SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9Z351

- KCNQ2_MOUSE

UniProt

Q9Z351 - KCNQ2_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Potassium voltage-gated channel subfamily KQT member 2
Gene
Kcnq2, Kqt2
Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Probably important in the regulation of neuronal excitability. Associates with KCNQ3 to form a potassium channel with essentially identical properties to the channel underlying the native M-current, a slowly activating and deactivating potassium conductance which plays a critical role in determining the subthreshold electrical excitability of neurons as well as the responsiveness to synaptic inputs.1 Publication

GO - Molecular functioni

  1. delayed rectifier potassium channel activity Source: RefGenome

GO - Biological processi

  1. transmission of nerve impulse Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

Ion channel, Potassium channel, Voltage-gated channel

Keywords - Biological processi

Ion transport, Potassium transport, Transport

Keywords - Ligandi

Potassium

Enzyme and pathway databases

ReactomeiREACT_199077. Voltage gated Potassium channels.

Names & Taxonomyi

Protein namesi
Recommended name:
Potassium voltage-gated channel subfamily KQT member 2
Alternative name(s):
KQT-like 2
Potassium channel subunit alpha KvLQT2
Voltage-gated potassium channel subunit Kv7.2
Gene namesi
Name:Kcnq2
Synonyms:Kqt2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 2

Organism-specific databases

MGIiMGI:1309503. Kcnq2.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei92 – 11221Helical; Name=Segment S1; Reviewed prediction
Add
BLAST
Topological domaini113 – 12210Extracellular Reviewed prediction
Transmembranei123 – 14321Helical; Name=Segment S2; Reviewed prediction
Add
BLAST
Topological domaini144 – 16623Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei167 – 18721Helical; Name=Segment S3; Reviewed prediction
Add
BLAST
Topological domaini188 – 19710Extracellular Reviewed prediction
Transmembranei198 – 22124Helical; Voltage-sensor; Name=Segment S4; Reviewed prediction
Add
BLAST
Topological domaini222 – 23110Cytoplasmic Reviewed prediction
Transmembranei232 – 25221Helical; Name=Segment S5; Reviewed prediction
Add
BLAST
Topological domaini253 – 26412Extracellular Reviewed prediction
Add
BLAST
Intramembranei265 – 28521Pore-forming; Name=Segment H5; Reviewed prediction
Add
BLAST
Topological domaini286 – 2916Extracellular Reviewed prediction
Transmembranei292 – 31221Helical; Name=Segment S6; Reviewed prediction
Add
BLAST
Topological domaini313 – 759447Cytoplasmic Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. axon initial segment Source: BHF-UCL
  2. node of Ranvier Source: BHF-UCL
  3. plasma membrane Source: BHF-UCL
  4. voltage-gated potassium channel complex Source: InterPro
Complete GO annotation...

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 759759Potassium voltage-gated channel subfamily KQT member 2
PRO_0000054031Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei52 – 521Phosphoserine; by PKA By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ9Z351.
PRIDEiQ9Z351.

PTM databases

PhosphoSiteiQ9Z351.

Expressioni

Tissue specificityi

Exclusively expressed in the brain. Expressed in every neuron-containing regions of the central nervous system examined, such as the cerebellum, cerebral cortex, occipital pole, substantia nigra, amygdala, caudate nucleus, hippocampus and thalamus. Also detected in the cochlea.

Developmental stagei

Detected at day 11, 15 and 17 of the embryonic development. Expression increases by a factor of 2.5 at 1 week after birth. Then the expression level remains stable until the adult stage. The mRNAs for shorter forms (isoforms 9, 10 and 11) are specifically expressed in an embryo on the 11th day after gestation.

Gene expression databases

ArrayExpressiQ9Z351.
BgeeiQ9Z351.
GenevestigatoriQ9Z351.

Interactioni

Subunit structurei

Heteromultimer with KCNQ3.

Protein-protein interaction databases

BioGridi200918. 1 interaction.
IntActiQ9Z351. 3 interactions.

Structurei

3D structure databases

ProteinModelPortaliQ9Z351.
SMRiQ9Z351. Positions 65-391.

Family & Domainsi

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi277 – 2826Selectivity filter By similarity

Domaini

The segment S4 is probably the voltage-sensor and is characterized by a series of positively charged amino acids at every third position By similarity.

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG1226.
GeneTreeiENSGT00550000074513.
HOVERGENiHBG059014.
KOiK04927.

Family and domain databases

InterProiIPR005821. Ion_trans_dom.
IPR003091. K_chnl.
IPR003937. K_chnl_volt-dep_KCNQ.
IPR003947. K_chnl_volt-dep_KCNQ2.
IPR013821. K_chnl_volt-dep_KCNQ_C.
IPR028325. VG_K_chnl.
[Graphical view]
PANTHERiPTHR11537. PTHR11537. 1 hit.
PfamiPF00520. Ion_trans. 1 hit.
PF03520. KCNQ_channel. 2 hits.
[Graphical view]
PRINTSiPR00169. KCHANNEL.
PR01461. KCNQ2CHANNEL.
PR01459. KCNQCHANNEL.

Sequences (13)i

Sequence statusi: Complete.

This entry describes 13 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9Z351-1) [UniParc]FASTAAdd to Basket

Also known as: MKQT2.1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MVQKSRNGGV YPGTSGEKKL KVGFVGLDPG APDSTRDGAL LIAGSEAPKR    50
GSVLSKPRTG GAGAGKPPKR NAFYRKLQNF LYNVLERPRG WAFIYHAYVF 100
LLVFSCLVLS VFSTIKEYEK SSEGALYILE IVTIVVFGVE YFVRIWAAGC 150
CCRYRGWRGR LKFARKPFCV IDIMVLIASI AVLAAGSQGN VFATSALRSL 200
RFLQILRMIR MDRRGGTWKL LGSVVYAHSK ELVTAWYIGF LCLILASFLV 250
YLAEKGENDH FDTYADALWW GLITLTTIGY GDKYPQTWNG RLLAATFTLI 300
GVSFFALPAG ILGSGFALKV QEQHRPKHFE KRRNPAAGLI QSAWRFYATN 350
LSRTDLHSTW QYYERTVTVP MYRLIPPLNQ LELLRNLKSK SGLTFRKEPQ 400
PEPSPSQKVS LKDRVFSSPR GMAAKGKGSP QAQTVRRSPS ADQSLDDSPS 450
KVPKSWSFGD RSRTRQAFRI KGAASRQNSE EASLPGEDIV EDNKSCNCEF 500
VTEDLTPGLK VSIRAVCVMR FLVSKRKFKE SLRPYDVMDV IEQYSAGHLD 550
MLSRIKSLQS RIDMIVGPPP PSTPRDKKYP TKGPTAPSRE SPQYSPRVDH 600
IVGRGPTITD KDRTKGPAET ELPEDPSMMG RLGKVEKQVL SMEKKLDFLV 650
SIYTQRMGIP PAETEAYFGA KEPEPAPPYH SPEDSRDHAD KHGCIIKIVR 700
STSSTGQRNY AAPPAIPPAQ CPPSTSWQQS HQRHGTSPVG DHGSLVLRLE 750
RSAGMMSCH 759
Length:759
Mass (Da):84,450
Last modified:May 1, 1999 - v1
Checksum:iC1D12DBFF3979D3F
GO
Isoform 2 (identifier: Q9Z351-2) [UniParc]FASTAAdd to Basket

Also known as: MKQT2.2

The sequence of this isoform differs from the canonical sequence as follows:
     562-596: IDMIVGPPPPSTPRDKKYPTKGPTAPSRESPQYSP → QEPLPVQSGHEQGPPGQNQAWHKGHQGLGD

Show »
Length:754
Mass (Da):83,871
Checksum:iE5B9E1302AD1BA3A
GO
Isoform 3 (identifier: Q9Z351-3) [UniParc]FASTAAdd to Basket

Also known as: MKQT2.3

The sequence of this isoform differs from the canonical sequence as follows:
     407-418: Missing.

Show »
Length:747
Mass (Da):83,075
Checksum:i7766068E0E4660FA
GO
Isoform 4 (identifier: Q9Z351-4) [UniParc]FASTAAdd to Basket

Also known as: MKQT2.4

The sequence of this isoform differs from the canonical sequence as follows:
     562-597: Missing.

Show »
Length:723
Mass (Da):80,519
Checksum:iB1A8D7BC05B0AAD2
GO
Isoform 5 (identifier: Q9Z351-5) [UniParc]FASTAAdd to Basket

Also known as: MKQT2.5

The sequence of this isoform differs from the canonical sequence as follows:
     562-570: IDMIVGPPP → SCDWRGVLA
     571-759: Missing.

Show »
Length:570
Mass (Da):63,805
Checksum:iDB5DA2952C6B6D09
GO
Isoform 6 (identifier: Q9Z351-6) [UniParc]FASTAAdd to Basket

Also known as: MKQT2.6

The sequence of this isoform differs from the canonical sequence as follows:
     562-623: IDMIVGPPPP...TKGPAETELP → QEPLPVQSGH...FLLCFHTVCF
     624-759: Missing.

Show »
Length:623
Mass (Da):69,734
Checksum:i8D2C7F4729A2BAB8
GO
Isoform 7 (identifier: Q9Z351-7) [UniParc]FASTAAdd to Basket

Also known as: MKQT2.7

The sequence of this isoform differs from the canonical sequence as follows:
     372-372: Y → YSSQTQTYGAS
     406-463: SQKVSLKDRV...KSWSFGDRSR → RSVPPASSRP...PGTPRVTSQL
     464-759: Missing.

Show »
Length:473
Mass (Da):52,651
Checksum:i3AFED94FA2262127
GO
Isoform 8 (identifier: Q9Z351-8) [UniParc]FASTAAdd to Basket

Also known as: MKQT2.8

The sequence of this isoform differs from the canonical sequence as follows:
     406-463: SQKVSLKDRV...KSWSFGDRSR → RSVPPASSRP...PGTPRVTSQL
     464-759: Missing.

Show »
Length:463
Mass (Da):51,640
Checksum:i9E6F79DFE373028A
GO
Isoform 9 (identifier: Q9Z351-9) [UniParc]FASTAAdd to Basket

Also known as: MKQT2.9

The sequence of this isoform differs from the canonical sequence as follows:
     342-349: SAWRFYAT → GQVRCAGH
     350-759: Missing.

Show »
Length:349
Mass (Da):38,652
Checksum:i034B50C777C54EC3
GO
Isoform 10 (identifier: Q9Z351-10) [UniParc]FASTAAdd to Basket

Also known as: MKQT2.10

The sequence of this isoform differs from the canonical sequence as follows:
     342-347: SAWRFY → VSLSPC
     348-759: Missing.

Show »
Length:347
Mass (Da):38,430
Checksum:i93BEA660ADB9FA73
GO
Isoform 11 (identifier: Q9Z351-11) [UniParc]FASTAAdd to Basket

Also known as: MKQT2.11

The sequence of this isoform differs from the canonical sequence as follows:
     310-338: GILGSGFALKVQEQHRPKHFEKRRNPAAG → VSPAHLPTLEMLGVLEAPHKAWPWPTCEL
     339-759: Missing.

Show »
Length:338
Mass (Da):37,483
Checksum:i82520B7C1C01FA2F
GO
Isoform 12 (identifier: Q9Z351-12) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     372-372: Y → YSSQTQTYGAS
     406-406: S → SKGRPCRGCLCGCCPGHSS
     562-597: Missing.
     747-759: LRLERSAGMMSCH → RIPPPPAHER...GDVAWAGPRK

Show »
Length:870
Mass (Da):95,720
Checksum:i59C6E7B4216708AA
GO
Isoform 13 (identifier: Q9Z351-13) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     372-372: Y → YSSQTQTYGAS
     571-606: Missing.
     747-759: LRLERSAGMMSCH → RIPPPPAHER...GDVAWAGPRK

Show »
Length:852
Mass (Da):93,906
Checksum:iBB27ADF9FA5BEE5D
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei310 – 33829GILGS…NPAAG → VSPAHLPTLEMLGVLEAPHK AWPWPTCEL in isoform 11.
VSP_000991Add
BLAST
Alternative sequencei339 – 759421Missing in isoform 11.
VSP_000992Add
BLAST
Alternative sequencei342 – 3498SAWRFYAT → GQVRCAGH in isoform 9.
VSP_000993
Alternative sequencei342 – 3476SAWRFY → VSLSPC in isoform 10.
VSP_000995
Alternative sequencei348 – 759412Missing in isoform 10.
VSP_000996Add
BLAST
Alternative sequencei350 – 759410Missing in isoform 9.
VSP_000994Add
BLAST
Alternative sequencei372 – 3721Y → YSSQTQTYGAS in isoform 7, isoform 12 and isoform 13.
VSP_000997
Alternative sequencei406 – 46358SQKVS…GDRSR → RSVPPASSRPGVCCTHLALL SLCIHHVSWGRATMGPCVCF YVQQVTVCPGTPRVTSQL in isoform 7 and isoform 8.
VSP_000998Add
BLAST
Alternative sequencei406 – 4061S → SKGRPCRGCLCGCCPGHSS in isoform 12.
VSP_012365
Alternative sequencei407 – 41812Missing in isoform 3.
VSP_001000Add
BLAST
Alternative sequencei464 – 759296Missing in isoform 7 and isoform 8.
VSP_000999Add
BLAST
Alternative sequencei562 – 62362IDMIV…ETELP → QEPLPVQSGHEQGPPGQNQA WHKGHQGLGDRCAEQGQYQL WRSLPTLLASCCFLLCFHTV CF in isoform 6.
VSP_001005Add
BLAST
Alternative sequencei562 – 59736Missing in isoform 4 and isoform 12.
VSP_001002Add
BLAST
Alternative sequencei562 – 59635IDMIV…PQYSP → QEPLPVQSGHEQGPPGQNQA WHKGHQGLGD in isoform 2.
VSP_001001Add
BLAST
Alternative sequencei562 – 5709IDMIVGPPP → SCDWRGVLA in isoform 5.
VSP_001003
Alternative sequencei571 – 759189Missing in isoform 5.
VSP_001004Add
BLAST
Alternative sequencei571 – 60636Missing in isoform 13.
VSP_022637Add
BLAST
Alternative sequencei624 – 759136Missing in isoform 6.
VSP_001006Add
BLAST
Alternative sequencei747 – 75913LRLER…MMSCH → RIPPPPAHERSLSAYGGGNR ASTEFLRLEGTPACRPSEAA LRDSDTSISIPSVDHEELER SFSGFSISQSKENLDALGSC YAAVAPCAKVRPYIAEGESD TDSDLCTPCGPPPRSATGEG PFGDVAWAGPRK in isoform 12 and isoform 13.
VSP_012366Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti125 – 1251A → P in BAA37161. 1 Publication
Sequence conflicti326 – 3261P → Q in BAA37160. 1 Publication
Sequence conflicti326 – 3261P → Q in BAA37165. 1 Publication
Sequence conflicti326 – 3261P → Q in AAM09696. 1 Publication
Sequence conflicti600 – 6001H → Q in AAM09696. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB000494 mRNA. Translation: BAA37156.1.
AB000495 mRNA. Translation: BAA37157.1.
AB000496 mRNA. Translation: BAA37158.1.
AB000497 mRNA. Translation: BAA37159.1.
AB000498 mRNA. Translation: BAA37160.1.
AB000499 mRNA. Translation: BAA37161.1.
AB000500 mRNA. Translation: BAA37162.1.
AB000501 mRNA. Translation: BAA37163.1.
AB000502 mRNA. Translation: BAA37164.1.
AB000503 mRNA. Translation: BAA37165.1.
AB000504 mRNA. Translation: BAA37166.1.
AF490773 mRNA. Translation: AAM09696.1.
AK139411 mRNA. Translation: BAE24000.1.
CCDSiCCDS17193.1. [Q9Z351-1]
CCDS17194.1. [Q9Z351-2]
CCDS17195.1. [Q9Z351-3]
CCDS17196.1. [Q9Z351-4]
CCDS17197.1. [Q9Z351-5]
CCDS17198.1. [Q9Z351-12]
CCDS17199.1. [Q9Z351-7]
CCDS17200.1. [Q9Z351-9]
CCDS50845.1. [Q9Z351-11]
CCDS50846.1. [Q9Z351-10]
CCDS50847.1. [Q9Z351-8]
CCDS50848.1. [Q9Z351-6]
RefSeqiNP_001003824.1. NM_001003824.1.
NP_001003825.1. NM_001003825.2.
NP_001006669.1. NM_001006668.1.
NP_001006670.1. NM_001006669.1.
NP_001006675.1. NM_001006674.1.
NP_001006676.1. NM_001006675.1.
NP_001006677.1. NM_001006676.1.
NP_001006678.1. NM_001006677.1.
NP_001006679.1. NM_001006678.1.
NP_001006680.1. NM_001006679.1.
NP_001006681.1. NM_001006680.1. [Q9Z351-11]
NP_034741.2. NM_010611.2.
UniGeneiMm.40615.
Mm.440175.

Genome annotation databases

EnsembliENSMUST00000123336; ENSMUSP00000130700; ENSMUSG00000016346.
ENSMUST00000129361; ENSMUSP00000131756; ENSMUSG00000016346. [Q9Z351-11]
GeneIDi16536.
KEGGimmu:16536.
UCSCiuc008olg.1. mouse. [Q9Z351-11]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB000494 mRNA. Translation: BAA37156.1 .
AB000495 mRNA. Translation: BAA37157.1 .
AB000496 mRNA. Translation: BAA37158.1 .
AB000497 mRNA. Translation: BAA37159.1 .
AB000498 mRNA. Translation: BAA37160.1 .
AB000499 mRNA. Translation: BAA37161.1 .
AB000500 mRNA. Translation: BAA37162.1 .
AB000501 mRNA. Translation: BAA37163.1 .
AB000502 mRNA. Translation: BAA37164.1 .
AB000503 mRNA. Translation: BAA37165.1 .
AB000504 mRNA. Translation: BAA37166.1 .
AF490773 mRNA. Translation: AAM09696.1 .
AK139411 mRNA. Translation: BAE24000.1 .
CCDSi CCDS17193.1. [Q9Z351-1 ]
CCDS17194.1. [Q9Z351-2 ]
CCDS17195.1. [Q9Z351-3 ]
CCDS17196.1. [Q9Z351-4 ]
CCDS17197.1. [Q9Z351-5 ]
CCDS17198.1. [Q9Z351-12 ]
CCDS17199.1. [Q9Z351-7 ]
CCDS17200.1. [Q9Z351-9 ]
CCDS50845.1. [Q9Z351-11 ]
CCDS50846.1. [Q9Z351-10 ]
CCDS50847.1. [Q9Z351-8 ]
CCDS50848.1. [Q9Z351-6 ]
RefSeqi NP_001003824.1. NM_001003824.1.
NP_001003825.1. NM_001003825.2.
NP_001006669.1. NM_001006668.1.
NP_001006670.1. NM_001006669.1.
NP_001006675.1. NM_001006674.1.
NP_001006676.1. NM_001006675.1.
NP_001006677.1. NM_001006676.1.
NP_001006678.1. NM_001006677.1.
NP_001006679.1. NM_001006678.1.
NP_001006680.1. NM_001006679.1.
NP_001006681.1. NM_001006680.1. [Q9Z351-11 ]
NP_034741.2. NM_010611.2.
UniGenei Mm.40615.
Mm.440175.

3D structure databases

ProteinModelPortali Q9Z351.
SMRi Q9Z351. Positions 65-391.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 200918. 1 interaction.
IntActi Q9Z351. 3 interactions.

Chemistry

BindingDBi Q9Z351.
ChEMBLi CHEMBL2985.

PTM databases

PhosphoSitei Q9Z351.

Proteomic databases

PaxDbi Q9Z351.
PRIDEi Q9Z351.

Protocols and materials databases

DNASUi 16536.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000123336 ; ENSMUSP00000130700 ; ENSMUSG00000016346 .
ENSMUST00000129361 ; ENSMUSP00000131756 ; ENSMUSG00000016346 . [Q9Z351-11 ]
GeneIDi 16536.
KEGGi mmu:16536.
UCSCi uc008olg.1. mouse. [Q9Z351-11 ]

Organism-specific databases

CTDi 3785.
MGIi MGI:1309503. Kcnq2.

Phylogenomic databases

eggNOGi COG1226.
GeneTreei ENSGT00550000074513.
HOVERGENi HBG059014.
KOi K04927.

Enzyme and pathway databases

Reactomei REACT_199077. Voltage gated Potassium channels.

Miscellaneous databases

NextBioi 289965.
PROi Q9Z351.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q9Z351.
Bgeei Q9Z351.
Genevestigatori Q9Z351.

Family and domain databases

InterProi IPR005821. Ion_trans_dom.
IPR003091. K_chnl.
IPR003937. K_chnl_volt-dep_KCNQ.
IPR003947. K_chnl_volt-dep_KCNQ2.
IPR013821. K_chnl_volt-dep_KCNQ_C.
IPR028325. VG_K_chnl.
[Graphical view ]
PANTHERi PTHR11537. PTHR11537. 1 hit.
Pfami PF00520. Ion_trans. 1 hit.
PF03520. KCNQ_channel. 2 hits.
[Graphical view ]
PRINTSi PR00169. KCHANNEL.
PR01461. KCNQ2CHANNEL.
PR01459. KCNQCHANNEL.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "KQT2, a new putative potassium channel family produced by alternative splicing. Isolation, genomic structure, and alternative splicing of the putative potassium channels."
    Nakamura M., Watanabe H., Kubo Y., Yokoyama M., Matsumoto T., Sasai H., Nishi Y.
    Recept. Channels 5:255-271(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4; 5; 6; 7; 8; 9; 10 AND 11).
    Tissue: Brain.
  2. "Calmodulin is an auxiliary subunit of KCNQ2/3 potassium channels."
    Wen H., Levitan I.B.
    J. Neurosci. 22:7991-8001(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 12).
    Strain: BALB/c.
  3. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 58-759 (ISOFORM 13).
    Strain: C57BL/6J.
    Tissue: Brain cortex.
  4. "Disruption of the epilepsy KCNQ2 gene results in neural hyperexcitability."
    Watanabe H., Nagata E., Kosakai A., Nakamura M., Yokoyama M., Tanaka K., Sasai H.
    J. Neurochem. 75:28-33(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: ROLE IN NEURAL HYPEREXCITABILITY.
  5. "Comprehensive identification of phosphorylation sites in postsynaptic density preparations."
    Trinidad J.C., Specht C.G., Thalhammer A., Schoepfer R., Burlingame A.L.
    Mol. Cell. Proteomics 5:914-922(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Brain.

Entry informationi

Entry nameiKCNQ2_MOUSE
AccessioniPrimary (citable) accession number: Q9Z351
Secondary accession number(s): Q3UTI0
, Q8R498, Q9QWN9, Q9Z342, Q9Z343, Q9Z344, Q9Z345, Q9Z346, Q9Z347, Q9Z348, Q9Z349, Q9Z350
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 1, 2001
Last sequence update: May 1, 1999
Last modified: September 3, 2014
This is version 129 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi