Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Dual specificity protein phosphatase 1

Gene

DSPTP1

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Has a dual specificity toward Ser/Thr and Tyr-containing proteins. Dephosphorylates MPK4 in vitro.1 Publication

Catalytic activityi

Protein tyrosine phosphate + H2O = protein tyrosine + phosphate.
[a protein]-serine/threonine phosphate + H2O = [a protein]-serine/threonine + phosphate.

Enzyme regulationi

Inhibited by sodium vanadate and sodium tungstate. NaF and spermifine repress specifically phosphoserine and phosphothreonine phosphatase activity.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei135Phosphocysteine intermediateBy similarity1

GO - Molecular functioni

  • calmodulin binding Source: TAIR
  • protein tyrosine/serine/threonine phosphatase activity Source: UniProtKB
  • protein tyrosine phosphatase activity Source: UniProtKB-EC

GO - Biological processi

  • protein dephosphorylation Source: TAIR

Keywordsi

Molecular functionCalmodulin-binding, Hydrolase, Protein phosphatase

Names & Taxonomyi

Protein namesi
Recommended name:
Dual specificity protein phosphatase 1 (EC:3.1.3.16, EC:3.1.3.48)
Short name:
AtDsPTP1
Gene namesi
Name:DSPTP1
Ordered Locus Names:At3g23610
ORF Names:MDB19.10
OrganismiArabidopsis thaliana (Mouse-ear cress)
Taxonomic identifieri3702 [NCBI]
Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
Proteomesi
  • UP000006548 Componenti: Chromosome 3

Organism-specific databases

AraportiAT3G23610
TAIRilocus:2088080 AT3G23610

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cell wall Cytoskeleton Vacuole Chloroplast Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertion Graphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi32I → R: Impaired CaM binding and loss of phosphatase activity. 1 Publication1
Mutagenesisi35L → R: Impaired CaM binding. 1 Publication1
Mutagenesisi135C → S: Loss of phosphatase activity. 1 Publication1
Mutagenesisi166K → E: Impaired CaM binding. 1 Publication1

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00004158961 – 198Dual specificity protein phosphatase 1Add BLAST198

Proteomic databases

PaxDbiQ9ZR37

PTM databases

iPTMnetiQ9ZR37

Expressioni

Tissue specificityi

Expressed in roots, stems, leaves and flowers.1 Publication

Gene expression databases

ExpressionAtlasiQ9ZR37 baseline and differential
GenevisibleiQ9ZR37 AT

Interactioni

Subunit structurei

Interacts with calmodulin (CaM) in a calcium Ca2+-dependent manner.1 Publication

GO - Molecular functioni

  • calmodulin binding Source: TAIR

Protein-protein interaction databases

BioGridi7273, 1 interactor
STRINGi3702.AT3G23610.3

Structurei

3D structure databases

ProteinModelPortaliQ9ZR37
SMRiQ9ZR37
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini118 – 182Tyrosine-protein phosphataseAdd BLAST65

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni26 – 47CaM binding domain 1Add BLAST22
Regioni151 – 180CaM binding domain 2Add BLAST30

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi8 – 17Poly-Ser10

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG1716 Eukaryota
COG2453 LUCA
HOGENOMiHOG000233767
InParanoidiQ9ZR37
KOiK05766
OMAiQLCQLNE
PhylomeDBiQ9ZR37

Family and domain databases

CDDicd00127 DSPc, 1 hit
Gene3Di3.90.190.10, 1 hit
InterProiView protein in InterPro
IPR020417 Atypical_DUSP
IPR000340 Dual-sp_phosphatase_cat-dom
IPR024950 DUSP
IPR029021 Prot-tyrosine_phosphatase-like
IPR000387 TYR_PHOSPHATASE_dom
IPR020422 TYR_PHOSPHATASE_DUAL_dom
PANTHERiPTHR10159 PTHR10159, 1 hit
PfamiView protein in Pfam
PF00782 DSPc, 1 hit
PRINTSiPR01908 ADSPHPHTASE
SMARTiView protein in SMART
SM00195 DSPc, 1 hit
SUPFAMiSSF52799 SSF52799, 1 hit
PROSITEiView protein in PROSITE
PS50056 TYR_PHOSPHATASE_2, 1 hit
PS50054 TYR_PHOSPHATASE_DUAL, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9ZR37-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSSRDRGSPS SSSSSSSLPG IEKYNEKVKN QIQALVRVIK VARTYRDDNV
60 70 80 90 100
PSLIEQGLYL GSVAAASNKN VLKSYNVTHI LTVASSLRPA HPDDFVYKVV
110 120 130 140 150
RVVDKEDTNL EMYFDECVDF IDEAKRQGGS VLVHCFVGKS RSVTIVVAYL
160 170 180 190
MKKHGMTLAQ ALQHVKSKRP VASPNAGFIR QLQDLEKSMQ VSDQFFSF
Length:198
Mass (Da):22,017
Last modified:May 1, 1999 - v1
Checksum:iEBF1C98A177E6450
GO
Isoform 2 (identifier: Q9ZR37-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     191-198: VSDQFFSF → GKQVTIAQCQA

Note: Derived from EST data. No experimental confirmation available.
Show »
Length:201
Mass (Da):22,187
Checksum:i2FA50431F9A00273
GO
Isoform 3 (identifier: Q9ZR37-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     192-198: SDQFFSF → VVEEKTVPCKYLLHASSFFSIKQGSKLRLHNVRREDH

Note: Constructed according to the conserved gene model. No experimental confirmation available.
Show »
Length:228
Mass (Da):25,493
Checksum:iA8D74C6A929B00D5
GO

Sequence cautioni

The sequence BAB02780 differs from that shown. Reason: Erroneous gene model prediction.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_042412191 – 198VSDQFFSF → GKQVTIAQCQA in isoform 2. Curated8
Alternative sequenceiVSP_042413192 – 198SDQFFSF → VVEEKTVPCKYLLHASSFFS IKQGSKLRLHNVRREDH in isoform 3. Curated7

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y18620 mRNA Translation: CAA77232.1
AB023036 Genomic DNA Translation: BAB02780.1 Sequence problems.
CP002686 Genomic DNA Translation: AEE76784.1
CP002686 Genomic DNA Translation: AEE76785.1
CP002686 Genomic DNA Translation: AEE76786.1
RefSeqiNP_001118683.1, NM_001125211.3 [Q9ZR37-2]
NP_001189955.1, NM_001203026.1 [Q9ZR37-3]
NP_189003.1, NM_113265.1 [Q9ZR37-1]
UniGeneiAt.25373

Genome annotation databases

EnsemblPlantsiAT3G23610.1; AT3G23610.1; AT3G23610 [Q9ZR37-1]
AT3G23610.2; AT3G23610.2; AT3G23610 [Q9ZR37-2]
AT3G23610.3; AT3G23610.3; AT3G23610 [Q9ZR37-3]
GeneIDi821941
GrameneiAT3G23610.1; AT3G23610.1; AT3G23610 [Q9ZR37-1]
AT3G23610.2; AT3G23610.2; AT3G23610 [Q9ZR37-2]
AT3G23610.3; AT3G23610.3; AT3G23610 [Q9ZR37-3]
KEGGiath:AT3G23610

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiDUS1_ARATH
AccessioniPrimary (citable) accession number: Q9ZR37
Secondary accession number(s): B3H4F5, F4J449, Q9LUG6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 21, 2012
Last sequence update: May 1, 1999
Last modified: April 25, 2018
This is version 104 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health