Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein PELOTA 1

Gene

PEL1

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Required for normal chromosome segregation during cell division and genomic stability (By similarity). May function in recognizing stalled ribosomes and triggering endonucleolytic cleavage of the mRNA, a mechanism to release non-functional ribosomes and degrade damaged mRNAs. May have ribonuclease activity (Potential).By similarityCurated

Cofactori

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionEndonuclease, Hydrolase, Nuclease
LigandMetal-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Protein PELOTA 1 (EC:3.1.-.-)
Short name:
AtPelota1
Gene namesi
Name:PEL1
Ordered Locus Names:At4g27650
ORF Names:T29A15.140
OrganismiArabidopsis thaliana (Mouse-ear cress)
Taxonomic identifieri3702 [NCBI]
Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
Proteomesi
  • UP000006548 Componenti: Chromosome 4

Organism-specific databases

AraportiAT4G27650
TAIRilocus:2137732 AT4G27650

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cell wall Cytoskeleton Vacuole Chloroplast Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertion Graphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00004299301 – 378Protein PELOTA 1Add BLAST378

Proteomic databases

PaxDbiQ9ZT87
PRIDEiQ9ZT87

Expressioni

Tissue specificityi

Expressed constitutively in seedlings, buds, stems, leaves and roots.1 Publication

Gene expression databases

ExpressionAtlasiQ9ZT87 baseline and differential
GenevisibleiQ9ZT87 AT

Interactioni

Protein-protein interaction databases

STRINGi3702.AT4G27650.1

Structurei

3D structure databases

ProteinModelPortaliQ9ZT87
SMRiQ9ZT87
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domaini

The N-terminal domain has the RNA-binding Sm fold. It may harbor the endoribonuclease activity (Potential).Curated

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG2869 Eukaryota
COG1537 LUCA
HOGENOMiHOG000184162
InParanoidiQ9ZT87
KOiK06965
OMAiDNLFRCQ
OrthoDBiEOG09360CM0
PhylomeDBiQ9ZT87

Family and domain databases

Gene3Di2.30.30.870, 1 hit
3.30.1330.30, 1 hit
InterProiView protein in InterPro
IPR005140 eRF1_1_Pelota
IPR005141 eRF1_2
IPR005142 eRF1_3
IPR029064 L30e-like
IPR038069 Pelota/DOM34_N
IPR004405 Transl-rel_pelota
PANTHERiPTHR10853 PTHR10853, 1 hit
PfamiView protein in Pfam
PF03463 eRF1_1, 1 hit
PF03464 eRF1_2, 1 hit
PF03465 eRF1_3, 1 hit
SMARTiView protein in SMART
SM01194 eRF1_1, 1 hit
SUPFAMiSSF159065 SSF159065, 1 hit
SSF55315 SSF55315, 1 hit
TIGRFAMsiTIGR00111 pelota, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9ZT87-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKIVRRDFVR NGPGSVKMVA EDSDDLWYAY NLIAVGDSVM AVTFRKVQRE
60 70 80 90 100
IPGGGRDSER VKLKLEVQVE EVDYDKDGSV LRIRGKNILE NEHVKIGAFH
110 120 130 140 150
TLELELKRPF VLRKEMWDSM ALDTLKQASD PAASADLAVV LMQEGLAQIF
160 170 180 190 200
LVGRSVTSSR ARIETSIPRK HGPAIAGYES ALKKFFENVL QAFVKHVDFS
210 220 230 240 250
VVRCAVVASP GFTKDQFHRH LLLEAERRQL RPIIENKSRI ILVHTNSGYR
260 270 280 290 300
HSLGEVLHAP NVMNMIKDTK AAKEVKALND FHNMLSTEPD RACYGPKHVE
310 320 330 340 350
VANERMAIQT LLITDELFRN SDVKTRKKYV NLVESVKDSG GDAFIFSAMH
360 370
VSGEQLAQLT GIAALLRFPL PELEDIEM
Length:378
Mass (Da):42,519
Last modified:May 1, 1999 - v1
Checksum:iA6B571D9592EBC43
GO
Isoform 2 (identifier: Q9ZT87-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     215-251: DQFHRHLLLEAERRQLRPIIENKSRIILVHTNSGYRH → VFFLVTQRLSKFTWFIIFQIAAGPGLQISHTYMTQTV
     252-378: Missing.

Note: No experimental confirmation available.
Show »
Length:251
Mass (Da):28,152
Checksum:i23CE4F85F58C3A51
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_055358215 – 251DQFHR…SGYRH → VFFLVTQRLSKFTWFIIFQI AAGPGLQISHTYMTQTV in isoform 2. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_055359252 – 378Missing in isoform 2. 1 PublicationAdd BLAST127

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF069497 mRNA Translation: AAC82379.1
AL035602 Genomic DNA Translation: CAB38277.1
AL161571 Genomic DNA Translation: CAB81415.1
CP002687 Genomic DNA Translation: AEE85374.1
CP002687 Genomic DNA Translation: ANM67968.1
CP002687 Genomic DNA Translation: ANM67969.1
AF325048 mRNA Translation: AAG40400.1
AY074298 mRNA Translation: AAL66995.1
AY096569 mRNA Translation: AAM20219.1
PIRiT05870
RefSeqiNP_001329759.1, NM_001341876.1 [Q9ZT87-1]
NP_001329760.1, NM_001341877.1 [Q9ZT87-1]
NP_194495.3, NM_118901.5 [Q9ZT87-1]
UniGeneiAt.2803

Genome annotation databases

EnsemblPlantsiAT4G27650.1; AT4G27650.1; AT4G27650 [Q9ZT87-1]
AT4G27650.2; AT4G27650.2; AT4G27650 [Q9ZT87-1]
AT4G27650.3; AT4G27650.3; AT4G27650 [Q9ZT87-1]
GeneIDi828876
GrameneiAT4G27650.1; AT4G27650.1; AT4G27650 [Q9ZT87-1]
AT4G27650.2; AT4G27650.2; AT4G27650 [Q9ZT87-1]
AT4G27650.3; AT4G27650.3; AT4G27650 [Q9ZT87-1]
KEGGiath:AT4G27650

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiPEL1_ARATH
AccessioniPrimary (citable) accession number: Q9ZT87
Secondary accession number(s): Q9FPG8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 9, 2014
Last sequence update: May 1, 1999
Last modified: May 23, 2018
This is version 113 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health