Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein PELOTA 1

Gene

PEL1

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Required for normal chromosome segregation during cell division and genomic stability (By similarity). May function in recognizing stalled ribosomes and triggering endonucleolytic cleavage of the mRNA, a mechanism to release non-functional ribosomes and degrade damaged mRNAs. May have ribonuclease activity (Potential).By similarityCurated

Cofactori

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Endonuclease, Hydrolase, Nuclease

Keywords - Ligandi

Metal-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Protein PELOTA 1 (EC:3.1.-.-)
Short name:
AtPelota1
Gene namesi
Name:PEL1
Ordered Locus Names:At4g27650
ORF Names:T29A15.140
OrganismiArabidopsis thaliana (Mouse-ear cress)
Taxonomic identifieri3702 [NCBI]
Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
Proteomesi
  • UP000006548 Componenti: Chromosome 4

Organism-specific databases

TAIRiAT4G27650.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 378378Protein PELOTA 1PRO_0000429930Add
BLAST

Proteomic databases

PaxDbiQ9ZT87.
PRIDEiQ9ZT87.

Expressioni

Tissue specificityi

Expressed constitutively in seedlings, buds, stems, leaves and roots.1 Publication

Gene expression databases

GenevisibleiQ9ZT87. AT.

Interactioni

Protein-protein interaction databases

STRINGi3702.AT4G27650.1.

Structurei

3D structure databases

ProteinModelPortaliQ9ZT87.
SMRiQ9ZT87. Positions 19-376.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domaini

The N-terminal domain has the RNA-binding Sm fold. It may harbor the endoribonuclease activity (Potential).Curated

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG2869. Eukaryota.
COG1537. LUCA.
HOGENOMiHOG000184162.
InParanoidiQ9ZT87.
KOiK06965.
OMAiAFYGKKH.
OrthoDBiEOG09360CM0.
PhylomeDBiQ9ZT87.

Family and domain databases

Gene3Di3.30.1330.30. 1 hit.
InterProiIPR005140. eRF1_1_Pelota.
IPR005141. eRF1_2.
IPR005142. eRF1_3.
IPR029064. L30e-like.
IPR004405. Transl-rel_pelota.
[Graphical view]
PANTHERiPTHR10853. PTHR10853. 1 hit.
PfamiPF03463. eRF1_1. 1 hit.
PF03464. eRF1_2. 1 hit.
PF03465. eRF1_3. 1 hit.
[Graphical view]
SMARTiSM01194. eRF1_1. 1 hit.
[Graphical view]
SUPFAMiSSF55315. SSF55315. 1 hit.
TIGRFAMsiTIGR00111. pelota. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9ZT87-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKIVRRDFVR NGPGSVKMVA EDSDDLWYAY NLIAVGDSVM AVTFRKVQRE
60 70 80 90 100
IPGGGRDSER VKLKLEVQVE EVDYDKDGSV LRIRGKNILE NEHVKIGAFH
110 120 130 140 150
TLELELKRPF VLRKEMWDSM ALDTLKQASD PAASADLAVV LMQEGLAQIF
160 170 180 190 200
LVGRSVTSSR ARIETSIPRK HGPAIAGYES ALKKFFENVL QAFVKHVDFS
210 220 230 240 250
VVRCAVVASP GFTKDQFHRH LLLEAERRQL RPIIENKSRI ILVHTNSGYR
260 270 280 290 300
HSLGEVLHAP NVMNMIKDTK AAKEVKALND FHNMLSTEPD RACYGPKHVE
310 320 330 340 350
VANERMAIQT LLITDELFRN SDVKTRKKYV NLVESVKDSG GDAFIFSAMH
360 370
VSGEQLAQLT GIAALLRFPL PELEDIEM
Length:378
Mass (Da):42,519
Last modified:May 1, 1999 - v1
Checksum:iA6B571D9592EBC43
GO
Isoform 2 (identifier: Q9ZT87-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     215-251: DQFHRHLLLEAERRQLRPIIENKSRIILVHTNSGYRH → VFFLVTQRLSKFTWFIIFQIAAGPGLQISHTYMTQTV
     252-378: Missing.

Note: No experimental confirmation available.
Show »
Length:251
Mass (Da):28,152
Checksum:i23CE4F85F58C3A51
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei215 – 25137DQFHR…SGYRH → VFFLVTQRLSKFTWFIIFQI AAGPGLQISHTYMTQTV in isoform 2. 1 PublicationVSP_055358Add
BLAST
Alternative sequencei252 – 378127Missing in isoform 2. 1 PublicationVSP_055359Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF069497 mRNA. Translation: AAC82379.1.
AL035602 Genomic DNA. Translation: CAB38277.1.
AL161571 Genomic DNA. Translation: CAB81415.1.
CP002687 Genomic DNA. Translation: AEE85374.1.
AF325048 mRNA. Translation: AAG40400.1.
AY074298 mRNA. Translation: AAL66995.1.
AY096569 mRNA. Translation: AAM20219.1.
PIRiT05870.
RefSeqiNP_194495.3. NM_118901.4. [Q9ZT87-1]
UniGeneiAt.2803.

Genome annotation databases

EnsemblPlantsiAT4G27650.1; AT4G27650.1; AT4G27650. [Q9ZT87-1]
GeneIDi828876.
KEGGiath:AT4G27650.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF069497 mRNA. Translation: AAC82379.1.
AL035602 Genomic DNA. Translation: CAB38277.1.
AL161571 Genomic DNA. Translation: CAB81415.1.
CP002687 Genomic DNA. Translation: AEE85374.1.
AF325048 mRNA. Translation: AAG40400.1.
AY074298 mRNA. Translation: AAL66995.1.
AY096569 mRNA. Translation: AAM20219.1.
PIRiT05870.
RefSeqiNP_194495.3. NM_118901.4. [Q9ZT87-1]
UniGeneiAt.2803.

3D structure databases

ProteinModelPortaliQ9ZT87.
SMRiQ9ZT87. Positions 19-376.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi3702.AT4G27650.1.

Proteomic databases

PaxDbiQ9ZT87.
PRIDEiQ9ZT87.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblPlantsiAT4G27650.1; AT4G27650.1; AT4G27650. [Q9ZT87-1]
GeneIDi828876.
KEGGiath:AT4G27650.

Organism-specific databases

TAIRiAT4G27650.

Phylogenomic databases

eggNOGiKOG2869. Eukaryota.
COG1537. LUCA.
HOGENOMiHOG000184162.
InParanoidiQ9ZT87.
KOiK06965.
OMAiAFYGKKH.
OrthoDBiEOG09360CM0.
PhylomeDBiQ9ZT87.

Miscellaneous databases

PROiQ9ZT87.

Gene expression databases

GenevisibleiQ9ZT87. AT.

Family and domain databases

Gene3Di3.30.1330.30. 1 hit.
InterProiIPR005140. eRF1_1_Pelota.
IPR005141. eRF1_2.
IPR005142. eRF1_3.
IPR029064. L30e-like.
IPR004405. Transl-rel_pelota.
[Graphical view]
PANTHERiPTHR10853. PTHR10853. 1 hit.
PfamiPF03463. eRF1_1. 1 hit.
PF03464. eRF1_2. 1 hit.
PF03465. eRF1_3. 1 hit.
[Graphical view]
SMARTiSM01194. eRF1_1. 1 hit.
[Graphical view]
SUPFAMiSSF55315. SSF55315. 1 hit.
TIGRFAMsiTIGR00111. pelota. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiPEL1_ARATH
AccessioniPrimary (citable) accession number: Q9ZT87
Secondary accession number(s): Q9FPG8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 9, 2014
Last sequence update: May 1, 1999
Last modified: September 7, 2016
This is version 99 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.