Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Laccase-6

Gene

LAC6

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

Lignin degradation and detoxification of lignin-derived products.By similarity

Catalytic activityi

4 benzenediol + O2 = 4 benzosemiquinone + 2 H2O.

Cofactori

Cu cationBy similarityNote: Binds 4 Cu cations per monomer.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi87Copper 1; type 2By similarity1
Metal bindingi89Copper 2; type 3By similarity1
Metal bindingi132Copper 2; type 3By similarity1
Metal bindingi134Copper 3; type 3By similarity1
Metal bindingi472Copper 4; type 1By similarity1
Metal bindingi475Copper 1; type 2By similarity1
Metal bindingi477Copper 3; type 3By similarity1
Metal bindingi532Copper 3; type 3By similarity1
Metal bindingi533Copper 4; type 1By similarity1
Metal bindingi534Copper 2; type 3By similarity1
Metal bindingi538Copper 4; type 1By similarity1
Metal bindingi543Copper 4; type 1By similarity1

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Oxidoreductase

Keywords - Biological processi

Lignin degradation

Keywords - Ligandi

Copper, Metal-binding

Enzyme and pathway databases

BioCyciARA:AT2G46570-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Laccase-6 (EC:1.10.3.2)
Alternative name(s):
Benzenediol:oxygen oxidoreductase 6
Diphenol oxidase 6
Urishiol oxidase 6
Gene namesi
Name:LAC6
Ordered Locus Names:At2g46570
ORF Names:F13A10.10
OrganismiArabidopsis thaliana (Mouse-ear cress)
Taxonomic identifieri3702 [NCBI]
Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
Proteomesi
  • UP000006548 Componenti: Chromosome 2

Organism-specific databases

TAIRiAT2G46570.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Apoplast, Secreted

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 29Sequence analysisAdd BLAST29
ChainiPRO_000028363430 – 569Laccase-6Add BLAST540

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi83N-linked (GlcNAc...)Sequence analysis1
Glycosylationi208N-linked (GlcNAc...)Sequence analysis1
Glycosylationi303N-linked (GlcNAc...)Sequence analysis1
Glycosylationi319N-linked (GlcNAc...)Sequence analysis1
Glycosylationi392N-linked (GlcNAc...)Sequence analysis1
Glycosylationi438N-linked (GlcNAc...)Sequence analysis1
Glycosylationi444N-linked (GlcNAc...)Sequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ9ZPY2.
PRIDEiQ9ZPY2.

Expressioni

Tissue specificityi

Predominantly expressed in the inflorescence stem, but not in siliques.2 Publications

Gene expression databases

GenevisibleiQ9ZPY2. AT.

Interactioni

Protein-protein interaction databases

STRINGi3702.AT2G46570.1.

Structurei

3D structure databases

ProteinModelPortaliQ9ZPY2.
SMRiQ9ZPY2.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini37 – 153Plastocyanin-like 1Add BLAST117
Domaini163 – 315Plastocyanin-like 2Add BLAST153
Domaini417 – 553Plastocyanin-like 3Add BLAST137

Sequence similaritiesi

Belongs to the multicopper oxidase family.Curated
Contains 3 plastocyanin-like domains.Curated

Keywords - Domaini

Repeat, Signal

Phylogenomic databases

eggNOGiKOG1263. Eukaryota.
COG2132. LUCA.
HOGENOMiHOG000241916.
InParanoidiQ9ZPY2.
KOiK05909.
OMAiAPNDIAN.
OrthoDBiEOG09360618.
PhylomeDBiQ9ZPY2.

Family and domain databases

Gene3Di2.60.40.420. 3 hits.
InterProiIPR001117. Cu-oxidase.
IPR011706. Cu-oxidase_2.
IPR011707. Cu-oxidase_3.
IPR033138. Cu_oxidase_CS.
IPR002355. Cu_oxidase_Cu_BS.
IPR008972. Cupredoxin.
IPR017761. Laccase.
[Graphical view]
PfamiPF00394. Cu-oxidase. 1 hit.
PF07731. Cu-oxidase_2. 1 hit.
PF07732. Cu-oxidase_3. 1 hit.
[Graphical view]
SUPFAMiSSF49503. SSF49503. 3 hits.
TIGRFAMsiTIGR03389. laccase. 1 hit.
PROSITEiPS00079. MULTICOPPER_OXIDASE1. 1 hit.
PS00080. MULTICOPPER_OXIDASE2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9ZPY2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTSSAVPSLF RLSFLLFTLQ VMNIGRIGAA TRFYQFKVQT IRLTRLCQTN
60 70 80 90 100
EIVTVNKKFP GPAISAQEDD RIVIKVINMT PYNTTIHWHG IKQKRSCWYD
110 120 130 140 150
GPSYITQCPI QSGQSFTYNF KVAQQKGTFL WHAHFSWLRA TVYGPLIVYP
160 170 180 190 200
KASVPYPFKK PFNEHTILLG EYWLKNVVEL EQHVLESGGP PPPADAFTIN
210 220 230 240 250
GQPGPNYNCS SKDVYEIQIV PRKIYLLRLI NAGINMETFF TIANHRLTIV
260 270 280 290 300
EVDGEYTKPY TTERVMLVPG QTMNILVTAD QTVGRYSMAM GPYESAKNVK
310 320 330 340 350
FQNTSAIANF QYIGALPNNV TVPAKLPIFN DNIAVKTVMD GLRSLNAVDV
360 370 380 390 400
PRNIDAHLFI TIGLNVNKCN SENPNNKCQG PRKGRLAASM NNISFIEPKV
410 420 430 440 450
SILEAYYKQL EGYFTLDFPT TPEKAYDFVN GAPNDIANDT QAANGTRAIV
460 470 480 490 500
FEYGSRIQII FQNTGTLTTE NHPIHLHGHS FYVIGYGTGN YDQQTAKFNL
510 520 530 540 550
EDPPYLNTIG VPVGGWAAIR FVANNPGLWL LHCHFDIHQT WGMSTMFIVK
560
NGKKVQESLP HPPADLPKC
Note: No experimental confirmation available.
Length:569
Mass (Da):63,901
Last modified:May 1, 1999 - v1
Checksum:i3BA02CB6A0C44238
GO
Isoform 2 (identifier: Q9ZPY2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-235: Missing.
     296-327: Missing.
     528-568: LWLLHCHFDIHQTWGMSTMFIVKNGKKVQESLPHPPADLPK → ILLHKTPKHHNTYDI

Show »
Length:276
Mass (Da):30,742
Checksum:i08DB7D61D8BB37B1
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0243451 – 235Missing in isoform 2. 1 PublicationAdd BLAST235
Alternative sequenceiVSP_024346296 – 327Missing in isoform 2. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_024347528 – 568LWLLH…ADLPK → ILLHKTPKHHNTYDI in isoform 2. 1 PublicationAdd BLAST41

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC006418 Genomic DNA. Translation: AAD20177.1.
CP002685 Genomic DNA. Translation: AEC10723.1.
AY078937 mRNA. Translation: AAL84943.1.
PIRiE84904.
RefSeqiNP_182180.1. NM_130222.2. [Q9ZPY2-1]

Genome annotation databases

EnsemblPlantsiAT2G46570.1; AT2G46570.1; AT2G46570. [Q9ZPY2-1]
GeneIDi819269.
GrameneiAT2G46570.1; AT2G46570.1; AT2G46570.
KEGGiath:AT2G46570.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC006418 Genomic DNA. Translation: AAD20177.1.
CP002685 Genomic DNA. Translation: AEC10723.1.
AY078937 mRNA. Translation: AAL84943.1.
PIRiE84904.
RefSeqiNP_182180.1. NM_130222.2. [Q9ZPY2-1]

3D structure databases

ProteinModelPortaliQ9ZPY2.
SMRiQ9ZPY2.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi3702.AT2G46570.1.

Proteomic databases

PaxDbiQ9ZPY2.
PRIDEiQ9ZPY2.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblPlantsiAT2G46570.1; AT2G46570.1; AT2G46570. [Q9ZPY2-1]
GeneIDi819269.
GrameneiAT2G46570.1; AT2G46570.1; AT2G46570.
KEGGiath:AT2G46570.

Organism-specific databases

TAIRiAT2G46570.

Phylogenomic databases

eggNOGiKOG1263. Eukaryota.
COG2132. LUCA.
HOGENOMiHOG000241916.
InParanoidiQ9ZPY2.
KOiK05909.
OMAiAPNDIAN.
OrthoDBiEOG09360618.
PhylomeDBiQ9ZPY2.

Enzyme and pathway databases

BioCyciARA:AT2G46570-MONOMER.

Miscellaneous databases

PROiQ9ZPY2.

Gene expression databases

GenevisibleiQ9ZPY2. AT.

Family and domain databases

Gene3Di2.60.40.420. 3 hits.
InterProiIPR001117. Cu-oxidase.
IPR011706. Cu-oxidase_2.
IPR011707. Cu-oxidase_3.
IPR033138. Cu_oxidase_CS.
IPR002355. Cu_oxidase_Cu_BS.
IPR008972. Cupredoxin.
IPR017761. Laccase.
[Graphical view]
PfamiPF00394. Cu-oxidase. 1 hit.
PF07731. Cu-oxidase_2. 1 hit.
PF07732. Cu-oxidase_3. 1 hit.
[Graphical view]
SUPFAMiSSF49503. SSF49503. 3 hits.
TIGRFAMsiTIGR03389. laccase. 1 hit.
PROSITEiPS00079. MULTICOPPER_OXIDASE1. 1 hit.
PS00080. MULTICOPPER_OXIDASE2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiLAC6_ARATH
AccessioniPrimary (citable) accession number: Q9ZPY2
Secondary accession number(s): Q8RY28
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 3, 2007
Last sequence update: May 1, 1999
Last modified: November 30, 2016
This is version 109 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.