Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Dual specificity protein phosphatase 1

Gene

DSPTP1

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Has a dual specificity toward Ser/Thr and Tyr-containing proteins. Dephosphorylates MPK4 in vitro.1 Publication

Catalytic activityi

Protein tyrosine phosphate + H2O = protein tyrosine + phosphate.
[a protein]-serine/threonine phosphate + H2O = [a protein]-serine/threonine + phosphate.

Enzyme regulationi

Inhibited by sodium vanadate and sodium tungstate. NaF and spermifine repress specifically phosphoserine and phosphothreonine phosphatase activity.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei135Phosphocysteine intermediateBy similarity1

GO - Molecular functioni

Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Protein phosphatase

Keywords - Ligandi

Calmodulin-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Dual specificity protein phosphatase 1 (EC:3.1.3.16, EC:3.1.3.48)
Short name:
AtDsPTP1
Gene namesi
Name:DSPTP1
Ordered Locus Names:At3g23610
ORF Names:MDB19.10
OrganismiArabidopsis thaliana (Mouse-ear cress)
Taxonomic identifieri3702 [NCBI]
Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
Proteomesi
  • UP000006548 Componenti: Chromosome 3

Organism-specific databases

TAIRiAT3G23610.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi32I → R: Impaired CaM binding and loss of phosphatase activity. 1 Publication1
Mutagenesisi35L → R: Impaired CaM binding. 1 Publication1
Mutagenesisi135C → S: Loss of phosphatase activity. 1 Publication1
Mutagenesisi166K → E: Impaired CaM binding. 1 Publication1

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00004158961 – 198Dual specificity protein phosphatase 1Add BLAST198

Proteomic databases

PaxDbiQ9ZR37.

PTM databases

iPTMnetiQ9ZR37.

Expressioni

Tissue specificityi

Expressed in roots, stems, leaves and flowers.1 Publication

Gene expression databases

GenevisibleiQ9ZR37. AT.

Interactioni

Subunit structurei

Interacts with calmodulin (CaM) in a calcium Ca2+-dependent manner.1 Publication

Protein-protein interaction databases

BioGridi7273. 1 interactor.
STRINGi3702.AT3G23610.3.

Structurei

3D structure databases

ProteinModelPortaliQ9ZR37.
SMRiQ9ZR37.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini118 – 182Tyrosine-protein phosphataseAdd BLAST65

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni26 – 47CaM binding domain 1Add BLAST22
Regioni151 – 180CaM binding domain 2Add BLAST30

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi8 – 17Poly-Ser10

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG1716. Eukaryota.
COG2453. LUCA.
HOGENOMiHOG000233767.
InParanoidiQ9ZR37.
KOiK05766.
OMAiSYNVTHI.
PhylomeDBiQ9ZR37.

Family and domain databases

CDDicd00127. DSPc. 1 hit.
Gene3Di3.90.190.10. 1 hit.
InterProiIPR020417. Atypical_DUSP.
IPR000340. Dual-sp_phosphatase_cat-dom.
IPR024950. DUSP.
IPR029021. Prot-tyrosine_phosphatase-like.
IPR000387. TYR_PHOSPHATASE_dom.
IPR020422. TYR_PHOSPHATASE_DUAL_dom.
[Graphical view]
PANTHERiPTHR10159. PTHR10159. 1 hit.
PfamiPF00782. DSPc. 1 hit.
[Graphical view]
PRINTSiPR01908. ADSPHPHTASE.
SMARTiSM00195. DSPc. 1 hit.
[Graphical view]
SUPFAMiSSF52799. SSF52799. 1 hit.
PROSITEiPS50056. TYR_PHOSPHATASE_2. 1 hit.
PS50054. TYR_PHOSPHATASE_DUAL. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9ZR37-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSSRDRGSPS SSSSSSSLPG IEKYNEKVKN QIQALVRVIK VARTYRDDNV
60 70 80 90 100
PSLIEQGLYL GSVAAASNKN VLKSYNVTHI LTVASSLRPA HPDDFVYKVV
110 120 130 140 150
RVVDKEDTNL EMYFDECVDF IDEAKRQGGS VLVHCFVGKS RSVTIVVAYL
160 170 180 190
MKKHGMTLAQ ALQHVKSKRP VASPNAGFIR QLQDLEKSMQ VSDQFFSF
Length:198
Mass (Da):22,017
Last modified:May 1, 1999 - v1
Checksum:iEBF1C98A177E6450
GO
Isoform 2 (identifier: Q9ZR37-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     191-198: VSDQFFSF → GKQVTIAQCQA

Note: Derived from EST data. No experimental confirmation available.
Show »
Length:201
Mass (Da):22,187
Checksum:i2FA50431F9A00273
GO
Isoform 3 (identifier: Q9ZR37-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     192-198: SDQFFSF → VVEEKTVPCKYLLHASSFFSIKQGSKLRLHNVRREDH

Note: Constructed according to the conserved gene model. No experimental confirmation available.
Show »
Length:228
Mass (Da):25,493
Checksum:iA8D74C6A929B00D5
GO

Sequence cautioni

The sequence BAB02780 differs from that shown. Reason: Erroneous gene model prediction.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_042412191 – 198VSDQFFSF → GKQVTIAQCQA in isoform 2. Curated8
Alternative sequenceiVSP_042413192 – 198SDQFFSF → VVEEKTVPCKYLLHASSFFS IKQGSKLRLHNVRREDH in isoform 3. Curated7

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y18620 mRNA. Translation: CAA77232.1.
AB023036 Genomic DNA. Translation: BAB02780.1. Sequence problems.
CP002686 Genomic DNA. Translation: AEE76784.1.
CP002686 Genomic DNA. Translation: AEE76785.1.
CP002686 Genomic DNA. Translation: AEE76786.1.
RefSeqiNP_001118683.1. NM_001125211.3. [Q9ZR37-2]
NP_001189955.1. NM_001203026.1. [Q9ZR37-3]
NP_189003.1. NM_113265.1. [Q9ZR37-1]
UniGeneiAt.25373.

Genome annotation databases

EnsemblPlantsiAT3G23610.1; AT3G23610.1; AT3G23610. [Q9ZR37-1]
GeneIDi821941.
GrameneiAT3G23610.1; AT3G23610.1; AT3G23610.
KEGGiath:AT3G23610.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y18620 mRNA. Translation: CAA77232.1.
AB023036 Genomic DNA. Translation: BAB02780.1. Sequence problems.
CP002686 Genomic DNA. Translation: AEE76784.1.
CP002686 Genomic DNA. Translation: AEE76785.1.
CP002686 Genomic DNA. Translation: AEE76786.1.
RefSeqiNP_001118683.1. NM_001125211.3. [Q9ZR37-2]
NP_001189955.1. NM_001203026.1. [Q9ZR37-3]
NP_189003.1. NM_113265.1. [Q9ZR37-1]
UniGeneiAt.25373.

3D structure databases

ProteinModelPortaliQ9ZR37.
SMRiQ9ZR37.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi7273. 1 interactor.
STRINGi3702.AT3G23610.3.

PTM databases

iPTMnetiQ9ZR37.

Proteomic databases

PaxDbiQ9ZR37.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblPlantsiAT3G23610.1; AT3G23610.1; AT3G23610. [Q9ZR37-1]
GeneIDi821941.
GrameneiAT3G23610.1; AT3G23610.1; AT3G23610.
KEGGiath:AT3G23610.

Organism-specific databases

TAIRiAT3G23610.

Phylogenomic databases

eggNOGiKOG1716. Eukaryota.
COG2453. LUCA.
HOGENOMiHOG000233767.
InParanoidiQ9ZR37.
KOiK05766.
OMAiSYNVTHI.
PhylomeDBiQ9ZR37.

Miscellaneous databases

PROiQ9ZR37.

Gene expression databases

GenevisibleiQ9ZR37. AT.

Family and domain databases

CDDicd00127. DSPc. 1 hit.
Gene3Di3.90.190.10. 1 hit.
InterProiIPR020417. Atypical_DUSP.
IPR000340. Dual-sp_phosphatase_cat-dom.
IPR024950. DUSP.
IPR029021. Prot-tyrosine_phosphatase-like.
IPR000387. TYR_PHOSPHATASE_dom.
IPR020422. TYR_PHOSPHATASE_DUAL_dom.
[Graphical view]
PANTHERiPTHR10159. PTHR10159. 1 hit.
PfamiPF00782. DSPc. 1 hit.
[Graphical view]
PRINTSiPR01908. ADSPHPHTASE.
SMARTiSM00195. DSPc. 1 hit.
[Graphical view]
SUPFAMiSSF52799. SSF52799. 1 hit.
PROSITEiPS50056. TYR_PHOSPHATASE_2. 1 hit.
PS50054. TYR_PHOSPHATASE_DUAL. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiDUS1_ARATH
AccessioniPrimary (citable) accession number: Q9ZR37
Secondary accession number(s): B3H4F5, F4J449, Q9LUG6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 21, 2012
Last sequence update: May 1, 1999
Last modified: November 30, 2016
This is version 95 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.