Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9ZPY2

- LAC6_ARATH

UniProt

Q9ZPY2 - LAC6_ARATH

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Laccase-6

Gene

LAC6

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli

Functioni

Lignin degradation and detoxification of lignin-derived products.By similarity

Catalytic activityi

4 benzenediol + O2 = 4 benzosemiquinone + 2 H2O.

Cofactori

Cu cationBy similarityNote: Binds 4 Cu cations per monomer.By similarity

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi87 – 871Copper 1; type 2By similarity
Metal bindingi89 – 891Copper 2; type 3By similarity
Metal bindingi132 – 1321Copper 2; type 3By similarity
Metal bindingi134 – 1341Copper 3; type 3By similarity
Metal bindingi472 – 4721Copper 4; type 1By similarity
Metal bindingi475 – 4751Copper 1; type 2By similarity
Metal bindingi477 – 4771Copper 3; type 3By similarity
Metal bindingi532 – 5321Copper 3; type 3By similarity
Metal bindingi533 – 5331Copper 4; type 1By similarity
Metal bindingi534 – 5341Copper 2; type 3By similarity
Metal bindingi538 – 5381Copper 4; type 1By similarity
Metal bindingi543 – 5431Copper 4; type 1By similarity

GO - Molecular functioni

  1. copper ion binding Source: InterPro
  2. hydroquinone:oxygen oxidoreductase activity Source: UniProtKB-EC

GO - Biological processi

  1. lignin catabolic process Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Oxidoreductase

Keywords - Biological processi

Lignin degradation

Keywords - Ligandi

Copper, Metal-binding

Enzyme and pathway databases

BioCyciARA:AT2G46570-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Laccase-6 (EC:1.10.3.2)
Alternative name(s):
Benzenediol:oxygen oxidoreductase 6
Diphenol oxidase 6
Urishiol oxidase 6
Gene namesi
Name:LAC6
Ordered Locus Names:At2g46570
ORF Names:F13A10.10
OrganismiArabidopsis thaliana (Mouse-ear cress)
Taxonomic identifieri3702 [NCBI]
Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
ProteomesiUP000006548: Chromosome 2

Organism-specific databases

TAIRiAT2G46570.

Subcellular locationi

GO - Cellular componenti

  1. apoplast Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Apoplast, Secreted

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2929Sequence AnalysisAdd
BLAST
Chaini30 – 569540Laccase-6PRO_0000283634Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi83 – 831N-linked (GlcNAc...)Sequence Analysis
Glycosylationi208 – 2081N-linked (GlcNAc...)Sequence Analysis
Glycosylationi303 – 3031N-linked (GlcNAc...)Sequence Analysis
Glycosylationi319 – 3191N-linked (GlcNAc...)Sequence Analysis
Glycosylationi392 – 3921N-linked (GlcNAc...)Sequence Analysis
Glycosylationi438 – 4381N-linked (GlcNAc...)Sequence Analysis
Glycosylationi444 – 4441N-linked (GlcNAc...)Sequence Analysis

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ9ZPY2.
PRIDEiQ9ZPY2.

Expressioni

Tissue specificityi

Predominantly expressed in the inflorescence stem, but not in siliques.2 Publications

Gene expression databases

GenevestigatoriQ9ZPY2.

Structurei

3D structure databases

ProteinModelPortaliQ9ZPY2.
SMRiQ9ZPY2. Positions 32-552.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini37 – 153117Plastocyanin-like 1Add
BLAST
Domaini163 – 315153Plastocyanin-like 2Add
BLAST
Domaini417 – 553137Plastocyanin-like 3Add
BLAST

Sequence similaritiesi

Belongs to the multicopper oxidase family.Curated
Contains 3 plastocyanin-like domains.Curated

Keywords - Domaini

Repeat, Signal

Phylogenomic databases

eggNOGiCOG2132.
HOGENOMiHOG000241916.
InParanoidiQ9ZPY2.
OMAiAPNDIAN.
PhylomeDBiQ9ZPY2.

Family and domain databases

Gene3Di2.60.40.420. 3 hits.
InterProiIPR001117. Cu-oxidase.
IPR011706. Cu-oxidase_2.
IPR011707. Cu-oxidase_3.
IPR002355. Cu_oxidase_Cu_BS.
IPR008972. Cupredoxin.
IPR017761. Laccase.
[Graphical view]
PfamiPF00394. Cu-oxidase. 1 hit.
PF07731. Cu-oxidase_2. 1 hit.
PF07732. Cu-oxidase_3. 1 hit.
[Graphical view]
SUPFAMiSSF49503. SSF49503. 3 hits.
TIGRFAMsiTIGR03389. laccase. 1 hit.
PROSITEiPS00079. MULTICOPPER_OXIDASE1. 1 hit.
PS00080. MULTICOPPER_OXIDASE2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9ZPY2-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTSSAVPSLF RLSFLLFTLQ VMNIGRIGAA TRFYQFKVQT IRLTRLCQTN
60 70 80 90 100
EIVTVNKKFP GPAISAQEDD RIVIKVINMT PYNTTIHWHG IKQKRSCWYD
110 120 130 140 150
GPSYITQCPI QSGQSFTYNF KVAQQKGTFL WHAHFSWLRA TVYGPLIVYP
160 170 180 190 200
KASVPYPFKK PFNEHTILLG EYWLKNVVEL EQHVLESGGP PPPADAFTIN
210 220 230 240 250
GQPGPNYNCS SKDVYEIQIV PRKIYLLRLI NAGINMETFF TIANHRLTIV
260 270 280 290 300
EVDGEYTKPY TTERVMLVPG QTMNILVTAD QTVGRYSMAM GPYESAKNVK
310 320 330 340 350
FQNTSAIANF QYIGALPNNV TVPAKLPIFN DNIAVKTVMD GLRSLNAVDV
360 370 380 390 400
PRNIDAHLFI TIGLNVNKCN SENPNNKCQG PRKGRLAASM NNISFIEPKV
410 420 430 440 450
SILEAYYKQL EGYFTLDFPT TPEKAYDFVN GAPNDIANDT QAANGTRAIV
460 470 480 490 500
FEYGSRIQII FQNTGTLTTE NHPIHLHGHS FYVIGYGTGN YDQQTAKFNL
510 520 530 540 550
EDPPYLNTIG VPVGGWAAIR FVANNPGLWL LHCHFDIHQT WGMSTMFIVK
560
NGKKVQESLP HPPADLPKC

Note: No experimental confirmation available.

Length:569
Mass (Da):63,901
Last modified:May 1, 1999 - v1
Checksum:i3BA02CB6A0C44238
GO
Isoform 2 (identifier: Q9ZPY2-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-235: Missing.
     296-327: Missing.
     528-568: LWLLHCHFDIHQTWGMSTMFIVKNGKKVQESLPHPPADLPK → ILLHKTPKHHNTYDI

Show »
Length:276
Mass (Da):30,742
Checksum:i08DB7D61D8BB37B1
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 235235Missing in isoform 2. 1 PublicationVSP_024345Add
BLAST
Alternative sequencei296 – 32732Missing in isoform 2. 1 PublicationVSP_024346Add
BLAST
Alternative sequencei528 – 56841LWLLH…ADLPK → ILLHKTPKHHNTYDI in isoform 2. 1 PublicationVSP_024347Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC006418 Genomic DNA. Translation: AAD20177.1.
CP002685 Genomic DNA. Translation: AEC10723.1.
AY078937 mRNA. Translation: AAL84943.1.
PIRiE84904.
RefSeqiNP_182180.1. NM_130222.1. [Q9ZPY2-1]
UniGeneiAt.53141.

Genome annotation databases

EnsemblPlantsiAT2G46570.1; AT2G46570.1; AT2G46570. [Q9ZPY2-1]
GeneIDi819269.
KEGGiath:AT2G46570.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC006418 Genomic DNA. Translation: AAD20177.1 .
CP002685 Genomic DNA. Translation: AEC10723.1 .
AY078937 mRNA. Translation: AAL84943.1 .
PIRi E84904.
RefSeqi NP_182180.1. NM_130222.1. [Q9ZPY2-1 ]
UniGenei At.53141.

3D structure databases

ProteinModelPortali Q9ZPY2.
SMRi Q9ZPY2. Positions 32-552.
ModBasei Search...
MobiDBi Search...

Proteomic databases

PaxDbi Q9ZPY2.
PRIDEi Q9ZPY2.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

EnsemblPlantsi AT2G46570.1 ; AT2G46570.1 ; AT2G46570 . [Q9ZPY2-1 ]
GeneIDi 819269.
KEGGi ath:AT2G46570.

Organism-specific databases

TAIRi AT2G46570.

Phylogenomic databases

eggNOGi COG2132.
HOGENOMi HOG000241916.
InParanoidi Q9ZPY2.
OMAi APNDIAN.
PhylomeDBi Q9ZPY2.

Enzyme and pathway databases

BioCyci ARA:AT2G46570-MONOMER.

Gene expression databases

Genevestigatori Q9ZPY2.

Family and domain databases

Gene3Di 2.60.40.420. 3 hits.
InterProi IPR001117. Cu-oxidase.
IPR011706. Cu-oxidase_2.
IPR011707. Cu-oxidase_3.
IPR002355. Cu_oxidase_Cu_BS.
IPR008972. Cupredoxin.
IPR017761. Laccase.
[Graphical view ]
Pfami PF00394. Cu-oxidase. 1 hit.
PF07731. Cu-oxidase_2. 1 hit.
PF07732. Cu-oxidase_3. 1 hit.
[Graphical view ]
SUPFAMi SSF49503. SSF49503. 3 hits.
TIGRFAMsi TIGR03389. laccase. 1 hit.
PROSITEi PS00079. MULTICOPPER_OXIDASE1. 1 hit.
PS00080. MULTICOPPER_OXIDASE2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: cv. Columbia.
  2. The Arabidopsis Information Resource (TAIR)
    Submitted (APR-2011) to the EMBL/GenBank/DDBJ databases
    Cited for: GENOME REANNOTATION.
    Strain: cv. Columbia.
  3. "Empirical analysis of transcriptional activity in the Arabidopsis genome."
    Yamada K., Lim J., Dale J.M., Chen H., Shinn P., Palm C.J., Southwick A.M., Wu H.C., Kim C.J., Nguyen M., Pham P.K., Cheuk R.F., Karlin-Newmann G., Liu S.X., Lam B., Sakano H., Wu T., Yu G.
    , Miranda M., Quach H.L., Tripp M., Chang C.H., Lee J.M., Toriumi M.J., Chan M.M., Tang C.C., Onodera C.S., Deng J.M., Akiyama K., Ansari Y., Arakawa T., Banh J., Banno F., Bowser L., Brooks S.Y., Carninci P., Chao Q., Choy N., Enju A., Goldsmith A.D., Gurjal M., Hansen N.F., Hayashizaki Y., Johnson-Hopson C., Hsuan V.W., Iida K., Karnes M., Khan S., Koesema E., Ishida J., Jiang P.X., Jones T., Kawai J., Kamiya A., Meyers C., Nakajima M., Narusaka M., Seki M., Sakurai T., Satou M., Tamse R., Vaysberg M., Wallender E.K., Wong C., Yamamura Y., Yuan S., Shinozaki K., Davis R.W., Theologis A., Ecker J.R.
    Science 302:842-846(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Strain: cv. Columbia.
  4. "Gene structure and molecular analysis of the laccase-like multicopper oxidase (LMCO) gene family in Arabidopsis thaliana."
    McCaig B.C., Meagher R.B., Dean J.F.D.
    Planta 221:619-636(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.
  5. "Mutant identification and characterization of the laccase gene family in Arabidopsis."
    Cai X., Davis E.J., Ballif J., Liang M., Bushman E., Haroldsen V., Torabinejad J., Wu Y.
    J. Exp. Bot. 57:2563-2569(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.

Entry informationi

Entry nameiLAC6_ARATH
AccessioniPrimary (citable) accession number: Q9ZPY2
Secondary accession number(s): Q8RY28
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 3, 2007
Last sequence update: May 1, 1999
Last modified: November 26, 2014
This is version 98 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3