Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9ZV48

- TPS11_ARATH

UniProt

Q9ZV48 - TPS11_ARATH

Protein

Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 11

Gene

TPS11

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 80 (01 Oct 2014)
      Sequence version 1 (01 May 1999)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Catalytic activityi

    UDP-glucose + D-glucose 6-phosphate = UDP + alpha,alpha-trehalose 6-phosphate.

    GO - Molecular functioni

    1. transferase activity, transferring glycosyl groups Source: UniProtKB-KW

    GO - Biological processi

    1. trehalose biosynthetic process Source: InterPro

    Keywords - Molecular functioni

    Glycosyltransferase, Transferase

    Protein family/group databases

    CAZyiGT20. Glycosyltransferase Family 20.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 11 (EC:2.4.1.15)
    Alternative name(s):
    Trehalose-6-phosphate synthase 11
    Short name:
    AtTPS11
    Gene namesi
    Name:TPS11
    Synonyms:TPSB
    Ordered Locus Names:At2g18700
    ORF Names:MSF3.8
    OrganismiArabidopsis thaliana (Mouse-ear cress)
    Taxonomic identifieri3702 [NCBI]
    Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
    ProteomesiUP000006548: Chromosome 2

    Organism-specific databases

    TAIRiAT2G18700.

    Subcellular locationi

    GO - Cellular componenti

    1. cytosol Source: TAIR
    2. mitochondrion Source: TAIR

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 862862Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 11PRO_0000324832Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei5 – 51PhosphoserineBy similarity

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    PaxDbiQ9ZV48.
    PRIDEiQ9ZV48.

    Expressioni

    Tissue specificityi

    Expressed in leaves, roots, stems and flowers.1 Publication

    Gene expression databases

    GenevestigatoriQ9ZV48.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9ZV48.
    SMRiQ9ZV48. Positions 133-538, 582-641.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni50 – 538489GlycosyltransferaseAdd
    BLAST

    Sequence similaritiesi

    In the N-terminal section; belongs to the glycosyltransferase 20 family.Curated
    In the C-terminal section; belongs to the trehalose phosphatase family.Curated

    Phylogenomic databases

    eggNOGiCOG0380.
    HOGENOMiHOG000191476.
    InParanoidiQ9ZV48.
    KOiK16055.
    OMAiDWKKTAE.
    PhylomeDBiQ9ZV48.

    Family and domain databases

    Gene3Di3.40.50.1000. 2 hits.
    InterProiIPR001830. Glyco_trans_20.
    IPR023214. HAD-like_dom.
    IPR006379. HAD-SF_hydro_IIB.
    IPR003337. Trehalose_PPase.
    [Graphical view]
    PfamiPF00982. Glyco_transf_20. 1 hit.
    PF02358. Trehalose_PPase. 1 hit.
    [Graphical view]
    SUPFAMiSSF56784. SSF56784. 1 hit.
    TIGRFAMsiTIGR01484. HAD-SF-IIB. 1 hit.
    TIGR00685. T6PP. 1 hit.

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9ZV48-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSPESWKDQL SLVSADDYRI MGRNRIPNAV TKLSGLETDD PNGGAWVTKP    50
    KRIVVSNQLP LRAHRDISSN KWCFEFDNDS LYLQLKDGFP PETEVVYVGS 100
    LNADVLPSEQ EDVSQFLLEK FQCVPTFLPS DLLNKYYHGF CKHYLWPIFH 150
    YLLPMTQAQG SLFDRSNWRA YTTVNKIFAD KIFEVLNPDD DYVWIHDYHL 200
    MILPTFLRNR FHRIKLGIFL HSPFPSSEIY RTLPVRDEIL KGFLNCDLVG 250
    FHTFDYARHF LSCCSRMLGL DYESKRGYIG LEYFGRTVSI KILPVGIHMG 300
    QIESIKASEK TAEKVKRLRE RFKGNIVMLG VDDLDMFKGI SLKFWAMGQL 350
    LEQNEELRGK VVLVQITNPA RSSGKDVQDV EKQINLIADE INSKFGRPGG 400
    YKPIVFINGP VSTLDKVAYY AISECVVVNA VRDGMNLVPY KYTVTRQGSP 450
    ALDAALGFGE DDVRKSVIIV SEFIGCSPSL SGAIRVNPWN IDAVTNAMSS 500
    AMTMSDKEKN LRHQKHHKYI SSHNVAYWAR SYDQDLQRAC KDHYNKRFWG 550
    VGFGLFFKVV ALDPNFRRLC GETIVPAYRR SSSRLILLDY DGTMMDQDTL 600
    DKRPSDDLIS LLNRLCDDPS NLVFIVSGRG KDPLSKWFDS CPNLGISAEH 650
    GYFTRWNSNS PWETSELPAD LSWKKIAKPV MNHYMEATDG SFIEEKESAM 700
    VWHHQEADHS FGSWQAKELL DHLESVLTNE PVVVKRGQHI VEVKPQGVSK 750
    GKVVEHLIAT MRNTKGKRPD FLLCIGDDRS DEDMFDSIVK HQDVSSIGLE 800
    EVFACTVGQK PSKAKYYLDD TPSVIKMLEW LASASDGSKH EQQKKQSKFT 850
    FQQPMGQCRK KA 862

    Note: Derived from EST data. No experimental confirmation available.

    Length:862
    Mass (Da):98,275
    Last modified:May 1, 1999 - v1
    Checksum:i2D2808FBFA1D5B6A
    GO
    Isoform 2 (identifier: Q9ZV48-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         654-654: T → TRYFAKTLPFHHLPSHFCKVNTFLLLICNH

    Show »
    Length:891
    Mass (Da):101,755
    Checksum:iD81D3CF20D1AC1C8
    GO

    Sequence cautioni

    The sequence AAK68805.1 differs from that shown. Reason: Erroneous initiation.

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei654 – 6541T → TRYFAKTLPFHHLPSHFCKV NTFLLLICNH in isoform 2. 2 PublicationsVSP_032378

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AC005724 Genomic DNA. Translation: AAD08939.1.
    CP002685 Genomic DNA. Translation: AEC06795.1.
    AV822913 mRNA. No translation available.
    AY042865 mRNA. Translation: AAK68805.1. Different initiation.
    AY081537 mRNA. Translation: AAM10099.1.
    PIRiE84567.
    RefSeqiNP_179460.1. NM_127426.2. [Q9ZV48-1]
    UniGeneiAt.25317.

    Genome annotation databases

    EnsemblPlantsiAT2G18700.1; AT2G18700.1; AT2G18700. [Q9ZV48-1]
    GeneIDi816385.
    KEGGiath:AT2G18700.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AC005724 Genomic DNA. Translation: AAD08939.1 .
    CP002685 Genomic DNA. Translation: AEC06795.1 .
    AV822913 mRNA. No translation available.
    AY042865 mRNA. Translation: AAK68805.1 . Different initiation.
    AY081537 mRNA. Translation: AAM10099.1 .
    PIRi E84567.
    RefSeqi NP_179460.1. NM_127426.2. [Q9ZV48-1 ]
    UniGenei At.25317.

    3D structure databases

    ProteinModelPortali Q9ZV48.
    SMRi Q9ZV48. Positions 133-538, 582-641.
    ModBasei Search...
    MobiDBi Search...

    Protein family/group databases

    CAZyi GT20. Glycosyltransferase Family 20.

    Proteomic databases

    PaxDbi Q9ZV48.
    PRIDEi Q9ZV48.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    EnsemblPlantsi AT2G18700.1 ; AT2G18700.1 ; AT2G18700 . [Q9ZV48-1 ]
    GeneIDi 816385.
    KEGGi ath:AT2G18700.

    Organism-specific databases

    TAIRi AT2G18700.

    Phylogenomic databases

    eggNOGi COG0380.
    HOGENOMi HOG000191476.
    InParanoidi Q9ZV48.
    KOi K16055.
    OMAi DWKKTAE.
    PhylomeDBi Q9ZV48.

    Gene expression databases

    Genevestigatori Q9ZV48.

    Family and domain databases

    Gene3Di 3.40.50.1000. 2 hits.
    InterProi IPR001830. Glyco_trans_20.
    IPR023214. HAD-like_dom.
    IPR006379. HAD-SF_hydro_IIB.
    IPR003337. Trehalose_PPase.
    [Graphical view ]
    Pfami PF00982. Glyco_transf_20. 1 hit.
    PF02358. Trehalose_PPase. 1 hit.
    [Graphical view ]
    SUPFAMi SSF56784. SSF56784. 1 hit.
    TIGRFAMsi TIGR01484. HAD-SF-IIB. 1 hit.
    TIGR00685. T6PP. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Trehalose metabolism in Arabidopsis: occurrence of trehalose and molecular cloning and characterization of trehalose-6-phosphate synthase homologues."
      Vogel G., Fiehn O., Jean-Richard-dit-Bressel L., Boller T., Wiemken A., Aeschbacher R.A., Wingler A.
      J. Exp. Bot. 52:1817-1826(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA], TISSUE SPECIFICITY.
      Strain: cv. Landsberg erecta.
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: cv. Columbia.
    3. The Arabidopsis Information Resource (TAIR)
      Submitted (APR-2011) to the EMBL/GenBank/DDBJ databases
      Cited for: GENOME REANNOTATION.
      Strain: cv. Columbia.
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 588-778 (ISOFORM 2).
      Strain: cv. Columbia.
    5. "Empirical analysis of transcriptional activity in the Arabidopsis genome."
      Yamada K., Lim J., Dale J.M., Chen H., Shinn P., Palm C.J., Southwick A.M., Wu H.C., Kim C.J., Nguyen M., Pham P.K., Cheuk R.F., Karlin-Newmann G., Liu S.X., Lam B., Sakano H., Wu T., Yu G.
      , Miranda M., Quach H.L., Tripp M., Chang C.H., Lee J.M., Toriumi M.J., Chan M.M., Tang C.C., Onodera C.S., Deng J.M., Akiyama K., Ansari Y., Arakawa T., Banh J., Banno F., Bowser L., Brooks S.Y., Carninci P., Chao Q., Choy N., Enju A., Goldsmith A.D., Gurjal M., Hansen N.F., Hayashizaki Y., Johnson-Hopson C., Hsuan V.W., Iida K., Karnes M., Khan S., Koesema E., Ishida J., Jiang P.X., Jones T., Kawai J., Kamiya A., Meyers C., Nakajima M., Narusaka M., Seki M., Sakurai T., Satou M., Tamse R., Vaysberg M., Wallender E.K., Wong C., Yamamura Y., Yuan S., Shinozaki K., Davis R.W., Theologis A., Ecker J.R.
      Science 302:842-846(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 589-862 (ISOFORM 2).
      Strain: cv. Columbia.
    6. "An unexpected plethora of trehalose biosynthesis genes in Arabidopsis thaliana."
      Leyman B., Van Dijck P., Thevelein J.M.
      Trends Plant Sci. 6:510-513(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: GENE FAMILY, NOMENCLATURE.

    Entry informationi

    Entry nameiTPS11_ARATH
    AccessioniPrimary (citable) accession number: Q9ZV48
    Secondary accession number(s): Q94B44
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: March 18, 2008
    Last sequence update: May 1, 1999
    Last modified: October 1, 2014
    This is version 80 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programPlant Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Arabidopsis thaliana
      Arabidopsis thaliana: entries and gene names
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3