Reviewed,
UniProtKB/Swiss-Prot Q9ZPY2 (LAC6_ARATH)
Last modified
February 9, 2010.
Version 59.
History...
Clusters with 100%,
90%,
50% identity |
Documents (2) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Laccase-6 EC=1.10.3.2 Alternative name(s): Benzenediol:oxygen oxidoreductase 6 Urishiol oxidase 6 Diphenol oxidase 6 | ||||||
| Gene names |
| ||||||
| Organism | Arabidopsis thaliana (Mouse-ear cress) [Complete proteome] | ||||||
| Taxonomic identifier | 3702 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Viridiplantae › Streptophyta › Embryophyta › Tracheophyta › Spermatophyta › Magnoliophyta › eudicotyledons › core eudicotyledons › rosids › malvids › Brassicales › Brassicaceae › Arabidopsis |
Protein attributes
| Sequence length | 569 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level. |
General annotation (Comments)
| Function | Lignin degradation and detoxification of lignin-derived products By similarity. |
| Catalytic activity | 4 benzenediol + O2 = 4 benzosemiquinone + 2 H2O. |
| Cofactor | Binds 4 copper ions per monomer By similarity. |
| Subcellular location | Secreted › extracellular space › apoplast Potential. |
| Tissue specificity | Predominantly expressed in the inflorescence stem, but not in siliques. Ref.3 Ref.4 |
| Sequence similarities | Belongs to the multicopper oxidase family. Contains 3 plastocyanin-like domains. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Lignin degradation |
| Cellular component | Apoplast Secreted |
| Coding sequence diversity | Alternative splicing |
| Domain | Repeat Signal |
| Ligand | Copper Metal-binding |
| Molecular function | Oxidoreductase |
| PTM | Glycoprotein |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Biological process | lignin catabolic process Inferred from electronic annotation. Source: UniProtKB-KW oxidation reductionInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | apoplast Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | copper ion binding Inferred from electronic annotation. Source: UniProtKB-KW laccase activityInferred from electronic annotation. Source: EC |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9ZPY2-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 2 (identifier: Q9ZPY2-2) The sequence of this isoform differs from the canonical sequence as follows: 1-235: Missing. 296-327: Missing. 528-568: LWLLHCHFDIHQTWGMSTMFIVKNGKKVQESLPHPPADLPK → ILLHKTPKHHNTYDI |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 29 | 29 | Potential | ||||||
| Chain | 30 – 569 | 540 | Laccase-6 | PRO_0000283634 | |||||
Regions | |||||||||
| Domain | 37 – 153 | 117 | Plastocyanin-like 1 | ||||||
| Domain | 163 – 315 | 153 | Plastocyanin-like 2 | ||||||
| Domain | 417 – 553 | 137 | Plastocyanin-like 3 | ||||||
Sites | |||||||||
| Metal binding | 87 | 1 | Copper 1; type 2 By similarity | ||||||
| Metal binding | 89 | 1 | Copper 2; type 3 By similarity | ||||||
| Metal binding | 132 | 1 | Copper 2; type 3 By similarity | ||||||
| Metal binding | 134 | 1 | Copper 3; type 3 By similarity | ||||||
| Metal binding | 472 | 1 | Copper 4; type 1 By similarity | ||||||
| Metal binding | 475 | 1 | Copper 1; type 2 By similarity | ||||||
| Metal binding | 477 | 1 | Copper 3; type 3 By similarity | ||||||
| Metal binding | 532 | 1 | Copper 3; type 3 By similarity | ||||||
| Metal binding | 533 | 1 | Copper 4; type 1 By similarity | ||||||
| Metal binding | 534 | 1 | Copper 2; type 3 By similarity | ||||||
| Metal binding | 538 | 1 | Copper 4; type 1 By similarity | ||||||
| Metal binding | 543 | 1 | Copper 4; type 1 By similarity | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 83 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 208 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 303 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 319 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 392 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 438 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 444 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 235 | 235 | Missing in isoform 2. | VSP_024345 | |||||
| Alternative sequence | 296 – 327 | 32 | Missing in isoform 2. | VSP_024346 | |||||
| Alternative sequence | 528 – 568 | 41 | LWLLH…ADLPK → ILLHKTPKHHNTYDI in isoform 2. | VSP_024347 | |||||
Sequences
| ||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AC006418 Genomic DNA. Translation: AAD20177.1. AY078937 mRNA. Translation: AAL84943.1. |
| IPI | IPI00536099. IPI00845129. |
| PIR | E84904. |
| RefSeq | NP_182180.1. |
| UniGene | At.53141 |
3D structure databases | |
| HSSP | HSSP built from PDB template 1AOZ based on UniProtKB P37064. |
| ModBase | Search... |
Genome annotation databases | |
| GeneID | 819269. |
| GenomeReviews | Gene locus AT2G46570 in contig CT485783_GR. |
| KEGG | ath:AT2G46570. |
| NMPDR | fig|3702.1.peg.11842. |
Organism-specific databases | |
| TAIR | At2g46570. |
Phylogenomic databases | |
| eggNOG | KOG1263. |
| HOGENOM | HBG749556. |
| InParanoid | Q9ZPY2. |
| OMA | MNNISFI. |
| PhylomeDB | Q9ZPY2. |
Enzyme and pathway databases | |
| BRENDA | 1.10.3.2. 302. |
Gene expression databases | |
| ArrayExpress | Q9ZPY2. |
| Genevestigator | Q9ZPY2. |
Family and domain databases | |
| InterPro | IPR001117. Cu-oxidase. IPR011706. Cu-oxidase_2. IPR011707. Cu-oxidase_3. IPR002355. Cu_oxidase_Cu_BS. IPR008972. Cupredoxin. IPR017761. Laccase. [Graphical view] |
| Gene3D | G3DSA:2.60.40.420. Cupredoxin. 3 hits. |
| Pfam | PF00394. Cu-oxidase. 1 hit. PF07731. Cu-oxidase_2. 1 hit. PF07732. Cu-oxidase_3. 1 hit. [Graphical view] |
| TIGRFAMs | TIGR03389. laccase. 1 hit. |
| PROSITE | PS00079. MULTICOPPER_OXIDASE1. 1 hit. PS00080. MULTICOPPER_OXIDASE2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Entry information
| Entry name | LAC6_ARATH | ||||||||
| Accession | Primary (citable) accession number: Q9ZPY2 Secondary accession number(s): Q8RY28 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | PPAP (Plant Proteome Annotation Project) | ||||||||
Relevant documents
| Arabidopsis thaliana Arabidopsis thaliana: entries and gene names |
| SIMILARITY comments Index of protein domains and families |

Clusters with


