Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9ZV48 (TPS11_ARATH) Reviewed, UniProtKB/Swiss-Prot

Last modified June 11, 2014. Version 79. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 11

EC=2.4.1.15
Alternative name(s):
Trehalose-6-phosphate synthase 11
Short name=AtTPS11
Gene names
Name:TPS11
Synonyms:TPSB
Ordered Locus Names:At2g18700
ORF Names:MSF3.8
OrganismArabidopsis thaliana (Mouse-ear cress) [Reference proteome]
Taxonomic identifier3702 [NCBI]
Taxonomic lineageEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis

Protein attributes

Sequence length862 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Catalytic activity

UDP-glucose + D-glucose 6-phosphate = UDP + alpha,alpha-trehalose 6-phosphate.

Tissue specificity

Expressed in leaves, roots, stems and flowers. Ref.1

Sequence similarities

In the N-terminal section; belongs to the glycosyltransferase 20 family.

In the C-terminal section; belongs to the trehalose phosphatase family.

Sequence caution

The sequence AAK68805.1 differs from that shown. Reason: Erroneous initiation.

Ontologies

Keywords
   Coding sequence diversityAlternative splicing
   Molecular functionGlycosyltransferase
Transferase
   PTMPhosphoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processtrehalose biosynthetic process

Inferred from electronic annotation. Source: InterPro

   Cellular_componentcytosol

Inferred from direct assay PubMed 21166475. Source: TAIR

mitochondrion

Inferred from direct assay PubMed 14671022. Source: TAIR

   Molecular_functiontransferase activity, transferring glycosyl groups

Inferred from electronic annotation. Source: UniProtKB-KW

Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9ZV48-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Note: Derived from EST data. No experimental confirmation available.
Isoform 2 (identifier: Q9ZV48-2)

The sequence of this isoform differs from the canonical sequence as follows:
     654-654: T → TRYFAKTLPFHHLPSHFCKVNTFLLLICNH

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 862862Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 11
PRO_0000324832

Regions

Region50 – 538489Glycosyltransferase

Amino acid modifications

Modified residue51Phosphoserine By similarity

Natural variations

Alternative sequence6541T → TRYFAKTLPFHHLPSHFCKV NTFLLLICNH in isoform 2.
VSP_032378

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified May 1, 1999. Version 1.
Checksum: 2D2808FBFA1D5B6A

FASTA86298,275
        10         20         30         40         50         60 
MSPESWKDQL SLVSADDYRI MGRNRIPNAV TKLSGLETDD PNGGAWVTKP KRIVVSNQLP 

        70         80         90        100        110        120 
LRAHRDISSN KWCFEFDNDS LYLQLKDGFP PETEVVYVGS LNADVLPSEQ EDVSQFLLEK 

       130        140        150        160        170        180 
FQCVPTFLPS DLLNKYYHGF CKHYLWPIFH YLLPMTQAQG SLFDRSNWRA YTTVNKIFAD 

       190        200        210        220        230        240 
KIFEVLNPDD DYVWIHDYHL MILPTFLRNR FHRIKLGIFL HSPFPSSEIY RTLPVRDEIL 

       250        260        270        280        290        300 
KGFLNCDLVG FHTFDYARHF LSCCSRMLGL DYESKRGYIG LEYFGRTVSI KILPVGIHMG 

       310        320        330        340        350        360 
QIESIKASEK TAEKVKRLRE RFKGNIVMLG VDDLDMFKGI SLKFWAMGQL LEQNEELRGK 

       370        380        390        400        410        420 
VVLVQITNPA RSSGKDVQDV EKQINLIADE INSKFGRPGG YKPIVFINGP VSTLDKVAYY 

       430        440        450        460        470        480 
AISECVVVNA VRDGMNLVPY KYTVTRQGSP ALDAALGFGE DDVRKSVIIV SEFIGCSPSL 

       490        500        510        520        530        540 
SGAIRVNPWN IDAVTNAMSS AMTMSDKEKN LRHQKHHKYI SSHNVAYWAR SYDQDLQRAC 

       550        560        570        580        590        600 
KDHYNKRFWG VGFGLFFKVV ALDPNFRRLC GETIVPAYRR SSSRLILLDY DGTMMDQDTL 

       610        620        630        640        650        660 
DKRPSDDLIS LLNRLCDDPS NLVFIVSGRG KDPLSKWFDS CPNLGISAEH GYFTRWNSNS 

       670        680        690        700        710        720 
PWETSELPAD LSWKKIAKPV MNHYMEATDG SFIEEKESAM VWHHQEADHS FGSWQAKELL 

       730        740        750        760        770        780 
DHLESVLTNE PVVVKRGQHI VEVKPQGVSK GKVVEHLIAT MRNTKGKRPD FLLCIGDDRS 

       790        800        810        820        830        840 
DEDMFDSIVK HQDVSSIGLE EVFACTVGQK PSKAKYYLDD TPSVIKMLEW LASASDGSKH 

       850        860 
EQQKKQSKFT FQQPMGQCRK KA 

« Hide

Isoform 2 [UniParc].

Checksum: D81D3CF20D1AC1C8
Show »

FASTA891101,755

References

« Hide 'large scale' references
[1]"Trehalose metabolism in Arabidopsis: occurrence of trehalose and molecular cloning and characterization of trehalose-6-phosphate synthase homologues."
Vogel G., Fiehn O., Jean-Richard-dit-Bressel L., Boller T., Wiemken A., Aeschbacher R.A., Wingler A.
J. Exp. Bot. 52:1817-1826(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA], TISSUE SPECIFICITY.
Strain: cv. Landsberg erecta.
[2]"Sequence and analysis of chromosome 2 of the plant Arabidopsis thaliana."
Lin X., Kaul S., Rounsley S.D., Shea T.P., Benito M.-I., Town C.D., Fujii C.Y., Mason T.M., Bowman C.L., Barnstead M.E., Feldblyum T.V., Buell C.R., Ketchum K.A., Lee J.J., Ronning C.M., Koo H.L., Moffat K.S., Cronin L.A. expand/collapse author list , Shen M., Pai G., Van Aken S., Umayam L., Tallon L.J., Gill J.E., Adams M.D., Carrera A.J., Creasy T.H., Goodman H.M., Somerville C.R., Copenhaver G.P., Preuss D., Nierman W.C., White O., Eisen J.A., Salzberg S.L., Fraser C.M., Venter J.C.
Nature 402:761-768(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Strain: cv. Columbia.
[3]The Arabidopsis Information Resource (TAIR)
Submitted (APR-2011) to the EMBL/GenBank/DDBJ databases
Cited for: GENOME REANNOTATION.
Strain: cv. Columbia.
[4]"Functional annotation of a full-length Arabidopsis cDNA collection."
Seki M., Narusaka M., Kamiya A., Ishida J., Satou M., Sakurai T., Nakajima M., Enju A., Akiyama K., Oono Y., Muramatsu M., Hayashizaki Y., Kawai J., Carninci P., Itoh M., Ishii Y., Arakawa T., Shibata K., Shinagawa A., Shinozaki K.
Science 296:141-145(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 588-778 (ISOFORM 2).
Strain: cv. Columbia.
[5]"Empirical analysis of transcriptional activity in the Arabidopsis genome."
Yamada K., Lim J., Dale J.M., Chen H., Shinn P., Palm C.J., Southwick A.M., Wu H.C., Kim C.J., Nguyen M., Pham P.K., Cheuk R.F., Karlin-Newmann G., Liu S.X., Lam B., Sakano H., Wu T., Yu G. expand/collapse author list , Miranda M., Quach H.L., Tripp M., Chang C.H., Lee J.M., Toriumi M.J., Chan M.M., Tang C.C., Onodera C.S., Deng J.M., Akiyama K., Ansari Y., Arakawa T., Banh J., Banno F., Bowser L., Brooks S.Y., Carninci P., Chao Q., Choy N., Enju A., Goldsmith A.D., Gurjal M., Hansen N.F., Hayashizaki Y., Johnson-Hopson C., Hsuan V.W., Iida K., Karnes M., Khan S., Koesema E., Ishida J., Jiang P.X., Jones T., Kawai J., Kamiya A., Meyers C., Nakajima M., Narusaka M., Seki M., Sakurai T., Satou M., Tamse R., Vaysberg M., Wallender E.K., Wong C., Yamamura Y., Yuan S., Shinozaki K., Davis R.W., Theologis A., Ecker J.R.
Science 302:842-846(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 589-862 (ISOFORM 2).
Strain: cv. Columbia.
[6]"An unexpected plethora of trehalose biosynthesis genes in Arabidopsis thaliana."
Leyman B., Van Dijck P., Thevelein J.M.
Trends Plant Sci. 6:510-513(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: GENE FAMILY, NOMENCLATURE.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AC005724 Genomic DNA. Translation: AAD08939.1.
CP002685 Genomic DNA. Translation: AEC06795.1.
AV822913 mRNA. No translation available.
AY042865 mRNA. Translation: AAK68805.1. Different initiation.
AY081537 mRNA. Translation: AAM10099.1.
PIRE84567.
RefSeqNP_179460.1. NM_127426.2. [Q9ZV48-1]
UniGeneAt.25317.

3D structure databases

ProteinModelPortalQ9ZV48.
SMRQ9ZV48. Positions 133-538, 582-641.
ModBaseSearch...
MobiDBSearch...

Protein family/group databases

CAZyGT20. Glycosyltransferase Family 20.

Proteomic databases

PaxDbQ9ZV48.
PRIDEQ9ZV48.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblPlantsAT2G18700.1; AT2G18700.1; AT2G18700. [Q9ZV48-1]
GeneID816385.
KEGGath:AT2G18700.

Organism-specific databases

TAIRAT2G18700.

Phylogenomic databases

eggNOGCOG0380.
HOGENOMHOG000191476.
InParanoidQ9ZV48.
KOK16055.
OMADWKKTAE.
PhylomeDBQ9ZV48.

Gene expression databases

GenevestigatorQ9ZV48.

Family and domain databases

Gene3D3.40.50.1000. 2 hits.
InterProIPR001830. Glyco_trans_20.
IPR023214. HAD-like_dom.
IPR006379. HAD-SF_hydro_IIB.
IPR003337. Trehalose_PPase.
[Graphical view]
PfamPF00982. Glyco_transf_20. 1 hit.
PF02358. Trehalose_PPase. 1 hit.
[Graphical view]
SUPFAMSSF56784. SSF56784. 1 hit.
TIGRFAMsTIGR01484. HAD-SF-IIB. 1 hit.
TIGR00685. T6PP. 1 hit.
ProtoNetSearch...

Entry information

Entry nameTPS11_ARATH
AccessionPrimary (citable) accession number: Q9ZV48
Secondary accession number(s): Q94B44
Entry history
Integrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: May 1, 1999
Last modified: June 11, 2014
This is version 79 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

Arabidopsis thaliana

Arabidopsis thaliana: entries and gene names