Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9ZPY2

- LAC6_ARATH

UniProt

Q9ZPY2 - LAC6_ARATH

Protein

Laccase-6

Gene

LAC6

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 96 (01 Oct 2014)
      Sequence version 1 (01 May 1999)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Lignin degradation and detoxification of lignin-derived products.By similarity

    Catalytic activityi

    4 benzenediol + O2 = 4 benzosemiquinone + 2 H2O.

    Cofactori

    Binds 4 copper ions per monomer.By similarity

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Metal bindingi87 – 871Copper 1; type 2By similarity
    Metal bindingi89 – 891Copper 2; type 3By similarity
    Metal bindingi132 – 1321Copper 2; type 3By similarity
    Metal bindingi134 – 1341Copper 3; type 3By similarity
    Metal bindingi472 – 4721Copper 4; type 1By similarity
    Metal bindingi475 – 4751Copper 1; type 2By similarity
    Metal bindingi477 – 4771Copper 3; type 3By similarity
    Metal bindingi532 – 5321Copper 3; type 3By similarity
    Metal bindingi533 – 5331Copper 4; type 1By similarity
    Metal bindingi534 – 5341Copper 2; type 3By similarity
    Metal bindingi538 – 5381Copper 4; type 1By similarity
    Metal bindingi543 – 5431Copper 4; type 1By similarity

    GO - Molecular functioni

    1. copper ion binding Source: InterPro
    2. hydroquinone:oxygen oxidoreductase activity Source: UniProtKB-EC

    GO - Biological processi

    1. lignin catabolic process Source: UniProtKB-KW

    Keywords - Molecular functioni

    Oxidoreductase

    Keywords - Biological processi

    Lignin degradation

    Keywords - Ligandi

    Copper, Metal-binding

    Enzyme and pathway databases

    BioCyciARA:AT2G46570-MONOMER.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Laccase-6 (EC:1.10.3.2)
    Alternative name(s):
    Benzenediol:oxygen oxidoreductase 6
    Diphenol oxidase 6
    Urishiol oxidase 6
    Gene namesi
    Name:LAC6
    Ordered Locus Names:At2g46570
    ORF Names:F13A10.10
    OrganismiArabidopsis thaliana (Mouse-ear cress)
    Taxonomic identifieri3702 [NCBI]
    Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
    ProteomesiUP000006548: Chromosome 2

    Organism-specific databases

    TAIRiAT2G46570.

    Subcellular locationi

    GO - Cellular componenti

    1. apoplast Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Apoplast, Secreted

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2929Sequence AnalysisAdd
    BLAST
    Chaini30 – 569540Laccase-6PRO_0000283634Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi83 – 831N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi208 – 2081N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi303 – 3031N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi319 – 3191N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi392 – 3921N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi438 – 4381N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi444 – 4441N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Glycoprotein

    Proteomic databases

    PaxDbiQ9ZPY2.
    PRIDEiQ9ZPY2.

    Expressioni

    Tissue specificityi

    Predominantly expressed in the inflorescence stem, but not in siliques.2 Publications

    Gene expression databases

    GenevestigatoriQ9ZPY2.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9ZPY2.
    SMRiQ9ZPY2. Positions 32-552.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini37 – 153117Plastocyanin-like 1Add
    BLAST
    Domaini163 – 315153Plastocyanin-like 2Add
    BLAST
    Domaini417 – 553137Plastocyanin-like 3Add
    BLAST

    Sequence similaritiesi

    Belongs to the multicopper oxidase family.Curated
    Contains 3 plastocyanin-like domains.Curated

    Keywords - Domaini

    Repeat, Signal

    Phylogenomic databases

    eggNOGiCOG2132.
    HOGENOMiHOG000241916.
    InParanoidiQ9ZPY2.
    OMAiAPNDIAN.
    PhylomeDBiQ9ZPY2.

    Family and domain databases

    Gene3Di2.60.40.420. 3 hits.
    InterProiIPR001117. Cu-oxidase.
    IPR011706. Cu-oxidase_2.
    IPR011707. Cu-oxidase_3.
    IPR002355. Cu_oxidase_Cu_BS.
    IPR008972. Cupredoxin.
    IPR017761. Laccase.
    [Graphical view]
    PfamiPF00394. Cu-oxidase. 1 hit.
    PF07731. Cu-oxidase_2. 1 hit.
    PF07732. Cu-oxidase_3. 1 hit.
    [Graphical view]
    SUPFAMiSSF49503. SSF49503. 3 hits.
    TIGRFAMsiTIGR03389. laccase. 1 hit.
    PROSITEiPS00079. MULTICOPPER_OXIDASE1. 1 hit.
    PS00080. MULTICOPPER_OXIDASE2. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9ZPY2-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MTSSAVPSLF RLSFLLFTLQ VMNIGRIGAA TRFYQFKVQT IRLTRLCQTN    50
    EIVTVNKKFP GPAISAQEDD RIVIKVINMT PYNTTIHWHG IKQKRSCWYD 100
    GPSYITQCPI QSGQSFTYNF KVAQQKGTFL WHAHFSWLRA TVYGPLIVYP 150
    KASVPYPFKK PFNEHTILLG EYWLKNVVEL EQHVLESGGP PPPADAFTIN 200
    GQPGPNYNCS SKDVYEIQIV PRKIYLLRLI NAGINMETFF TIANHRLTIV 250
    EVDGEYTKPY TTERVMLVPG QTMNILVTAD QTVGRYSMAM GPYESAKNVK 300
    FQNTSAIANF QYIGALPNNV TVPAKLPIFN DNIAVKTVMD GLRSLNAVDV 350
    PRNIDAHLFI TIGLNVNKCN SENPNNKCQG PRKGRLAASM NNISFIEPKV 400
    SILEAYYKQL EGYFTLDFPT TPEKAYDFVN GAPNDIANDT QAANGTRAIV 450
    FEYGSRIQII FQNTGTLTTE NHPIHLHGHS FYVIGYGTGN YDQQTAKFNL 500
    EDPPYLNTIG VPVGGWAAIR FVANNPGLWL LHCHFDIHQT WGMSTMFIVK 550
    NGKKVQESLP HPPADLPKC 569

    Note: No experimental confirmation available.

    Length:569
    Mass (Da):63,901
    Last modified:May 1, 1999 - v1
    Checksum:i3BA02CB6A0C44238
    GO
    Isoform 2 (identifier: Q9ZPY2-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-235: Missing.
         296-327: Missing.
         528-568: LWLLHCHFDIHQTWGMSTMFIVKNGKKVQESLPHPPADLPK → ILLHKTPKHHNTYDI

    Show »
    Length:276
    Mass (Da):30,742
    Checksum:i08DB7D61D8BB37B1
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 235235Missing in isoform 2. 1 PublicationVSP_024345Add
    BLAST
    Alternative sequencei296 – 32732Missing in isoform 2. 1 PublicationVSP_024346Add
    BLAST
    Alternative sequencei528 – 56841LWLLH…ADLPK → ILLHKTPKHHNTYDI in isoform 2. 1 PublicationVSP_024347Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AC006418 Genomic DNA. Translation: AAD20177.1.
    CP002685 Genomic DNA. Translation: AEC10723.1.
    AY078937 mRNA. Translation: AAL84943.1.
    PIRiE84904.
    RefSeqiNP_182180.1. NM_130222.1. [Q9ZPY2-1]
    UniGeneiAt.53141.

    Genome annotation databases

    EnsemblPlantsiAT2G46570.1; AT2G46570.1; AT2G46570. [Q9ZPY2-1]
    GeneIDi819269.
    KEGGiath:AT2G46570.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AC006418 Genomic DNA. Translation: AAD20177.1 .
    CP002685 Genomic DNA. Translation: AEC10723.1 .
    AY078937 mRNA. Translation: AAL84943.1 .
    PIRi E84904.
    RefSeqi NP_182180.1. NM_130222.1. [Q9ZPY2-1 ]
    UniGenei At.53141.

    3D structure databases

    ProteinModelPortali Q9ZPY2.
    SMRi Q9ZPY2. Positions 32-552.
    ModBasei Search...
    MobiDBi Search...

    Proteomic databases

    PaxDbi Q9ZPY2.
    PRIDEi Q9ZPY2.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    EnsemblPlantsi AT2G46570.1 ; AT2G46570.1 ; AT2G46570 . [Q9ZPY2-1 ]
    GeneIDi 819269.
    KEGGi ath:AT2G46570.

    Organism-specific databases

    TAIRi AT2G46570.

    Phylogenomic databases

    eggNOGi COG2132.
    HOGENOMi HOG000241916.
    InParanoidi Q9ZPY2.
    OMAi APNDIAN.
    PhylomeDBi Q9ZPY2.

    Enzyme and pathway databases

    BioCyci ARA:AT2G46570-MONOMER.

    Gene expression databases

    Genevestigatori Q9ZPY2.

    Family and domain databases

    Gene3Di 2.60.40.420. 3 hits.
    InterProi IPR001117. Cu-oxidase.
    IPR011706. Cu-oxidase_2.
    IPR011707. Cu-oxidase_3.
    IPR002355. Cu_oxidase_Cu_BS.
    IPR008972. Cupredoxin.
    IPR017761. Laccase.
    [Graphical view ]
    Pfami PF00394. Cu-oxidase. 1 hit.
    PF07731. Cu-oxidase_2. 1 hit.
    PF07732. Cu-oxidase_3. 1 hit.
    [Graphical view ]
    SUPFAMi SSF49503. SSF49503. 3 hits.
    TIGRFAMsi TIGR03389. laccase. 1 hit.
    PROSITEi PS00079. MULTICOPPER_OXIDASE1. 1 hit.
    PS00080. MULTICOPPER_OXIDASE2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: cv. Columbia.
    2. The Arabidopsis Information Resource (TAIR)
      Submitted (APR-2011) to the EMBL/GenBank/DDBJ databases
      Cited for: GENOME REANNOTATION.
      Strain: cv. Columbia.
    3. "Empirical analysis of transcriptional activity in the Arabidopsis genome."
      Yamada K., Lim J., Dale J.M., Chen H., Shinn P., Palm C.J., Southwick A.M., Wu H.C., Kim C.J., Nguyen M., Pham P.K., Cheuk R.F., Karlin-Newmann G., Liu S.X., Lam B., Sakano H., Wu T., Yu G.
      , Miranda M., Quach H.L., Tripp M., Chang C.H., Lee J.M., Toriumi M.J., Chan M.M., Tang C.C., Onodera C.S., Deng J.M., Akiyama K., Ansari Y., Arakawa T., Banh J., Banno F., Bowser L., Brooks S.Y., Carninci P., Chao Q., Choy N., Enju A., Goldsmith A.D., Gurjal M., Hansen N.F., Hayashizaki Y., Johnson-Hopson C., Hsuan V.W., Iida K., Karnes M., Khan S., Koesema E., Ishida J., Jiang P.X., Jones T., Kawai J., Kamiya A., Meyers C., Nakajima M., Narusaka M., Seki M., Sakurai T., Satou M., Tamse R., Vaysberg M., Wallender E.K., Wong C., Yamamura Y., Yuan S., Shinozaki K., Davis R.W., Theologis A., Ecker J.R.
      Science 302:842-846(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Strain: cv. Columbia.
    4. "Gene structure and molecular analysis of the laccase-like multicopper oxidase (LMCO) gene family in Arabidopsis thaliana."
      McCaig B.C., Meagher R.B., Dean J.F.D.
      Planta 221:619-636(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY.
    5. "Mutant identification and characterization of the laccase gene family in Arabidopsis."
      Cai X., Davis E.J., Ballif J., Liang M., Bushman E., Haroldsen V., Torabinejad J., Wu Y.
      J. Exp. Bot. 57:2563-2569(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY.

    Entry informationi

    Entry nameiLAC6_ARATH
    AccessioniPrimary (citable) accession number: Q9ZPY2
    Secondary accession number(s): Q8RY28
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: April 3, 2007
    Last sequence update: May 1, 1999
    Last modified: October 1, 2014
    This is version 96 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programPlant Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Arabidopsis thaliana
      Arabidopsis thaliana: entries and gene names
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3