Q9ZR37 (DUS1_ARATH) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 68.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Dual specificity protein phosphatase 1 Short name=AtDsPTP1 EC=3.1.3.16 EC=3.1.3.48 | ||||||
| Gene names |
| ||||||
| Organism | Arabidopsis thaliana (Mouse-ear cress) [Reference proteome] | ||||||
| Taxonomic identifier | 3702 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Viridiplantae › Streptophyta › Embryophyta › Tracheophyta › Spermatophyta › Magnoliophyta › eudicotyledons › core eudicotyledons › rosids › malvids › Brassicales › Brassicaceae › Camelineae › Arabidopsis![]() |
Protein attributes
| Sequence length | 198 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Has a dual specificity toward Ser/Thr and Tyr-containing proteins. Dephosphorylates MPK4 in vitro. Ref.1 |
| Catalytic activity | Protein tyrosine phosphate + H2O = protein tyrosine + phosphate. A phosphoprotein + H2O = a protein + phosphate. |
| Enzyme regulation | Inhibited by sodium vanadate and sodium tungstate. NaF and spermifine repress specifically phosphoserine and phosphothreonine phosphatase activity. Ref.1 |
| Subunit structure | Interacts with calmodulin (CaM) in a calcium Ca2+-dependent manner. Ref.4 |
| Subcellular location | |
| Tissue specificity | Expressed in roots, stems, leaves and flowers. Ref.1 |
| Sequence similarities | Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily. Contains 1 tyrosine-protein phosphatase domain. |
| Sequence caution | The sequence BAB02780.1 differs from that shown. Reason: Erroneous gene model prediction. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Nucleus |
| Coding sequence diversity | Alternative splicing |
| Ligand | Calmodulin-binding |
| Molecular function | Hydrolase Protein phosphatase |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | peptidyl-tyrosine dephosphorylation Inferred from electronic annotation. Source: GOC |
| Cellular_component | cytoplasm Inferred from electronic annotation. Source: UniProtKB-SubCell nucleusInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | protein tyrosine phosphatase activity Inferred from electronic annotation. Source: EC protein tyrosine/serine/threonine phosphatase activityInferred from direct assay Ref.1. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9ZR37-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9ZR37-2) The sequence of this isoform differs from the canonical sequence as follows: 191-198: VSDQFFSF → GKQVTIAQCQA | ||||||
| Note: Derived from EST data. No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q9ZR37-3) The sequence of this isoform differs from the canonical sequence as follows: 192-198: SDQFFSF → VVEEKTVPCKYLLHASSFFSIKQGSKLRLHNVRREDH | ||||||
| Note: Constructed according to the conserved gene model. No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 198 | 198 | Dual specificity protein phosphatase 1 | PRO_0000415896 | |||||
Regions | |||||||||
| Domain | 118 – 182 | 65 | Tyrosine-protein phosphatase | ||||||
| Region | 26 – 47 | 22 | CaM binding domain 1 | ||||||
| Region | 151 – 180 | 30 | CaM binding domain 2 | ||||||
| Compositional bias | 8 – 17 | 10 | Poly-Ser | ||||||
Sites | |||||||||
| Active site | 135 | 1 | Phosphocysteine intermediate By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 191 – 198 | 8 | VSDQFFSF → GKQVTIAQCQA in isoform 2. | VSP_042412 | |||||
| Alternative sequence | 192 – 198 | 7 | SDQFFSF → VVEEKTVPCKYLLHASSFFS IKQGSKLRLHNVRREDH in isoform 3. | VSP_042413 | |||||
Experimental info | |||||||||
| Mutagenesis | 32 | 1 | I → R: Impaired CaM binding and loss of phosphatase activity. Ref.4 | ||||||
| Mutagenesis | 35 | 1 | L → R: Impaired CaM binding. Ref.4 | ||||||
| Mutagenesis | 135 | 1 | C → S: Loss of phosphatase activity. Ref.1 | ||||||
| Mutagenesis | 166 | 1 | K → E: Impaired CaM binding. Ref.4 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification of a dual-specificity protein phosphatase that inactivates a MAP kinase from Arabidopsis." Gupta R., Huang Y., Kieber J., Luan S. Plant J. 16:581-589(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION AS DUAL-SPECIFICITY PROTEIN PHOSPHATASE, MUTAGENESIS OF CYS-135, TISSUE SPECIFICITY, ENZYME REGULATION. Strain: cv. Columbia. |
| [2] | "Structural analysis of Arabidopsis thaliana chromosome 3. I. Sequence features of the regions of 4,504,864 bp covered by sixty P1 and TAC clones." Sato S., Nakamura Y., Kaneko T., Katoh T., Asamizu E., Tabata S. DNA Res. 7:131-135(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: cv. Columbia. |
| [3] | The Arabidopsis Information Resource (TAIR) Submitted (APR-2011) to the EMBL/GenBank/DDBJ databases Cited for: GENOME REANNOTATION. Strain: cv. Columbia. |
| [4] | "Regulation of the dual specificity protein phosphatase, DsPTP1, through interactions with calmodulin." Yoo J.H., Cheong M.S., Park C.Y., Moon B.C., Kim M.C., Kang Y.H., Park H.C., Choi M.S., Lee J.H., Jung W.Y., Yoon H.W., Chung W.S., Lim C.O., Lee S.Y., Cho M.J. J. Biol. Chem. 279:848-858(2004) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH CALMODULIN, MUTAGENESIS OF ILE-32; LEU-35 AND LYS-166. Strain: cv. Columbia. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | Y18620 mRNA. Translation: CAA77232.1. AB023036 Genomic DNA. Translation: BAB02780.1. Sequence problems. CP002686 Genomic DNA. Translation: AEE76784.1. CP002686 Genomic DNA. Translation: AEE76785.1. CP002686 Genomic DNA. Translation: AEE76786.1. |
| IPI | IPI00525668. IPI00527221. IPI00891414. IPI00991367. |
| RefSeq | NP_001118683.1. NM_001125211.2. NP_001189955.1. NM_001203026.1. NP_189003.1. NM_113265.1. |
| UniGene | At.25373. |
3D structure databases | |
| HSSP | HSSP built from PDB template 1MKP based on UniProtKB Q16828. |
| ProteinModelPortal | Q9ZR37. |
| SMR | Q9ZR37. Positions 57-187. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 3702.AT3G23610.2-P. |
Proteomic databases | |
| PRIDE | Q9ZR37. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| EnsemblPlants | AT3G23610.1; AT3G23610.1; AT3G23610. |
| GeneID | 821941. |
| KEGG | ath:AT3G23610. |
Organism-specific databases | |
| TAIR | At3g23610. |
Phylogenomic databases | |
| HOGENOM | HOG000233767. |
| InParanoid | Q9ZR37. |
| KO | K05766. |
| OMA | LEMYFDE. |
| PhylomeDB | Q9ZR37. |
| ProtClustDB | CLSN2684327. |
Gene expression databases | |
| ArrayExpress | Q9ZR37. |
| Genevestigator | Q9ZR37. |
Family and domain databases | |
| InterPro | IPR020417. Atypical_DUSP. IPR000340. Dual-sp_phosphatase_cat-dom. IPR020422. Dual-sp_phosphatase_subgr_cat. IPR024950. DUSP. IPR000387. Tyr/Dual-sp_Pase. [Graphical view] |
| PANTHER | PTHR10159. PTHR10159. 1 hit. |
| Pfam | PF00782. DSPc. 1 hit. [Graphical view] |
| PRINTS | PR01908. ADSPHPHTASE. |
| SMART | SM00195. DSPc. 1 hit. [Graphical view] |
| PROSITE | PS50056. TYR_PHOSPHATASE_2. 1 hit. PS50054. TYR_PHOSPHATASE_DUAL. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Entry information
| Entry name | DUS1_ARATH | ||||||||
| Accession | Primary (citable) accession number: Q9ZR37 Secondary accession number(s): B3H4F5, F4J449, Q9LUG6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Plant Protein Annotation Program | ||||||||
Relevant documents
| Arabidopsis thaliana Arabidopsis thaliana: entries and gene names |
| SIMILARITY comments Index of protein domains and families |

Clusters with
