SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9ZV48

- TPS11_ARATH

UniProt

Q9ZV48 - TPS11_ARATH

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 11
Gene
TPS11, TPSB, At2g18700, MSF3.8
Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed - Annotation score: 4 out of 5 - Experimental evidence at transcript leveli

Functioni

Catalytic activityi

UDP-glucose + D-glucose 6-phosphate = UDP + alpha,alpha-trehalose 6-phosphate.

GO - Molecular functioni

  1. transferase activity, transferring glycosyl groups Source: UniProtKB-KW

GO - Biological processi

  1. trehalose biosynthetic process Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Glycosyltransferase, Transferase

Protein family/group databases

CAZyiGT20. Glycosyltransferase Family 20.

Names & Taxonomyi

Protein namesi
Recommended name:
Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 11 (EC:2.4.1.15)
Alternative name(s):
Trehalose-6-phosphate synthase 11
Short name:
AtTPS11
Gene namesi
Name:TPS11
Synonyms:TPSB
Ordered Locus Names:At2g18700
ORF Names:MSF3.8
OrganismiArabidopsis thaliana (Mouse-ear cress)
Taxonomic identifieri3702 [NCBI]
Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
ProteomesiUP000006548: Chromosome 2

Organism-specific databases

TAIRiAT2G18700.

Subcellular locationi

GO - Cellular componenti

  1. cytosol Source: TAIR
  2. mitochondrion Source: TAIR
Complete GO annotation...

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 862862Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 11
PRO_0000324832Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei5 – 51Phosphoserine By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ9ZV48.
PRIDEiQ9ZV48.

Expressioni

Tissue specificityi

Expressed in leaves, roots, stems and flowers.1 Publication

Gene expression databases

GenevestigatoriQ9ZV48.

Structurei

3D structure databases

ProteinModelPortaliQ9ZV48.
SMRiQ9ZV48. Positions 133-538, 582-641.

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni50 – 538489Glycosyltransferase
Add
BLAST

Sequence similaritiesi

In the N-terminal section; belongs to the glycosyltransferase 20 family.
In the C-terminal section; belongs to the trehalose phosphatase family.

Phylogenomic databases

eggNOGiCOG0380.
HOGENOMiHOG000191476.
InParanoidiQ9ZV48.
KOiK16055.
OMAiDWKKTAE.
PhylomeDBiQ9ZV48.

Family and domain databases

Gene3Di3.40.50.1000. 2 hits.
InterProiIPR001830. Glyco_trans_20.
IPR023214. HAD-like_dom.
IPR006379. HAD-SF_hydro_IIB.
IPR003337. Trehalose_PPase.
[Graphical view]
PfamiPF00982. Glyco_transf_20. 1 hit.
PF02358. Trehalose_PPase. 1 hit.
[Graphical view]
SUPFAMiSSF56784. SSF56784. 1 hit.
TIGRFAMsiTIGR01484. HAD-SF-IIB. 1 hit.
TIGR00685. T6PP. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9ZV48-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MSPESWKDQL SLVSADDYRI MGRNRIPNAV TKLSGLETDD PNGGAWVTKP    50
KRIVVSNQLP LRAHRDISSN KWCFEFDNDS LYLQLKDGFP PETEVVYVGS 100
LNADVLPSEQ EDVSQFLLEK FQCVPTFLPS DLLNKYYHGF CKHYLWPIFH 150
YLLPMTQAQG SLFDRSNWRA YTTVNKIFAD KIFEVLNPDD DYVWIHDYHL 200
MILPTFLRNR FHRIKLGIFL HSPFPSSEIY RTLPVRDEIL KGFLNCDLVG 250
FHTFDYARHF LSCCSRMLGL DYESKRGYIG LEYFGRTVSI KILPVGIHMG 300
QIESIKASEK TAEKVKRLRE RFKGNIVMLG VDDLDMFKGI SLKFWAMGQL 350
LEQNEELRGK VVLVQITNPA RSSGKDVQDV EKQINLIADE INSKFGRPGG 400
YKPIVFINGP VSTLDKVAYY AISECVVVNA VRDGMNLVPY KYTVTRQGSP 450
ALDAALGFGE DDVRKSVIIV SEFIGCSPSL SGAIRVNPWN IDAVTNAMSS 500
AMTMSDKEKN LRHQKHHKYI SSHNVAYWAR SYDQDLQRAC KDHYNKRFWG 550
VGFGLFFKVV ALDPNFRRLC GETIVPAYRR SSSRLILLDY DGTMMDQDTL 600
DKRPSDDLIS LLNRLCDDPS NLVFIVSGRG KDPLSKWFDS CPNLGISAEH 650
GYFTRWNSNS PWETSELPAD LSWKKIAKPV MNHYMEATDG SFIEEKESAM 700
VWHHQEADHS FGSWQAKELL DHLESVLTNE PVVVKRGQHI VEVKPQGVSK 750
GKVVEHLIAT MRNTKGKRPD FLLCIGDDRS DEDMFDSIVK HQDVSSIGLE 800
EVFACTVGQK PSKAKYYLDD TPSVIKMLEW LASASDGSKH EQQKKQSKFT 850
FQQPMGQCRK KA 862

Note: Derived from EST data. No experimental confirmation available.

Length:862
Mass (Da):98,275
Last modified:May 1, 1999 - v1
Checksum:i2D2808FBFA1D5B6A
GO
Isoform 2 (identifier: Q9ZV48-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     654-654: T → TRYFAKTLPFHHLPSHFCKVNTFLLLICNH

Show »
Length:891
Mass (Da):101,755
Checksum:iD81D3CF20D1AC1C8
GO

Sequence cautioni

The sequence AAK68805.1 differs from that shown. Reason: Erroneous initiation.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei654 – 6541T → TRYFAKTLPFHHLPSHFCKV NTFLLLICNH in isoform 2.
VSP_032378

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AC005724 Genomic DNA. Translation: AAD08939.1.
CP002685 Genomic DNA. Translation: AEC06795.1.
AV822913 mRNA. No translation available.
AY042865 mRNA. Translation: AAK68805.1. Different initiation.
AY081537 mRNA. Translation: AAM10099.1.
PIRiE84567.
RefSeqiNP_179460.1. NM_127426.2. [Q9ZV48-1]
UniGeneiAt.25317.

Genome annotation databases

EnsemblPlantsiAT2G18700.1; AT2G18700.1; AT2G18700. [Q9ZV48-1]
GeneIDi816385.
KEGGiath:AT2G18700.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AC005724 Genomic DNA. Translation: AAD08939.1 .
CP002685 Genomic DNA. Translation: AEC06795.1 .
AV822913 mRNA. No translation available.
AY042865 mRNA. Translation: AAK68805.1 . Different initiation.
AY081537 mRNA. Translation: AAM10099.1 .
PIRi E84567.
RefSeqi NP_179460.1. NM_127426.2. [Q9ZV48-1 ]
UniGenei At.25317.

3D structure databases

ProteinModelPortali Q9ZV48.
SMRi Q9ZV48. Positions 133-538, 582-641.
ModBasei Search...
MobiDBi Search...

Protein family/group databases

CAZyi GT20. Glycosyltransferase Family 20.

Proteomic databases

PaxDbi Q9ZV48.
PRIDEi Q9ZV48.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

EnsemblPlantsi AT2G18700.1 ; AT2G18700.1 ; AT2G18700 . [Q9ZV48-1 ]
GeneIDi 816385.
KEGGi ath:AT2G18700.

Organism-specific databases

TAIRi AT2G18700.

Phylogenomic databases

eggNOGi COG0380.
HOGENOMi HOG000191476.
InParanoidi Q9ZV48.
KOi K16055.
OMAi DWKKTAE.
PhylomeDBi Q9ZV48.

Gene expression databases

Genevestigatori Q9ZV48.

Family and domain databases

Gene3Di 3.40.50.1000. 2 hits.
InterProi IPR001830. Glyco_trans_20.
IPR023214. HAD-like_dom.
IPR006379. HAD-SF_hydro_IIB.
IPR003337. Trehalose_PPase.
[Graphical view ]
Pfami PF00982. Glyco_transf_20. 1 hit.
PF02358. Trehalose_PPase. 1 hit.
[Graphical view ]
SUPFAMi SSF56784. SSF56784. 1 hit.
TIGRFAMsi TIGR01484. HAD-SF-IIB. 1 hit.
TIGR00685. T6PP. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Trehalose metabolism in Arabidopsis: occurrence of trehalose and molecular cloning and characterization of trehalose-6-phosphate synthase homologues."
    Vogel G., Fiehn O., Jean-Richard-dit-Bressel L., Boller T., Wiemken A., Aeschbacher R.A., Wingler A.
    J. Exp. Bot. 52:1817-1826(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA], TISSUE SPECIFICITY.
    Strain: cv. Landsberg erecta.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: cv. Columbia.
  3. The Arabidopsis Information Resource (TAIR)
    Submitted (APR-2011) to the EMBL/GenBank/DDBJ databases
    Cited for: GENOME REANNOTATION.
    Strain: cv. Columbia.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 588-778 (ISOFORM 2).
    Strain: cv. Columbia.
  5. "Empirical analysis of transcriptional activity in the Arabidopsis genome."
    Yamada K., Lim J., Dale J.M., Chen H., Shinn P., Palm C.J., Southwick A.M., Wu H.C., Kim C.J., Nguyen M., Pham P.K., Cheuk R.F., Karlin-Newmann G., Liu S.X., Lam B., Sakano H., Wu T., Yu G.
    , Miranda M., Quach H.L., Tripp M., Chang C.H., Lee J.M., Toriumi M.J., Chan M.M., Tang C.C., Onodera C.S., Deng J.M., Akiyama K., Ansari Y., Arakawa T., Banh J., Banno F., Bowser L., Brooks S.Y., Carninci P., Chao Q., Choy N., Enju A., Goldsmith A.D., Gurjal M., Hansen N.F., Hayashizaki Y., Johnson-Hopson C., Hsuan V.W., Iida K., Karnes M., Khan S., Koesema E., Ishida J., Jiang P.X., Jones T., Kawai J., Kamiya A., Meyers C., Nakajima M., Narusaka M., Seki M., Sakurai T., Satou M., Tamse R., Vaysberg M., Wallender E.K., Wong C., Yamamura Y., Yuan S., Shinozaki K., Davis R.W., Theologis A., Ecker J.R.
    Science 302:842-846(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 589-862 (ISOFORM 2).
    Strain: cv. Columbia.
  6. "An unexpected plethora of trehalose biosynthesis genes in Arabidopsis thaliana."
    Leyman B., Van Dijck P., Thevelein J.M.
    Trends Plant Sci. 6:510-513(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: GENE FAMILY, NOMENCLATURE.

Entry informationi

Entry nameiTPS11_ARATH
AccessioniPrimary (citable) accession number: Q9ZV48
Secondary accession number(s): Q94B44
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: May 1, 1999
Last modified: June 11, 2014
This is version 79 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi