Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Laccase-6

Gene

LAC6

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Lignin degradation and detoxification of lignin-derived products.By similarity

Catalytic activityi

4 benzenediol + O2 = 4 benzosemiquinone + 2 H2O.

Cofactori

Cu cationBy similarityNote: Binds 4 Cu cations per monomer.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi87Copper 1; type 2By similarity1
Metal bindingi89Copper 2; type 3By similarity1
Metal bindingi132Copper 2; type 3By similarity1
Metal bindingi134Copper 3; type 3By similarity1
Metal bindingi472Copper 4; type 1By similarity1
Metal bindingi475Copper 1; type 2By similarity1
Metal bindingi477Copper 3; type 3By similarity1
Metal bindingi532Copper 3; type 3By similarity1
Metal bindingi533Copper 4; type 1By similarity1
Metal bindingi534Copper 2; type 3By similarity1
Metal bindingi538Copper 4; type 1By similarity1
Metal bindingi543Copper 4; type 1By similarity1

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionOxidoreductase
Biological processLignin degradation
LigandCopper, Metal-binding

Enzyme and pathway databases

BioCyciARA:AT2G46570-MONOMER

Names & Taxonomyi

Protein namesi
Recommended name:
Laccase-6 (EC:1.10.3.2)
Alternative name(s):
Benzenediol:oxygen oxidoreductase 6
Diphenol oxidase 6
Urishiol oxidase 6
Gene namesi
Name:LAC6
Ordered Locus Names:At2g46570
ORF Names:F13A10.10
OrganismiArabidopsis thaliana (Mouse-ear cress)
Taxonomic identifieri3702 [NCBI]
Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
Proteomesi
  • UP000006548 Componenti: Chromosome 2

Organism-specific databases

AraportiAT2G46570
TAIRilocus:2039944 AT2G46570

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cell wall Cytoskeleton Vacuole Chloroplast Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertion Graphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Apoplast, Secreted

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 29Sequence analysisAdd BLAST29
ChainiPRO_000028363430 – 569Laccase-6Add BLAST540

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi83N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi208N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi303N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi319N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi392N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi438N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi444N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ9ZPY2
PRIDEiQ9ZPY2

Expressioni

Tissue specificityi

Predominantly expressed in the inflorescence stem, but not in siliques.2 Publications

Gene expression databases

ExpressionAtlasiQ9ZPY2 baseline and differential
GenevisibleiQ9ZPY2 AT

Interactioni

Protein-protein interaction databases

STRINGi3702.AT2G46570.1

Structurei

3D structure databases

ProteinModelPortaliQ9ZPY2
SMRiQ9ZPY2
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini37 – 153Plastocyanin-like 1Add BLAST117
Domaini163 – 315Plastocyanin-like 2Add BLAST153
Domaini417 – 553Plastocyanin-like 3Add BLAST137

Sequence similaritiesi

Belongs to the multicopper oxidase family.Curated

Keywords - Domaini

Repeat, Signal

Phylogenomic databases

eggNOGiKOG1263 Eukaryota
COG2132 LUCA
HOGENOMiHOG000241916
InParanoidiQ9ZPY2
KOiK05909
OMAiLKFYDFV
OrthoDBiEOG09360618
PhylomeDBiQ9ZPY2

Family and domain databases

CDDicd13849 CuRO_1_LCC_plant, 1 hit
cd13875 CuRO_2_LCC_plant, 1 hit
cd13897 CuRO_3_LCC_plant, 1 hit
Gene3Di2.60.40.420, 3 hits
InterProiView protein in InterPro
IPR001117 Cu-oxidase
IPR011706 Cu-oxidase_2
IPR011707 Cu-oxidase_3
IPR033138 Cu_oxidase_CS
IPR002355 Cu_oxidase_Cu_BS
IPR008972 Cupredoxin
IPR034288 CuRO_1_LCC
IPR034285 CuRO_2_LCC
IPR034289 CuRO_3_LCC
IPR017761 Laccase
PfamiView protein in Pfam
PF00394 Cu-oxidase, 1 hit
PF07731 Cu-oxidase_2, 1 hit
PF07732 Cu-oxidase_3, 1 hit
SUPFAMiSSF49503 SSF49503, 3 hits
TIGRFAMsiTIGR03389 laccase, 1 hit
PROSITEiView protein in PROSITE
PS00079 MULTICOPPER_OXIDASE1, 1 hit
PS00080 MULTICOPPER_OXIDASE2, 1 hit

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9ZPY2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTSSAVPSLF RLSFLLFTLQ VMNIGRIGAA TRFYQFKVQT IRLTRLCQTN
60 70 80 90 100
EIVTVNKKFP GPAISAQEDD RIVIKVINMT PYNTTIHWHG IKQKRSCWYD
110 120 130 140 150
GPSYITQCPI QSGQSFTYNF KVAQQKGTFL WHAHFSWLRA TVYGPLIVYP
160 170 180 190 200
KASVPYPFKK PFNEHTILLG EYWLKNVVEL EQHVLESGGP PPPADAFTIN
210 220 230 240 250
GQPGPNYNCS SKDVYEIQIV PRKIYLLRLI NAGINMETFF TIANHRLTIV
260 270 280 290 300
EVDGEYTKPY TTERVMLVPG QTMNILVTAD QTVGRYSMAM GPYESAKNVK
310 320 330 340 350
FQNTSAIANF QYIGALPNNV TVPAKLPIFN DNIAVKTVMD GLRSLNAVDV
360 370 380 390 400
PRNIDAHLFI TIGLNVNKCN SENPNNKCQG PRKGRLAASM NNISFIEPKV
410 420 430 440 450
SILEAYYKQL EGYFTLDFPT TPEKAYDFVN GAPNDIANDT QAANGTRAIV
460 470 480 490 500
FEYGSRIQII FQNTGTLTTE NHPIHLHGHS FYVIGYGTGN YDQQTAKFNL
510 520 530 540 550
EDPPYLNTIG VPVGGWAAIR FVANNPGLWL LHCHFDIHQT WGMSTMFIVK
560
NGKKVQESLP HPPADLPKC
Note: No experimental confirmation available.
Length:569
Mass (Da):63,901
Last modified:May 1, 1999 - v1
Checksum:i3BA02CB6A0C44238
GO
Isoform 2 (identifier: Q9ZPY2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-235: Missing.
     296-327: Missing.
     528-568: LWLLHCHFDIHQTWGMSTMFIVKNGKKVQESLPHPPADLPK → ILLHKTPKHHNTYDI

Show »
Length:276
Mass (Da):30,742
Checksum:i08DB7D61D8BB37B1
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0243451 – 235Missing in isoform 2. 1 PublicationAdd BLAST235
Alternative sequenceiVSP_024346296 – 327Missing in isoform 2. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_024347528 – 568LWLLH…ADLPK → ILLHKTPKHHNTYDI in isoform 2. 1 PublicationAdd BLAST41

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC006418 Genomic DNA Translation: AAD20177.1
CP002685 Genomic DNA Translation: AEC10723.1
AY078937 mRNA Translation: AAL84943.1
PIRiE84904
RefSeqiNP_182180.1, NM_130222.2 [Q9ZPY2-1]

Genome annotation databases

EnsemblPlantsiAT2G46570.1; AT2G46570.1; AT2G46570 [Q9ZPY2-1]
GeneIDi819269
GrameneiAT2G46570.1; AT2G46570.1; AT2G46570 [Q9ZPY2-1]
KEGGiath:AT2G46570

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiLAC6_ARATH
AccessioniPrimary (citable) accession number: Q9ZPY2
Secondary accession number(s): Q8RY28
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 3, 2007
Last sequence update: May 1, 1999
Last modified: April 25, 2018
This is version 120 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health