Q9ZV48 (TPS11_ARATH) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 68.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 11 EC=2.4.1.15 Alternative name(s): Trehalose-6-phosphate synthase 11 Short name=AtTPS11 | ||||||||
| Gene names |
| ||||||||
| Organism | Arabidopsis thaliana (Mouse-ear cress) [Reference proteome] | ||||||||
| Taxonomic identifier | 3702 [NCBI] | ||||||||
| Taxonomic lineage | Eukaryota › Viridiplantae › Streptophyta › Embryophyta › Tracheophyta › Spermatophyta › Magnoliophyta › eudicotyledons › core eudicotyledons › rosids › malvids › Brassicales › Brassicaceae › Camelineae › Arabidopsis![]() |
Protein attributes
| Sequence length | 862 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Catalytic activity | UDP-glucose + D-glucose 6-phosphate = UDP + alpha,alpha-trehalose 6-phosphate. |
| Tissue specificity | Expressed in leaves, roots, stems and flowers. Ref.1 |
| Sequence similarities | In the N-terminal section; belongs to the glycosyltransferase 20 family. In the C-terminal section; belongs to the trehalose phosphatase family. |
| Sequence caution | The sequence AAK68805.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Molecular function | Glycosyltransferase Transferase |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | trehalose biosynthetic process Inferred from electronic annotation. Source: InterPro |
| Cellular_component | cytosol Inferred from direct assay PubMed 21166475. Source: TAIR mitochondrionInferred from direct assay PubMed 14671022. Source: TAIR |
| Molecular_function | transferase activity, transferring glycosyl groups Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9ZV48-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: Derived from EST data. No experimental confirmation available. | ||||||
| Isoform 2 (identifier: Q9ZV48-2) The sequence of this isoform differs from the canonical sequence as follows: 654-654: T → TRYFAKTLPFHHLPSHFCKVNTFLLLICNH |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 862 | 862 | Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 11 | PRO_0000324832 | |||||
Regions | |||||||||
| Region | 50 – 538 | 489 | Glycosyltransferase | ||||||
Natural variations | |||||||||
| Alternative sequence | 654 | 1 | T → TRYFAKTLPFHHLPSHFCKV NTFLLLICNH in isoform 2. | VSP_032378 | |||||
Sequences
| ||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AC005724 Genomic DNA. Translation: AAD08939.1. CP002685 Genomic DNA. Translation: AEC06795.1. AV822913 mRNA. No translation available. AY042865 mRNA. Translation: AAK68805.1. Different initiation. AY081537 mRNA. Translation: AAM10099.1. |
| IPI | IPI00538425. IPI00889354. |
| PIR | E84567. |
| RefSeq | NP_179460.1. NM_127426.2. |
| UniGene | At.25317. |
3D structure databases | |
| HSSP | HSSP built from PDB template 1GZ5 based on UniProtKB P31677. |
| ProteinModelPortal | Q9ZV48. |
| SMR | Q9ZV48. Positions 133-538. |
| ModBase | Search... |
Protein family/group databases | |
| CAZy | GT20. Glycosyltransferase Family 20. |
Proteomic databases | |
| PaxDb | Q9ZV48. |
| PRIDE | Q9ZV48. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| EnsemblPlants | AT2G18700.1; AT2G18700.1; AT2G18700. |
| GeneID | 816385. |
| KEGG | ath:AT2G18700. |
Organism-specific databases | |
| TAIR | At2g18700. |
Phylogenomic databases | |
| eggNOG | COG0380. |
| HOGENOM | HOG000191476. |
| InParanoid | Q9ZV48. |
| KO | K16055. |
| OMA | DYDGTMM. |
| PhylomeDB | Q9ZV48. |
| ProtClustDB | CLSN2912887. |
Gene expression databases | |
| Genevestigator | Q9ZV48. |
Family and domain databases | |
| Gene3D | 3.40.50.1000. 2 hits. |
| InterPro | IPR001830. Glyco_trans_20. IPR023214. HAD-like_dom. IPR006379. HAD-SF_hydro_IIB. IPR003337. Trehalose_PPase. [Graphical view] |
| Pfam | PF00982. Glyco_transf_20. 1 hit. PF02358. Trehalose_PPase. 1 hit. [Graphical view] |
| SUPFAM | SSF56784. HAD-like_dom. 1 hit. |
| TIGRFAMs | TIGR01484. HAD-SF-IIB. 1 hit. TIGR00685. T6PP. 1 hit. |
| ProtoNet | Search... |
Entry information
| Entry name | TPS11_ARATH | ||||||||
| Accession | Primary (citable) accession number: Q9ZV48 Secondary accession number(s): Q94B44 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Plant Protein Annotation Program | ||||||||
Relevant documents
| Arabidopsis thaliana Arabidopsis thaliana: entries and gene names |
| SIMILARITY comments Index of protein domains and families |

Clusters with
