Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9Z351

- KCNQ2_MOUSE

UniProt

Q9Z351 - KCNQ2_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Potassium voltage-gated channel subfamily KQT member 2

Gene

Kcnq2

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Probably important in the regulation of neuronal excitability. Associates with KCNQ3 to form a potassium channel with essentially identical properties to the channel underlying the native M-current, a slowly activating and deactivating potassium conductance which plays a critical role in determining the subthreshold electrical excitability of neurons as well as the responsiveness to synaptic inputs.1 Publication

GO - Molecular functioni

  1. delayed rectifier potassium channel activity Source: RefGenome

GO - Biological processi

  1. transmission of nerve impulse Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

Ion channel, Potassium channel, Voltage-gated channel

Keywords - Biological processi

Ion transport, Potassium transport, Transport

Keywords - Ligandi

Potassium

Enzyme and pathway databases

ReactomeiREACT_199077. Voltage gated Potassium channels.
REACT_244931. Interaction between L1 and Ankyrins.

Names & Taxonomyi

Protein namesi
Recommended name:
Potassium voltage-gated channel subfamily KQT member 2
Alternative name(s):
KQT-like 2
Potassium channel subunit alpha KvLQT2
Voltage-gated potassium channel subunit Kv7.2
Gene namesi
Name:Kcnq2
Synonyms:Kqt2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 2

Organism-specific databases

MGIiMGI:1309503. Kcnq2.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei92 – 11221Helical; Name=Segment S1Sequence AnalysisAdd
BLAST
Topological domaini113 – 12210ExtracellularSequence Analysis
Transmembranei123 – 14321Helical; Name=Segment S2Sequence AnalysisAdd
BLAST
Topological domaini144 – 16623CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei167 – 18721Helical; Name=Segment S3Sequence AnalysisAdd
BLAST
Topological domaini188 – 19710ExtracellularSequence Analysis
Transmembranei198 – 22124Helical; Voltage-sensor; Name=Segment S4Sequence AnalysisAdd
BLAST
Topological domaini222 – 23110CytoplasmicSequence Analysis
Transmembranei232 – 25221Helical; Name=Segment S5Sequence AnalysisAdd
BLAST
Topological domaini253 – 26412ExtracellularSequence AnalysisAdd
BLAST
Intramembranei265 – 28521Pore-forming; Name=Segment H5Sequence AnalysisAdd
BLAST
Topological domaini286 – 2916ExtracellularSequence Analysis
Transmembranei292 – 31221Helical; Name=Segment S6Sequence AnalysisAdd
BLAST
Topological domaini313 – 759447CytoplasmicSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. axon initial segment Source: BHF-UCL
  2. node of Ranvier Source: BHF-UCL
  3. plasma membrane Source: BHF-UCL
  4. voltage-gated potassium channel complex Source: InterPro
Complete GO annotation...

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 759759Potassium voltage-gated channel subfamily KQT member 2PRO_0000054031Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei52 – 521Phosphoserine; by PKABy similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ9Z351.
PRIDEiQ9Z351.

PTM databases

PhosphoSiteiQ9Z351.

Expressioni

Tissue specificityi

Exclusively expressed in the brain. Expressed in every neuron-containing regions of the central nervous system examined, such as the cerebellum, cerebral cortex, occipital pole, substantia nigra, amygdala, caudate nucleus, hippocampus and thalamus. Also detected in the cochlea.

Developmental stagei

Detected at day 11, 15 and 17 of the embryonic development. Expression increases by a factor of 2.5 at 1 week after birth. Then the expression level remains stable until the adult stage. The mRNAs for shorter forms (isoforms 9, 10 and 11) are specifically expressed in an embryo on the 11th day after gestation.

Gene expression databases

BgeeiQ9Z351.
ExpressionAtlasiQ9Z351. baseline and differential.
GenevestigatoriQ9Z351.

Interactioni

Subunit structurei

Heteromultimer with KCNQ3.

Protein-protein interaction databases

BioGridi200918. 1 interaction.
IntActiQ9Z351. 3 interactions.

Structurei

3D structure databases

ProteinModelPortaliQ9Z351.
SMRiQ9Z351. Positions 65-391.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi277 – 2826Selectivity filterBy similarity

Domaini

The segment S4 is probably the voltage-sensor and is characterized by a series of positively charged amino acids at every third position.By similarity

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG1226.
GeneTreeiENSGT00550000074513.
HOVERGENiHBG059014.
InParanoidiQ9Z351.
KOiK04927.

Family and domain databases

InterProiIPR005821. Ion_trans_dom.
IPR003091. K_chnl.
IPR003937. K_chnl_volt-dep_KCNQ.
IPR003947. K_chnl_volt-dep_KCNQ2.
IPR013821. K_chnl_volt-dep_KCNQ_C.
IPR028325. VG_K_chnl.
[Graphical view]
PANTHERiPTHR11537. PTHR11537. 1 hit.
PfamiPF00520. Ion_trans. 1 hit.
PF03520. KCNQ_channel. 2 hits.
[Graphical view]
PRINTSiPR00169. KCHANNEL.
PR01461. KCNQ2CHANNEL.
PR01459. KCNQCHANNEL.

Sequences (13)i

Sequence statusi: Complete.

This entry describes 13 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9Z351-1) [UniParc]FASTAAdd to Basket

Also known as: MKQT2.1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVQKSRNGGV YPGTSGEKKL KVGFVGLDPG APDSTRDGAL LIAGSEAPKR
60 70 80 90 100
GSVLSKPRTG GAGAGKPPKR NAFYRKLQNF LYNVLERPRG WAFIYHAYVF
110 120 130 140 150
LLVFSCLVLS VFSTIKEYEK SSEGALYILE IVTIVVFGVE YFVRIWAAGC
160 170 180 190 200
CCRYRGWRGR LKFARKPFCV IDIMVLIASI AVLAAGSQGN VFATSALRSL
210 220 230 240 250
RFLQILRMIR MDRRGGTWKL LGSVVYAHSK ELVTAWYIGF LCLILASFLV
260 270 280 290 300
YLAEKGENDH FDTYADALWW GLITLTTIGY GDKYPQTWNG RLLAATFTLI
310 320 330 340 350
GVSFFALPAG ILGSGFALKV QEQHRPKHFE KRRNPAAGLI QSAWRFYATN
360 370 380 390 400
LSRTDLHSTW QYYERTVTVP MYRLIPPLNQ LELLRNLKSK SGLTFRKEPQ
410 420 430 440 450
PEPSPSQKVS LKDRVFSSPR GMAAKGKGSP QAQTVRRSPS ADQSLDDSPS
460 470 480 490 500
KVPKSWSFGD RSRTRQAFRI KGAASRQNSE EASLPGEDIV EDNKSCNCEF
510 520 530 540 550
VTEDLTPGLK VSIRAVCVMR FLVSKRKFKE SLRPYDVMDV IEQYSAGHLD
560 570 580 590 600
MLSRIKSLQS RIDMIVGPPP PSTPRDKKYP TKGPTAPSRE SPQYSPRVDH
610 620 630 640 650
IVGRGPTITD KDRTKGPAET ELPEDPSMMG RLGKVEKQVL SMEKKLDFLV
660 670 680 690 700
SIYTQRMGIP PAETEAYFGA KEPEPAPPYH SPEDSRDHAD KHGCIIKIVR
710 720 730 740 750
STSSTGQRNY AAPPAIPPAQ CPPSTSWQQS HQRHGTSPVG DHGSLVLRLE

RSAGMMSCH
Length:759
Mass (Da):84,450
Last modified:May 1, 1999 - v1
Checksum:iC1D12DBFF3979D3F
GO
Isoform 2 (identifier: Q9Z351-2) [UniParc]FASTAAdd to Basket

Also known as: MKQT2.2

The sequence of this isoform differs from the canonical sequence as follows:
     562-596: IDMIVGPPPPSTPRDKKYPTKGPTAPSRESPQYSP → QEPLPVQSGHEQGPPGQNQAWHKGHQGLGD

Show »
Length:754
Mass (Da):83,871
Checksum:iE5B9E1302AD1BA3A
GO
Isoform 3 (identifier: Q9Z351-3) [UniParc]FASTAAdd to Basket

Also known as: MKQT2.3

The sequence of this isoform differs from the canonical sequence as follows:
     407-418: Missing.

Show »
Length:747
Mass (Da):83,075
Checksum:i7766068E0E4660FA
GO
Isoform 4 (identifier: Q9Z351-4) [UniParc]FASTAAdd to Basket

Also known as: MKQT2.4

The sequence of this isoform differs from the canonical sequence as follows:
     562-597: Missing.

Show »
Length:723
Mass (Da):80,519
Checksum:iB1A8D7BC05B0AAD2
GO
Isoform 5 (identifier: Q9Z351-5) [UniParc]FASTAAdd to Basket

Also known as: MKQT2.5

The sequence of this isoform differs from the canonical sequence as follows:
     562-570: IDMIVGPPP → SCDWRGVLA
     571-759: Missing.

Show »
Length:570
Mass (Da):63,805
Checksum:iDB5DA2952C6B6D09
GO
Isoform 6 (identifier: Q9Z351-6) [UniParc]FASTAAdd to Basket

Also known as: MKQT2.6

The sequence of this isoform differs from the canonical sequence as follows:
     562-623: IDMIVGPPPP...TKGPAETELP → QEPLPVQSGH...FLLCFHTVCF
     624-759: Missing.

Show »
Length:623
Mass (Da):69,734
Checksum:i8D2C7F4729A2BAB8
GO
Isoform 7 (identifier: Q9Z351-7) [UniParc]FASTAAdd to Basket

Also known as: MKQT2.7

The sequence of this isoform differs from the canonical sequence as follows:
     372-372: Y → YSSQTQTYGAS
     406-463: SQKVSLKDRV...KSWSFGDRSR → RSVPPASSRP...PGTPRVTSQL
     464-759: Missing.

Show »
Length:473
Mass (Da):52,651
Checksum:i3AFED94FA2262127
GO
Isoform 8 (identifier: Q9Z351-8) [UniParc]FASTAAdd to Basket

Also known as: MKQT2.8

The sequence of this isoform differs from the canonical sequence as follows:
     406-463: SQKVSLKDRV...KSWSFGDRSR → RSVPPASSRP...PGTPRVTSQL
     464-759: Missing.

Show »
Length:463
Mass (Da):51,640
Checksum:i9E6F79DFE373028A
GO
Isoform 9 (identifier: Q9Z351-9) [UniParc]FASTAAdd to Basket

Also known as: MKQT2.9

The sequence of this isoform differs from the canonical sequence as follows:
     342-349: SAWRFYAT → GQVRCAGH
     350-759: Missing.

Show »
Length:349
Mass (Da):38,652
Checksum:i034B50C777C54EC3
GO
Isoform 10 (identifier: Q9Z351-10) [UniParc]FASTAAdd to Basket

Also known as: MKQT2.10

The sequence of this isoform differs from the canonical sequence as follows:
     342-347: SAWRFY → VSLSPC
     348-759: Missing.

Show »
Length:347
Mass (Da):38,430
Checksum:i93BEA660ADB9FA73
GO
Isoform 11 (identifier: Q9Z351-11) [UniParc]FASTAAdd to Basket

Also known as: MKQT2.11

The sequence of this isoform differs from the canonical sequence as follows:
     310-338: GILGSGFALKVQEQHRPKHFEKRRNPAAG → VSPAHLPTLEMLGVLEAPHKAWPWPTCEL
     339-759: Missing.

Show »
Length:338
Mass (Da):37,483
Checksum:i82520B7C1C01FA2F
GO
Isoform 12 (identifier: Q9Z351-12) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     372-372: Y → YSSQTQTYGAS
     406-406: S → SKGRPCRGCLCGCCPGHSS
     562-597: Missing.
     747-759: LRLERSAGMMSCH → RIPPPPAHER...GDVAWAGPRK

Show »
Length:870
Mass (Da):95,720
Checksum:i59C6E7B4216708AA
GO
Isoform 13 (identifier: Q9Z351-13) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     372-372: Y → YSSQTQTYGAS
     571-606: Missing.
     747-759: LRLERSAGMMSCH → RIPPPPAHER...GDVAWAGPRK

Show »
Length:852
Mass (Da):93,906
Checksum:iBB27ADF9FA5BEE5D
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti125 – 1251A → P in BAA37161. (PubMed:9666519)Curated
Sequence conflicti326 – 3261P → Q in BAA37160. (PubMed:9666519)Curated
Sequence conflicti326 – 3261P → Q in BAA37165. (PubMed:9666519)Curated
Sequence conflicti326 – 3261P → Q in AAM09696. (PubMed:12223552)Curated
Sequence conflicti600 – 6001H → Q in AAM09696. (PubMed:12223552)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei310 – 33829GILGS…NPAAG → VSPAHLPTLEMLGVLEAPHK AWPWPTCEL in isoform 11. 1 PublicationVSP_000991Add
BLAST
Alternative sequencei339 – 759421Missing in isoform 11. 1 PublicationVSP_000992Add
BLAST
Alternative sequencei342 – 3498SAWRFYAT → GQVRCAGH in isoform 9. 1 PublicationVSP_000993
Alternative sequencei342 – 3476SAWRFY → VSLSPC in isoform 10. 1 PublicationVSP_000995
Alternative sequencei348 – 759412Missing in isoform 10. 1 PublicationVSP_000996Add
BLAST
Alternative sequencei350 – 759410Missing in isoform 9. 1 PublicationVSP_000994Add
BLAST
Alternative sequencei372 – 3721Y → YSSQTQTYGAS in isoform 7, isoform 12 and isoform 13. 3 PublicationsVSP_000997
Alternative sequencei406 – 46358SQKVS…GDRSR → RSVPPASSRPGVCCTHLALL SLCIHHVSWGRATMGPCVCF YVQQVTVCPGTPRVTSQL in isoform 7 and isoform 8. 1 PublicationVSP_000998Add
BLAST
Alternative sequencei406 – 4061S → SKGRPCRGCLCGCCPGHSS in isoform 12. 1 PublicationVSP_012365
Alternative sequencei407 – 41812Missing in isoform 3. 1 PublicationVSP_001000Add
BLAST
Alternative sequencei464 – 759296Missing in isoform 7 and isoform 8. 1 PublicationVSP_000999Add
BLAST
Alternative sequencei562 – 62362IDMIV…ETELP → QEPLPVQSGHEQGPPGQNQA WHKGHQGLGDRCAEQGQYQL WRSLPTLLASCCFLLCFHTV CF in isoform 6. 1 PublicationVSP_001005Add
BLAST
Alternative sequencei562 – 59736Missing in isoform 4 and isoform 12. 2 PublicationsVSP_001002Add
BLAST
Alternative sequencei562 – 59635IDMIV…PQYSP → QEPLPVQSGHEQGPPGQNQA WHKGHQGLGD in isoform 2. 1 PublicationVSP_001001Add
BLAST
Alternative sequencei562 – 5709IDMIVGPPP → SCDWRGVLA in isoform 5. 1 PublicationVSP_001003
Alternative sequencei571 – 759189Missing in isoform 5. 1 PublicationVSP_001004Add
BLAST
Alternative sequencei571 – 60636Missing in isoform 13. 1 PublicationVSP_022637Add
BLAST
Alternative sequencei624 – 759136Missing in isoform 6. 1 PublicationVSP_001006Add
BLAST
Alternative sequencei747 – 75913LRLER…MMSCH → RIPPPPAHERSLSAYGGGNR ASTEFLRLEGTPACRPSEAA LRDSDTSISIPSVDHEELER SFSGFSISQSKENLDALGSC YAAVAPCAKVRPYIAEGESD TDSDLCTPCGPPPRSATGEG PFGDVAWAGPRK in isoform 12 and isoform 13. 2 PublicationsVSP_012366Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB000494 mRNA. Translation: BAA37156.1.
AB000495 mRNA. Translation: BAA37157.1.
AB000496 mRNA. Translation: BAA37158.1.
AB000497 mRNA. Translation: BAA37159.1.
AB000498 mRNA. Translation: BAA37160.1.
AB000499 mRNA. Translation: BAA37161.1.
AB000500 mRNA. Translation: BAA37162.1.
AB000501 mRNA. Translation: BAA37163.1.
AB000502 mRNA. Translation: BAA37164.1.
AB000503 mRNA. Translation: BAA37165.1.
AB000504 mRNA. Translation: BAA37166.1.
AF490773 mRNA. Translation: AAM09696.1.
AK139411 mRNA. Translation: BAE24000.1.
CCDSiCCDS17193.1. [Q9Z351-1]
CCDS17194.1. [Q9Z351-2]
CCDS17195.1. [Q9Z351-3]
CCDS17196.1. [Q9Z351-4]
CCDS17197.1. [Q9Z351-5]
CCDS17198.1. [Q9Z351-12]
CCDS17199.1. [Q9Z351-7]
CCDS17200.1. [Q9Z351-9]
CCDS50845.1. [Q9Z351-11]
CCDS50846.1. [Q9Z351-10]
CCDS50847.1. [Q9Z351-8]
CCDS50848.1. [Q9Z351-6]
RefSeqiNP_001003824.1. NM_001003824.1.
NP_001003825.1. NM_001003825.2.
NP_001006669.1. NM_001006668.1.
NP_001006670.1. NM_001006669.1.
NP_001006675.1. NM_001006674.1.
NP_001006676.1. NM_001006675.1.
NP_001006677.1. NM_001006676.1.
NP_001006678.1. NM_001006677.1.
NP_001006679.1. NM_001006678.1.
NP_001006680.1. NM_001006679.1.
NP_001006681.1. NM_001006680.1. [Q9Z351-11]
NP_034741.2. NM_010611.2.
UniGeneiMm.40615.
Mm.440175.

Genome annotation databases

EnsembliENSMUST00000123336; ENSMUSP00000130700; ENSMUSG00000016346.
ENSMUST00000129361; ENSMUSP00000131756; ENSMUSG00000016346. [Q9Z351-11]
GeneIDi16536.
KEGGimmu:16536.
UCSCiuc008olg.1. mouse. [Q9Z351-11]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB000494 mRNA. Translation: BAA37156.1 .
AB000495 mRNA. Translation: BAA37157.1 .
AB000496 mRNA. Translation: BAA37158.1 .
AB000497 mRNA. Translation: BAA37159.1 .
AB000498 mRNA. Translation: BAA37160.1 .
AB000499 mRNA. Translation: BAA37161.1 .
AB000500 mRNA. Translation: BAA37162.1 .
AB000501 mRNA. Translation: BAA37163.1 .
AB000502 mRNA. Translation: BAA37164.1 .
AB000503 mRNA. Translation: BAA37165.1 .
AB000504 mRNA. Translation: BAA37166.1 .
AF490773 mRNA. Translation: AAM09696.1 .
AK139411 mRNA. Translation: BAE24000.1 .
CCDSi CCDS17193.1. [Q9Z351-1 ]
CCDS17194.1. [Q9Z351-2 ]
CCDS17195.1. [Q9Z351-3 ]
CCDS17196.1. [Q9Z351-4 ]
CCDS17197.1. [Q9Z351-5 ]
CCDS17198.1. [Q9Z351-12 ]
CCDS17199.1. [Q9Z351-7 ]
CCDS17200.1. [Q9Z351-9 ]
CCDS50845.1. [Q9Z351-11 ]
CCDS50846.1. [Q9Z351-10 ]
CCDS50847.1. [Q9Z351-8 ]
CCDS50848.1. [Q9Z351-6 ]
RefSeqi NP_001003824.1. NM_001003824.1.
NP_001003825.1. NM_001003825.2.
NP_001006669.1. NM_001006668.1.
NP_001006670.1. NM_001006669.1.
NP_001006675.1. NM_001006674.1.
NP_001006676.1. NM_001006675.1.
NP_001006677.1. NM_001006676.1.
NP_001006678.1. NM_001006677.1.
NP_001006679.1. NM_001006678.1.
NP_001006680.1. NM_001006679.1.
NP_001006681.1. NM_001006680.1. [Q9Z351-11 ]
NP_034741.2. NM_010611.2.
UniGenei Mm.40615.
Mm.440175.

3D structure databases

ProteinModelPortali Q9Z351.
SMRi Q9Z351. Positions 65-391.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 200918. 1 interaction.
IntActi Q9Z351. 3 interactions.

Chemistry

BindingDBi Q9Z351.
ChEMBLi CHEMBL2985.

PTM databases

PhosphoSitei Q9Z351.

Proteomic databases

PaxDbi Q9Z351.
PRIDEi Q9Z351.

Protocols and materials databases

DNASUi 16536.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000123336 ; ENSMUSP00000130700 ; ENSMUSG00000016346 .
ENSMUST00000129361 ; ENSMUSP00000131756 ; ENSMUSG00000016346 . [Q9Z351-11 ]
GeneIDi 16536.
KEGGi mmu:16536.
UCSCi uc008olg.1. mouse. [Q9Z351-11 ]

Organism-specific databases

CTDi 3785.
MGIi MGI:1309503. Kcnq2.

Phylogenomic databases

eggNOGi COG1226.
GeneTreei ENSGT00550000074513.
HOVERGENi HBG059014.
InParanoidi Q9Z351.
KOi K04927.

Enzyme and pathway databases

Reactomei REACT_199077. Voltage gated Potassium channels.
REACT_244931. Interaction between L1 and Ankyrins.

Miscellaneous databases

NextBioi 289965.
PROi Q9Z351.
SOURCEi Search...

Gene expression databases

Bgeei Q9Z351.
ExpressionAtlasi Q9Z351. baseline and differential.
Genevestigatori Q9Z351.

Family and domain databases

InterProi IPR005821. Ion_trans_dom.
IPR003091. K_chnl.
IPR003937. K_chnl_volt-dep_KCNQ.
IPR003947. K_chnl_volt-dep_KCNQ2.
IPR013821. K_chnl_volt-dep_KCNQ_C.
IPR028325. VG_K_chnl.
[Graphical view ]
PANTHERi PTHR11537. PTHR11537. 1 hit.
Pfami PF00520. Ion_trans. 1 hit.
PF03520. KCNQ_channel. 2 hits.
[Graphical view ]
PRINTSi PR00169. KCHANNEL.
PR01461. KCNQ2CHANNEL.
PR01459. KCNQCHANNEL.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "KQT2, a new putative potassium channel family produced by alternative splicing. Isolation, genomic structure, and alternative splicing of the putative potassium channels."
    Nakamura M., Watanabe H., Kubo Y., Yokoyama M., Matsumoto T., Sasai H., Nishi Y.
    Recept. Channels 5:255-271(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4; 5; 6; 7; 8; 9; 10 AND 11).
    Tissue: Brain.
  2. "Calmodulin is an auxiliary subunit of KCNQ2/3 potassium channels."
    Wen H., Levitan I.B.
    J. Neurosci. 22:7991-8001(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 12).
    Strain: BALB/c.
  3. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 58-759 (ISOFORM 13).
    Strain: C57BL/6J.
    Tissue: Brain cortex.
  4. "Disruption of the epilepsy KCNQ2 gene results in neural hyperexcitability."
    Watanabe H., Nagata E., Kosakai A., Nakamura M., Yokoyama M., Tanaka K., Sasai H.
    J. Neurochem. 75:28-33(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: ROLE IN NEURAL HYPEREXCITABILITY.
  5. "Comprehensive identification of phosphorylation sites in postsynaptic density preparations."
    Trinidad J.C., Specht C.G., Thalhammer A., Schoepfer R., Burlingame A.L.
    Mol. Cell. Proteomics 5:914-922(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Brain.

Entry informationi

Entry nameiKCNQ2_MOUSE
AccessioniPrimary (citable) accession number: Q9Z351
Secondary accession number(s): Q3UTI0
, Q8R498, Q9QWN9, Q9Z342, Q9Z343, Q9Z344, Q9Z345, Q9Z346, Q9Z347, Q9Z348, Q9Z349, Q9Z350
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 1, 2001
Last sequence update: May 1, 1999
Last modified: November 26, 2014
This is version 132 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3