Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Probable inositol transporter 3

Gene

INT3

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Plasma membrane inositol-proton symporter.By similarity1 Publication

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Symport, Transport

Enzyme and pathway databases

ReactomeiR-ATH-429593. Inositol transporters.

Names & Taxonomyi

Protein namesi
Recommended name:
Probable inositol transporter 3
Gene namesi
Name:INT3
Ordered Locus Names:At2g35740
ORF Names:T20F21.7
OrganismiArabidopsis thaliana (Mouse-ear cress)
Taxonomic identifieri3702 [NCBI]
Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
Proteomesi
  • UP000006548 Componenti: Chromosome 2

Organism-specific databases

TAIRiAT2G35740.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei34 – 5421Helical; Name=1Sequence analysisAdd
BLAST
Transmembranei69 – 8921Helical; Name=2Sequence analysisAdd
BLAST
Transmembranei104 – 12421Helical; Name=3Sequence analysisAdd
BLAST
Transmembranei127 – 14721Helical; Name=4Sequence analysisAdd
BLAST
Transmembranei161 – 18121Helical; Name=5Sequence analysisAdd
BLAST
Transmembranei187 – 20721Helical; Name=6Sequence analysisAdd
BLAST
Transmembranei289 – 30921Helical; Name=7Sequence analysisAdd
BLAST
Transmembranei316 – 33621Helical; Name=8Sequence analysisAdd
BLAST
Transmembranei344 – 36421Helical; Name=9Sequence analysisAdd
BLAST
Transmembranei455 – 47521Helical; Name=10Sequence analysisAdd
BLAST
Transmembranei493 – 51321Helical; Name=11Sequence analysisAdd
BLAST
Transmembranei524 – 54421Helical; Name=12Sequence analysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 580580Probable inositol transporter 3PRO_0000259877Add
BLAST

Proteomic databases

PaxDbiQ9ZQP6.
PRIDEiQ9ZQP6.

Expressioni

Gene expression databases

GenevisibleiQ9ZQP6. AT.

Interactioni

Protein-protein interaction databases

STRINGi3702.AT2G35740.1.

Structurei

3D structure databases

ProteinModelPortaliQ9ZQP6.
SMRiQ9ZQP6. Positions 23-563.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG0254. Eukaryota.
ENOG410XNQK. LUCA.
HOGENOMiHOG000202868.
InParanoidiQ9ZQP6.
KOiK08150.
OMAiISACGLM.
PhylomeDBiQ9ZQP6.

Family and domain databases

InterProiIPR020846. MFS_dom.
IPR005828. MFS_sugar_transport_like.
IPR003663. Sugar/inositol_transpt.
IPR005829. Sugar_transporter_CS.
[Graphical view]
PfamiPF00083. Sugar_tr. 2 hits.
[Graphical view]
PRINTSiPR00171. SUGRTRNSPORT.
SUPFAMiSSF103473. SSF103473. 2 hits.
TIGRFAMsiTIGR00879. SP. 1 hit.
PROSITEiPS50850. MFS. 1 hit.
PS00216. SUGAR_TRANSPORT_1. 1 hit.
PS00217. SUGAR_TRANSPORT_2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9ZQP6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVEEASKSEQ INITEVWTTT WETPYIMRLA LSAGIGGLLF GYNTGVIAGA
60 70 80 90 100
LLYIKEEFGE VDNKTWLQEI IVSMTVAGAI VGAAIGGWYN DKFGRRMSVL
110 120 130 140 150
IADVLFLLGA LVMVIAHAPW VIILGRLLVG FGVGMASMTS PLYISEMSPA
160 170 180 190 200
RIRGALVSTN GLLITGGQFL SYLINLAFVH TPGTWRWMLG VSAIPAIIQF
210 220 230 240 250
CLMLTLPESP RWLYRNDRKA ESRDILERIY PAEMVEAEIA ALKESVRAET
260 270 280 290 300
ADEDIIGHTF SDKLRGALSN PVVRHGLAAG ITVQVAQQFV GINTVMYYSP
310 320 330 340 350
TILQFAGYAS NKTAMALALI TSGLNAVGSV VSMMFVDRYG RRKLMIISMF
360 370 380 390 400
GIITCLVILA AVFNEASNHA PKIDKRDSRN FAKNATCPAF APFTASRSPP
410 420 430 440 450
SNWNCMKCLQ YDCGFCSNGA QEYAPGACIV QSADMKALCH SKGRTFFKDG
460 470 480 490 500
CPSKFGYLAI VFLGLYIIVY APGMGTVPWI VNSEIYPLRY RGLAGGIAAV
510 520 530 540 550
SNWMSNLVVS ETFLTLTNAV GSSGTFLLFA GSSAVGLFFI WLLVPETKGL
560 570 580
QFEEVEKLLE GGFRPSLLRP TTKENQVETP
Length:580
Mass (Da):63,172
Last modified:May 1, 1999 - v1
Checksum:iFC6437FD5A3E00B3
GO
Isoform 2 (identifier: Q9ZQP6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     149-182: PARIRGALVSTNGLLITGGQFLSYLINLAFVHTP → HTGYMEVDVGSLGDSSDHSVLPHANAARVSTVAL
     183-580: Missing.

Note: Major isoform, probably not functional. May be due to competing donor splice site.
Show »
Length:182
Mass (Da):19,496
Checksum:iC7D2F1DC0CA65A96
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei149 – 18234PARIR…FVHTP → HTGYMEVDVGSLGDSSDHSV LPHANAARVSTVAL in isoform 2. 1 PublicationVSP_043682Add
BLAST
Alternative sequencei183 – 580398Missing in isoform 2. 1 PublicationVSP_043683Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ973177 mRNA. Translation: CAJ00305.1.
AM778029 mRNA. Translation: CAO82752.1.
AC006068 Genomic DNA. Translation: AAD15441.1.
CP002685 Genomic DNA. Translation: AEC09155.1.
PIRiD84772.
RefSeqiNP_181117.1. NM_129132.1. [Q9ZQP6-1]
UniGeneiAt.50117.

Genome annotation databases

EnsemblPlantsiAT2G35740.1; AT2G35740.1; AT2G35740. [Q9ZQP6-1]
GeneIDi818146.
KEGGiath:AT2G35740.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ973177 mRNA. Translation: CAJ00305.1.
AM778029 mRNA. Translation: CAO82752.1.
AC006068 Genomic DNA. Translation: AAD15441.1.
CP002685 Genomic DNA. Translation: AEC09155.1.
PIRiD84772.
RefSeqiNP_181117.1. NM_129132.1. [Q9ZQP6-1]
UniGeneiAt.50117.

3D structure databases

ProteinModelPortaliQ9ZQP6.
SMRiQ9ZQP6. Positions 23-563.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi3702.AT2G35740.1.

Proteomic databases

PaxDbiQ9ZQP6.
PRIDEiQ9ZQP6.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblPlantsiAT2G35740.1; AT2G35740.1; AT2G35740. [Q9ZQP6-1]
GeneIDi818146.
KEGGiath:AT2G35740.

Organism-specific databases

TAIRiAT2G35740.

Phylogenomic databases

eggNOGiKOG0254. Eukaryota.
ENOG410XNQK. LUCA.
HOGENOMiHOG000202868.
InParanoidiQ9ZQP6.
KOiK08150.
OMAiISACGLM.
PhylomeDBiQ9ZQP6.

Enzyme and pathway databases

ReactomeiR-ATH-429593. Inositol transporters.

Miscellaneous databases

PROiQ9ZQP6.

Gene expression databases

GenevisibleiQ9ZQP6. AT.

Family and domain databases

InterProiIPR020846. MFS_dom.
IPR005828. MFS_sugar_transport_like.
IPR003663. Sugar/inositol_transpt.
IPR005829. Sugar_transporter_CS.
[Graphical view]
PfamiPF00083. Sugar_tr. 2 hits.
[Graphical view]
PRINTSiPR00171. SUGRTRNSPORT.
SUPFAMiSSF103473. SSF103473. 2 hits.
TIGRFAMsiTIGR00879. SP. 1 hit.
PROSITEiPS50850. MFS. 1 hit.
PS00216. SUGAR_TRANSPORT_1. 1 hit.
PS00217. SUGAR_TRANSPORT_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Arabidopsis INOSITOL TRANSPORTER4 mediates high-affinity H+ symport of myoinositol across the plasma membrane."
    Schneider S., Schneidereit A., Konrad K.R., Hajirezaei M.-R., Gramann M., Hedrich R., Sauer N.
    Plant Physiol. 141:565-577(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "Arabidopsis INOSITOL TRANSPORTER2 mediates H+ symport of different inositol epimers and derivatives across the plasma membrane."
    Schneider S., Schneidereit A., Udvardi P., Hammes U., Gramann M., Dietrich P., Sauer N.
    Plant Physiol. 145:1395-1407(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION.
    Strain: cv. Columbia.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: cv. Columbia.
  4. The Arabidopsis Information Resource (TAIR)
    Submitted (APR-2011) to the EMBL/GenBank/DDBJ databases
    Cited for: GENOME REANNOTATION.
    Strain: cv. Columbia.
  5. "The monosaccharide transporter gene family in land plants is ancient and shows differential subfamily expression and expansion across lineages."
    Johnson D.A., Hill J.P., Thomas M.A.
    BMC Evol. Biol. 6:64-64(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: GENE FAMILY.

Entry informationi

Entry nameiINT3_ARATH
AccessioniPrimary (citable) accession number: Q9ZQP6
Secondary accession number(s): A9JNR7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 28, 2006
Last sequence update: May 1, 1999
Last modified: February 17, 2016
This is version 105 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.