Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Mitochondrial uncoupling protein 2

Gene

PUMP2

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

PUMPS are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation. This leads to a decrease in the efficiency of oxidative phosphorylation and an increase in heat production. May be involved in protecting plant cells against oxidative stress damage (By similarity).By similarity

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Stress response, Transport

Enzyme and pathway databases

ReactomeiR-ATH-167826. The fatty acid cycling model.
R-ATH-167827. The proton buffering model.

Names & Taxonomyi

Protein namesi
Recommended name:
Mitochondrial uncoupling protein 2
Short name:
AtPUMP2
Gene namesi
Name:PUMP2
Synonyms:UCP2
Ordered Locus Names:At5g58970
ORF Names:K19M22.16
OrganismiArabidopsis thaliana (Mouse-ear cress)
Taxonomic identifieri3702 [NCBI]
Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
Proteomesi
  • UP000006548 Componenti: Chromosome 5

Organism-specific databases

TAIRiAT5G58970.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei16 – 36Helical; Name=1Sequence analysisAdd BLAST21
Transmembranei73 – 93Helical; Name=2Sequence analysisAdd BLAST21
Transmembranei120 – 140Helical; Name=3Sequence analysisAdd BLAST21
Transmembranei179 – 199Helical; Name=4Sequence analysisAdd BLAST21
Transmembranei220 – 240Helical; Name=5Sequence analysisAdd BLAST21
Transmembranei270 – 290Helical; Name=6Sequence analysisAdd BLAST21

GO - Cellular componenti

  • Golgi apparatus Source: TAIR
  • integral component of membrane Source: UniProtKB-KW
  • mitochondrial inner membrane Source: UniProtKB-SubCell
  • plasma membrane Source: TAIR
Complete GO annotation...

Keywords - Cellular componenti

Membrane, Mitochondrion, Mitochondrion inner membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00004202561 – 305Mitochondrial uncoupling protein 2Add BLAST305

Proteomic databases

PaxDbiQ9ZWG1.

Expressioni

Inductioni

By chloramphenicol.1 Publication

Gene expression databases

GenevisibleiQ9ZWG1. AT.

Interactioni

Protein-protein interaction databases

STRINGi3702.AT5G58970.1.

Structurei

3D structure databases

ProteinModelPortaliQ9ZWG1.
SMRiQ9ZWG1.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati10 – 104Solcar 1Add BLAST95
Repeati114 – 205Solcar 2Add BLAST92
Repeati214 – 297Solcar 3Add BLAST84

Sequence similaritiesi

Contains 3 Solcar repeats.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG0753. Eukaryota.
ENOG410XRV1. LUCA.
HOGENOMiHOG000165140.
InParanoidiQ9ZWG1.
KOiK15103.
OMAiKMFTNEG.
OrthoDBiEOG09360HWE.
PhylomeDBiQ9ZWG1.

Family and domain databases

Gene3Di1.50.40.10. 1 hit.
InterProiIPR002030. Mit_uncoupling.
IPR018108. Mitochondrial_sb/sol_carrier.
IPR023395. Mt_carrier_dom.
[Graphical view]
PfamiPF00153. Mito_carr. 3 hits.
[Graphical view]
PRINTSiPR00784. MTUNCOUPLING.
SUPFAMiSSF103506. SSF103506. 1 hit.
PROSITEiPS50920. SOLCAR. 3 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9ZWG1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MADFKPRIEI SFLETFICSA FAACFAELCT IPLDTAKVRL QLQRKIPTGD
60 70 80 90 100
GENLPKYRGS IGTLATIARE EGISGLWKGV IAGLHRQCIY GGLRIGLYEP
110 120 130 140 150
VKTLLVGSDF IGDIPLYQKI LAALLTGAIA IIVANPTDLV KVRLQSEGKL
160 170 180 190 200
PAGVPRRYAG AVDAYFTIVK LEGVSALWTG LGPNIARNAI VNAAELASYD
210 220 230 240 250
QIKETIMKIP FFRDSVLTHL LAGLAAGFFA VCIGSPIDVV KSRMMGDSTY
260 270 280 290 300
RNTVDCFIKT MKTEGIMAFY KGFLPNFTRL GTWNAIMFLT LEQVKKVFLR

EVLYD
Length:305
Mass (Da):33,442
Last modified:May 1, 1999 - v1
Checksum:iB0F6428F758EDCD7
GO
Isoform 2 (identifier: Q9ZWG1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     241-272: KSRMMGDSTYRNTVDCFIKTMKTEGIMAFYKG → SIHFRLLHKSTTRLFGFRLIMCGSAYIYNKFQ
     273-305: Missing.

Note: No experimental confirmation available.
Show »
Length:272
Mass (Da):29,595
Checksum:iFF052F5EB4C1F628
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_044433241 – 272KSRMM…AFYKG → SIHFRLLHKSTTRLFGFRLI MCGSAYIYNKFQ in isoform 2. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_044434273 – 305Missing in isoform 2. 1 PublicationAdd BLAST33

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB021706 mRNA. Translation: BAA36222.1.
JQ937241 mRNA. Translation: AFI41209.1.
AB016885 Genomic DNA. Translation: BAB09640.1.
CP002688 Genomic DNA. Translation: AED97124.1.
CP002688 Genomic DNA. Translation: AED97125.1.
AY088200 mRNA. Translation: AAM65742.1.
BX831274 mRNA. No translation available.
RefSeqiNP_568894.1. NM_125287.5. [Q9ZWG1-1]
NP_974962.1. NM_203233.1. [Q9ZWG1-2]
UniGeneiAt.21660.
At.29251.

Genome annotation databases

EnsemblPlantsiAT5G58970.1; AT5G58970.1; AT5G58970. [Q9ZWG1-1]
GeneIDi836014.
GrameneiAT5G58970.1; AT5G58970.1; AT5G58970.
KEGGiath:AT5G58970.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB021706 mRNA. Translation: BAA36222.1.
JQ937241 mRNA. Translation: AFI41209.1.
AB016885 Genomic DNA. Translation: BAB09640.1.
CP002688 Genomic DNA. Translation: AED97124.1.
CP002688 Genomic DNA. Translation: AED97125.1.
AY088200 mRNA. Translation: AAM65742.1.
BX831274 mRNA. No translation available.
RefSeqiNP_568894.1. NM_125287.5. [Q9ZWG1-1]
NP_974962.1. NM_203233.1. [Q9ZWG1-2]
UniGeneiAt.21660.
At.29251.

3D structure databases

ProteinModelPortaliQ9ZWG1.
SMRiQ9ZWG1.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi3702.AT5G58970.1.

Proteomic databases

PaxDbiQ9ZWG1.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblPlantsiAT5G58970.1; AT5G58970.1; AT5G58970. [Q9ZWG1-1]
GeneIDi836014.
GrameneiAT5G58970.1; AT5G58970.1; AT5G58970.
KEGGiath:AT5G58970.

Organism-specific databases

TAIRiAT5G58970.

Phylogenomic databases

eggNOGiKOG0753. Eukaryota.
ENOG410XRV1. LUCA.
HOGENOMiHOG000165140.
InParanoidiQ9ZWG1.
KOiK15103.
OMAiKMFTNEG.
OrthoDBiEOG09360HWE.
PhylomeDBiQ9ZWG1.

Enzyme and pathway databases

ReactomeiR-ATH-167826. The fatty acid cycling model.
R-ATH-167827. The proton buffering model.

Miscellaneous databases

PROiQ9ZWG1.

Gene expression databases

GenevisibleiQ9ZWG1. AT.

Family and domain databases

Gene3Di1.50.40.10. 1 hit.
InterProiIPR002030. Mit_uncoupling.
IPR018108. Mitochondrial_sb/sol_carrier.
IPR023395. Mt_carrier_dom.
[Graphical view]
PfamiPF00153. Mito_carr. 3 hits.
[Graphical view]
PRINTSiPR00784. MTUNCOUPLING.
SUPFAMiSSF103506. SSF103506. 1 hit.
PROSITEiPS50920. SOLCAR. 3 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiPUMP2_ARATH
AccessioniPrimary (citable) accession number: Q9ZWG1
Secondary accession number(s): F4KGF2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 28, 2012
Last sequence update: May 1, 1999
Last modified: November 30, 2016
This is version 112 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.