNA Translation: AED97125.1
AY088200 mRNA Translation: AAM65742.1
BX831274 mRNA No translation available.
RefSeqiNP_568894.1, NM_125287.5 [Q9ZWG1-1]
NP_974962.1, NM_203233.1 [Q9ZWG1-2]
UniGeneiAt.21660
At.29251

Genome annotation databases

EnsemblPlantsiAT5G58970.1; AT5G58970.1; AT5G58970 [Q9ZWG1-1]
AT5G58970.2; AT5G58970.2; AT5G58970 [Q9ZWG1-2]
GeneIDi836014
GrameneiAT5G58970.1; AT5G58970.1; AT5G58970 [Q9ZWG1-1]
AT5G58970.2; AT5G58970.2; AT5G58970 [Q9ZWG1-2]
KEGGiath:AT5G58970

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiPUMP2_ARATH
AccessioniPrimary (citable) accession number: Q9ZWG1
Secondary accession number(s): F4KGF2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 28, 2012
Last sequence update: May 1, 1999
Last modified: April 25, 2018
This is version 122 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health