Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 11

Gene

TPS11

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Catalytic activityi

UDP-alpha-D-glucose + D-glucose 6-phosphate = UDP + alpha,alpha-trehalose 6-phosphate.

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionGlycosyltransferase, Transferase

Protein family/group databases

CAZyiGT20 Glycosyltransferase Family 20

Names & Taxonomyi

Protein namesi
Recommended name:
Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 11 (EC:2.4.1.15)
Alternative name(s):
Trehalose-6-phosphate synthase 11
Short name:
AtTPS11
Gene namesi
Name:TPS11
Synonyms:TPSB
Ordered Locus Names:At2g18700
ORF Names:MSF3.8
OrganismiArabidopsis thaliana (Mouse-ear cress)
Taxonomic identifieri3702 [NCBI]
Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
Proteomesi
  • UP000006548 Componenti: Chromosome 2

Organism-specific databases

AraportiAT2G18700
TAIRilocus:2054027 AT2G18700

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cell wall Cytoskeleton Vacuole Chloroplast Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertion Graphics by Christian Stolte; Source: COMPARTMENTS

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003248321 – 862Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 11Add BLAST862

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei5PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ9ZV48
PRIDEiQ9ZV48

Expressioni

Tissue specificityi

Expressed in leaves, roots, stems and flowers.1 Publication

Gene expression databases

ExpressionAtlasiQ9ZV48 baseline and differential
GenevisibleiQ9ZV48 AT

Interactioni

Protein-protein interaction databases

STRINGi3702.AT2G18700.1

Structurei

3D structure databases

ProteinModelPortaliQ9ZV48
SMRiQ9ZV48
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni50 – 538GlycosyltransferaseAdd BLAST489

Sequence similaritiesi

In the N-terminal section; belongs to the glycosyltransferase 20 family.Curated
In the C-terminal section; belongs to the trehalose phosphatase family.Curated

Phylogenomic databases

eggNOGiKOG1050 Eukaryota
COG0380 LUCA
COG1877 LUCA
HOGENOMiHOG000191476
InParanoidiQ9ZV48
KOiK16055
OMAiPVVYLKQ
OrthoDBiEOG093601RY
PhylomeDBiQ9ZV48

Family and domain databases

CDDicd03788 GT1_TPS, 1 hit
Gene3Di3.40.50.1000, 2 hits
InterProiView protein in InterPro
IPR001830 Glyco_trans_20
IPR036412 HAD-like_sf
IPR006379 HAD-SF_hydro_IIB
IPR023214 HAD_sf
IPR003337 Trehalose_PPase
PfamiView protein in Pfam
PF00982 Glyco_transf_20, 1 hit
PF02358 Trehalose_PPase, 1 hit
SUPFAMiSSF56784 SSF56784, 1 hit
TIGRFAMsiTIGR01484 HAD-SF-IIB, 1 hit
TIGR00685 T6PP, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9ZV48-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSPESWKDQL SLVSADDYRI MGRNRIPNAV TKLSGLETDD PNGGAWVTKP
60 70 80 90 100
KRIVVSNQLP LRAHRDISSN KWCFEFDNDS LYLQLKDGFP PETEVVYVGS
110 120 130 140 150
LNADVLPSEQ EDVSQFLLEK FQCVPTFLPS DLLNKYYHGF CKHYLWPIFH
160 170 180 190 200
YLLPMTQAQG SLFDRSNWRA YTTVNKIFAD KIFEVLNPDD DYVWIHDYHL
210 220 230 240 250
MILPTFLRNR FHRIKLGIFL HSPFPSSEIY RTLPVRDEIL KGFLNCDLVG
260 270 280 290 300
FHTFDYARHF LSCCSRMLGL DYESKRGYIG LEYFGRTVSI KILPVGIHMG
310 320 330 340 350
QIESIKASEK TAEKVKRLRE RFKGNIVMLG VDDLDMFKGI SLKFWAMGQL
360 370 380 390 400
LEQNEELRGK VVLVQITNPA RSSGKDVQDV EKQINLIADE INSKFGRPGG
410 420 430 440 450
YKPIVFINGP VSTLDKVAYY AISECVVVNA VRDGMNLVPY KYTVTRQGSP
460 470 480 490 500
ALDAALGFGE DDVRKSVIIV SEFIGCSPSL SGAIRVNPWN IDAVTNAMSS
510 520 530 540 550
AMTMSDKEKN LRHQKHHKYI SSHNVAYWAR SYDQDLQRAC KDHYNKRFWG
560 570 580 590 600
VGFGLFFKVV ALDPNFRRLC GETIVPAYRR SSSRLILLDY DGTMMDQDTL
610 620 630 640 650
DKRPSDDLIS LLNRLCDDPS NLVFIVSGRG KDPLSKWFDS CPNLGISAEH
660 670 680 690 700
GYFTRWNSNS PWETSELPAD LSWKKIAKPV MNHYMEATDG SFIEEKESAM
710 720 730 740 750
VWHHQEADHS FGSWQAKELL DHLESVLTNE PVVVKRGQHI VEVKPQGVSK
760 770 780 790 800
GKVVEHLIAT MRNTKGKRPD FLLCIGDDRS DEDMFDSIVK HQDVSSIGLE
810 820 830 840 850
EVFACTVGQK PSKAKYYLDD TPSVIKMLEW LASASDGSKH EQQKKQSKFT
860
FQQPMGQCRK KA
Note: Derived from EST data. No experimental confirmation available.
Length:862
Mass (Da):98,275
Last modified:May 1, 1999 - v1
Checksum:i2D2808FBFA1D5B6A
GO
Isoform 2 (identifier: Q9ZV48-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     654-654: T → TRYFAKTLPFHHLPSHFCKVNTFLLLICNH

Show »
Length:891
Mass (Da):101,755
Checksum:iD81D3CF20D1AC1C8
GO

Sequence cautioni

The sequence AAK68805 differs from that shown. Reason: Erroneous initiation.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_032378654T → TRYFAKTLPFHHLPSHFCKV NTFLLLICNH in isoform 2. 2 Publications1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC005724 Genomic DNA Translation: AAD08939.1
CP002685 Genomic DNA Translation: AEC06795.1
AV822913 mRNA No translation available.
AY042865 mRNA Translation: AAK68805.1 Different initiation.
AY081537 mRNA Translation: AAM10099.1
PIRiE84567
RefSeqiNP_179460.1, NM_127426.3 [Q9ZV48-1]
UniGeneiAt.25317

Genome annotation databases

EnsemblPlantsiAT2G18700.1; AT2G18700.1; AT2G18700 [Q9ZV48-1]
GeneIDi816385
GrameneiAT2G18700.1; AT2G18700.1; AT2G18700 [Q9ZV48-1]
KEGGiath:AT2G18700

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiTPS11_ARATH
AccessioniPrimary (citable) accession number: Q9ZV48
Secondary accession number(s): Q94B44
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: May 1, 1999
Last modified: April 25, 2018
This is version 104 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health