SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9ZR37

- DUS1_ARATH

UniProt

Q9ZR37 - DUS1_ARATH

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Dual specificity protein phosphatase 1

Gene
DSPTP1, At3g23610, MDB19.10
Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Has a dual specificity toward Ser/Thr and Tyr-containing proteins. Dephosphorylates MPK4 in vitro.1 Publication

Catalytic activityi

Protein tyrosine phosphate + H2O = protein tyrosine + phosphate.
[a protein]-serine/threonine phosphate + H2O = [a protein]-serine/threonine + phosphate.

Enzyme regulationi

Inhibited by sodium vanadate and sodium tungstate. NaF and spermifine repress specifically phosphoserine and phosphothreonine phosphatase activity.1 Publication

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei135 – 1351Phosphocysteine intermediate By similarity

GO - Molecular functioni

  1. protein tyrosine/serine/threonine phosphatase activity Source: UniProtKB
  2. protein tyrosine phosphatase activity Source: UniProtKB-EC
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Protein phosphatase

Keywords - Ligandi

Calmodulin-binding

Enzyme and pathway databases

BioCyciARA:AT3G23610-MONOMER.
ARA:GQT-877-MONOMER.
ReactomeiREACT_208246. ERKs are inactivated.

Names & Taxonomyi

Protein namesi
Recommended name:
Dual specificity protein phosphatase 1 (EC:3.1.3.16, EC:3.1.3.48)
Short name:
AtDsPTP1
Gene namesi
Name:DSPTP1
Ordered Locus Names:At3g23610
ORF Names:MDB19.10
OrganismiArabidopsis thaliana (Mouse-ear cress)
Taxonomic identifieri3702 [NCBI]
Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
ProteomesiUP000006548: Chromosome 3

Organism-specific databases

TAIRiAT3G23610.

Subcellular locationi

Nucleus By similarity. Cytoplasm By similarity

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB-SubCell
  2. nucleus Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi32 – 321I → R: Impaired CaM binding and loss of phosphatase activity. 1 Publication
Mutagenesisi35 – 351L → R: Impaired CaM binding. 1 Publication
Mutagenesisi135 – 1351C → S: Loss of phosphatase activity. 1 Publication
Mutagenesisi166 – 1661K → E: Impaired CaM binding. 1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 198198Dual specificity protein phosphatase 1PRO_0000415896Add
BLAST

Proteomic databases

PRIDEiQ9ZR37.

Expressioni

Tissue specificityi

Expressed in roots, stems, leaves and flowers.1 Publication

Gene expression databases

GenevestigatoriQ9ZR37.

Interactioni

Subunit structurei

Interacts with calmodulin (CaM) in a calcium Ca2+-dependent manner.1 Publication

Protein-protein interaction databases

STRINGi3702.AT3G23610.2-P.

Structurei

3D structure databases

ProteinModelPortaliQ9ZR37.
SMRiQ9ZR37. Positions 57-187.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini118 – 18265Tyrosine-protein phosphataseAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni26 – 4722CaM binding domain 1Add
BLAST
Regioni151 – 18030CaM binding domain 2Add
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi8 – 1710Poly-Ser

Sequence similaritiesi

Phylogenomic databases

HOGENOMiHOG000233767.
InParanoidiQ9ZR37.
KOiK05766.
OMAiQDFEKSL.
PhylomeDBiQ9ZR37.

Family and domain databases

Gene3Di3.90.190.10. 1 hit.
InterProiIPR020417. Atypical_DUSP.
IPR000340. Dual-sp_phosphatase_cat-dom.
IPR020422. Dual-sp_phosphatase_subgr_cat.
IPR024950. DUSP.
IPR029021. Prot-tyrosine_phosphatase-like.
IPR000387. Tyr/Dual-sp_Pase.
[Graphical view]
PANTHERiPTHR10159. PTHR10159. 1 hit.
PfamiPF00782. DSPc. 1 hit.
[Graphical view]
PRINTSiPR01908. ADSPHPHTASE.
SMARTiSM00195. DSPc. 1 hit.
[Graphical view]
SUPFAMiSSF52799. SSF52799. 1 hit.
PROSITEiPS50056. TYR_PHOSPHATASE_2. 1 hit.
PS50054. TYR_PHOSPHATASE_DUAL. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9ZR37-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MSSRDRGSPS SSSSSSSLPG IEKYNEKVKN QIQALVRVIK VARTYRDDNV    50
PSLIEQGLYL GSVAAASNKN VLKSYNVTHI LTVASSLRPA HPDDFVYKVV 100
RVVDKEDTNL EMYFDECVDF IDEAKRQGGS VLVHCFVGKS RSVTIVVAYL 150
MKKHGMTLAQ ALQHVKSKRP VASPNAGFIR QLQDLEKSMQ VSDQFFSF 198
Length:198
Mass (Da):22,017
Last modified:May 1, 1999 - v1
Checksum:iEBF1C98A177E6450
GO
Isoform 2 (identifier: Q9ZR37-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     191-198: VSDQFFSF → GKQVTIAQCQA

Note: Derived from EST data. No experimental confirmation available.

Show »
Length:201
Mass (Da):22,187
Checksum:i2FA50431F9A00273
GO
Isoform 3 (identifier: Q9ZR37-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     192-198: SDQFFSF → VVEEKTVPCKYLLHASSFFSIKQGSKLRLHNVRREDH

Note: Constructed according to the conserved gene model. No experimental confirmation available.

Show »
Length:228
Mass (Da):25,493
Checksum:iA8D74C6A929B00D5
GO

Sequence cautioni

The sequence BAB02780.1 differs from that shown. Reason: Erroneous gene model prediction.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei191 – 1988VSDQFFSF → GKQVTIAQCQA in isoform 2. VSP_042412
Alternative sequencei192 – 1987SDQFFSF → VVEEKTVPCKYLLHASSFFS IKQGSKLRLHNVRREDH in isoform 3. VSP_042413

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
Y18620 mRNA. Translation: CAA77232.1.
AB023036 Genomic DNA. Translation: BAB02780.1. Sequence problems.
CP002686 Genomic DNA. Translation: AEE76784.1.
CP002686 Genomic DNA. Translation: AEE76785.1.
CP002686 Genomic DNA. Translation: AEE76786.1.
RefSeqiNP_001118683.1. NM_001125211.2. [Q9ZR37-2]
NP_001189955.1. NM_001203026.1. [Q9ZR37-3]
NP_189003.1. NM_113265.1. [Q9ZR37-1]
UniGeneiAt.25373.

Genome annotation databases

EnsemblPlantsiAT3G23610.1; AT3G23610.1; AT3G23610. [Q9ZR37-1]
GeneIDi821941.
KEGGiath:AT3G23610.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
Y18620 mRNA. Translation: CAA77232.1 .
AB023036 Genomic DNA. Translation: BAB02780.1 . Sequence problems.
CP002686 Genomic DNA. Translation: AEE76784.1 .
CP002686 Genomic DNA. Translation: AEE76785.1 .
CP002686 Genomic DNA. Translation: AEE76786.1 .
RefSeqi NP_001118683.1. NM_001125211.2. [Q9ZR37-2 ]
NP_001189955.1. NM_001203026.1. [Q9ZR37-3 ]
NP_189003.1. NM_113265.1. [Q9ZR37-1 ]
UniGenei At.25373.

3D structure databases

ProteinModelPortali Q9ZR37.
SMRi Q9ZR37. Positions 57-187.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

STRINGi 3702.AT3G23610.2-P.

Proteomic databases

PRIDEi Q9ZR37.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

EnsemblPlantsi AT3G23610.1 ; AT3G23610.1 ; AT3G23610 . [Q9ZR37-1 ]
GeneIDi 821941.
KEGGi ath:AT3G23610.

Organism-specific databases

TAIRi AT3G23610.

Phylogenomic databases

HOGENOMi HOG000233767.
InParanoidi Q9ZR37.
KOi K05766.
OMAi QDFEKSL.
PhylomeDBi Q9ZR37.

Enzyme and pathway databases

BioCyci ARA:AT3G23610-MONOMER.
ARA:GQT-877-MONOMER.
Reactomei REACT_208246. ERKs are inactivated.

Gene expression databases

Genevestigatori Q9ZR37.

Family and domain databases

Gene3Di 3.90.190.10. 1 hit.
InterProi IPR020417. Atypical_DUSP.
IPR000340. Dual-sp_phosphatase_cat-dom.
IPR020422. Dual-sp_phosphatase_subgr_cat.
IPR024950. DUSP.
IPR029021. Prot-tyrosine_phosphatase-like.
IPR000387. Tyr/Dual-sp_Pase.
[Graphical view ]
PANTHERi PTHR10159. PTHR10159. 1 hit.
Pfami PF00782. DSPc. 1 hit.
[Graphical view ]
PRINTSi PR01908. ADSPHPHTASE.
SMARTi SM00195. DSPc. 1 hit.
[Graphical view ]
SUPFAMi SSF52799. SSF52799. 1 hit.
PROSITEi PS50056. TYR_PHOSPHATASE_2. 1 hit.
PS50054. TYR_PHOSPHATASE_DUAL. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Identification of a dual-specificity protein phosphatase that inactivates a MAP kinase from Arabidopsis."
    Gupta R., Huang Y., Kieber J., Luan S.
    Plant J. 16:581-589(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION AS DUAL-SPECIFICITY PROTEIN PHOSPHATASE, MUTAGENESIS OF CYS-135, TISSUE SPECIFICITY, ENZYME REGULATION.
    Strain: cv. Columbia.
  2. "Structural analysis of Arabidopsis thaliana chromosome 3. I. Sequence features of the regions of 4,504,864 bp covered by sixty P1 and TAC clones."
    Sato S., Nakamura Y., Kaneko T., Katoh T., Asamizu E., Tabata S.
    DNA Res. 7:131-135(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: cv. Columbia.
  3. The Arabidopsis Information Resource (TAIR)
    Submitted (APR-2011) to the EMBL/GenBank/DDBJ databases
    Cited for: GENOME REANNOTATION.
    Strain: cv. Columbia.
  4. "Regulation of the dual specificity protein phosphatase, DsPTP1, through interactions with calmodulin."
    Yoo J.H., Cheong M.S., Park C.Y., Moon B.C., Kim M.C., Kang Y.H., Park H.C., Choi M.S., Lee J.H., Jung W.Y., Yoon H.W., Chung W.S., Lim C.O., Lee S.Y., Cho M.J.
    J. Biol. Chem. 279:848-858(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH CALMODULIN, MUTAGENESIS OF ILE-32; LEU-35 AND LYS-166.
    Strain: cv. Columbia.

Entry informationi

Entry nameiDUS1_ARATH
AccessioniPrimary (citable) accession number: Q9ZR37
Secondary accession number(s): B3H4F5, F4J449, Q9LUG6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 21, 2012
Last sequence update: May 1, 1999
Last modified: September 3, 2014
This is version 80 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi