Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9Z351 (KCNQ2_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 128. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Potassium voltage-gated channel subfamily KQT member 2
Alternative name(s):
KQT-like 2
Potassium channel subunit alpha KvLQT2
Voltage-gated potassium channel subunit Kv7.2
Gene names
Name:Kcnq2
Synonyms:Kqt2
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length759 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Probably important in the regulation of neuronal excitability. Associates with KCNQ3 to form a potassium channel with essentially identical properties to the channel underlying the native M-current, a slowly activating and deactivating potassium conductance which plays a critical role in determining the subthreshold electrical excitability of neurons as well as the responsiveness to synaptic inputs. Ref.4

Subunit structure

Heteromultimer with KCNQ3.

Subcellular location

Membrane; Multi-pass membrane protein.

Tissue specificity

Exclusively expressed in the brain. Expressed in every neuron-containing regions of the central nervous system examined, such as the cerebellum, cerebral cortex, occipital pole, substantia nigra, amygdala, caudate nucleus, hippocampus and thalamus. Also detected in the cochlea.

Developmental stage

Detected at day 11, 15 and 17 of the embryonic development. Expression increases by a factor of 2.5 at 1 week after birth. Then the expression level remains stable until the adult stage. The mRNAs for shorter forms (isoforms 9, 10 and 11) are specifically expressed in an embryo on the 11th day after gestation.

Domain

The segment S4 is probably the voltage-sensor and is characterized by a series of positively charged amino acids at every third position By similarity.

Sequence similarities

Belongs to the potassium channel family. KQT (TC 1.A.1.15) subfamily. Kv7.2/KCNQ2 sub-subfamily. [View classification]

Alternative products

This entry describes 13 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9Z351-1)

Also known as: MKQT2.1;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9Z351-2)

Also known as: MKQT2.2;

The sequence of this isoform differs from the canonical sequence as follows:
     562-596: IDMIVGPPPPSTPRDKKYPTKGPTAPSRESPQYSP → QEPLPVQSGHEQGPPGQNQAWHKGHQGLGD
Isoform 3 (identifier: Q9Z351-3)

Also known as: MKQT2.3;

The sequence of this isoform differs from the canonical sequence as follows:
     407-418: Missing.
Isoform 4 (identifier: Q9Z351-4)

Also known as: MKQT2.4;

The sequence of this isoform differs from the canonical sequence as follows:
     562-597: Missing.
Isoform 5 (identifier: Q9Z351-5)

Also known as: MKQT2.5;

The sequence of this isoform differs from the canonical sequence as follows:
     562-570: IDMIVGPPP → SCDWRGVLA
     571-759: Missing.
Isoform 6 (identifier: Q9Z351-6)

Also known as: MKQT2.6;

The sequence of this isoform differs from the canonical sequence as follows:
     562-623: IDMIVGPPPP...TKGPAETELP → QEPLPVQSGH...FLLCFHTVCF
     624-759: Missing.
Isoform 7 (identifier: Q9Z351-7)

Also known as: MKQT2.7;

The sequence of this isoform differs from the canonical sequence as follows:
     372-372: Y → YSSQTQTYGAS
     406-463: SQKVSLKDRV...KSWSFGDRSR → RSVPPASSRP...PGTPRVTSQL
     464-759: Missing.
Isoform 8 (identifier: Q9Z351-8)

Also known as: MKQT2.8;

The sequence of this isoform differs from the canonical sequence as follows:
     406-463: SQKVSLKDRV...KSWSFGDRSR → RSVPPASSRP...PGTPRVTSQL
     464-759: Missing.
Isoform 9 (identifier: Q9Z351-9)

Also known as: MKQT2.9;

The sequence of this isoform differs from the canonical sequence as follows:
     342-349: SAWRFYAT → GQVRCAGH
     350-759: Missing.
Isoform 10 (identifier: Q9Z351-10)

Also known as: MKQT2.10;

The sequence of this isoform differs from the canonical sequence as follows:
     342-347: SAWRFY → VSLSPC
     348-759: Missing.
Isoform 11 (identifier: Q9Z351-11)

Also known as: MKQT2.11;

The sequence of this isoform differs from the canonical sequence as follows:
     310-338: GILGSGFALKVQEQHRPKHFEKRRNPAAG → VSPAHLPTLEMLGVLEAPHKAWPWPTCEL
     339-759: Missing.
Isoform 12 (identifier: Q9Z351-12)

The sequence of this isoform differs from the canonical sequence as follows:
     372-372: Y → YSSQTQTYGAS
     406-406: S → SKGRPCRGCLCGCCPGHSS
     562-597: Missing.
     747-759: LRLERSAGMMSCH → RIPPPPAHER...GDVAWAGPRK
Isoform 13 (identifier: Q9Z351-13)

The sequence of this isoform differs from the canonical sequence as follows:
     372-372: Y → YSSQTQTYGAS
     571-606: Missing.
     747-759: LRLERSAGMMSCH → RIPPPPAHER...GDVAWAGPRK

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 759759Potassium voltage-gated channel subfamily KQT member 2
PRO_0000054031

Regions

Transmembrane92 – 11221Helical; Name=Segment S1; Potential
Topological domain113 – 12210Extracellular Potential
Transmembrane123 – 14321Helical; Name=Segment S2; Potential
Topological domain144 – 16623Cytoplasmic Potential
Transmembrane167 – 18721Helical; Name=Segment S3; Potential
Topological domain188 – 19710Extracellular Potential
Transmembrane198 – 22124Helical; Voltage-sensor; Name=Segment S4; Potential
Topological domain222 – 23110Cytoplasmic Potential
Transmembrane232 – 25221Helical; Name=Segment S5; Potential
Topological domain253 – 26412Extracellular Potential
Intramembrane265 – 28521Pore-forming; Name=Segment H5; Potential
Topological domain286 – 2916Extracellular Potential
Transmembrane292 – 31221Helical; Name=Segment S6; Potential
Topological domain313 – 759447Cytoplasmic Potential
Motif277 – 2826Selectivity filter By similarity

Amino acid modifications

Modified residue521Phosphoserine; by PKA By similarity

Natural variations

Alternative sequence310 – 33829GILGS…NPAAG → VSPAHLPTLEMLGVLEAPHK AWPWPTCEL in isoform 11.
VSP_000991
Alternative sequence339 – 759421Missing in isoform 11.
VSP_000992
Alternative sequence342 – 3498SAWRFYAT → GQVRCAGH in isoform 9.
VSP_000993
Alternative sequence342 – 3476SAWRFY → VSLSPC in isoform 10.
VSP_000995
Alternative sequence348 – 759412Missing in isoform 10.
VSP_000996
Alternative sequence350 – 759410Missing in isoform 9.
VSP_000994
Alternative sequence3721Y → YSSQTQTYGAS in isoform 7, isoform 12 and isoform 13.
VSP_000997
Alternative sequence406 – 46358SQKVS…GDRSR → RSVPPASSRPGVCCTHLALL SLCIHHVSWGRATMGPCVCF YVQQVTVCPGTPRVTSQL in isoform 7 and isoform 8.
VSP_000998
Alternative sequence4061S → SKGRPCRGCLCGCCPGHSS in isoform 12.
VSP_012365
Alternative sequence407 – 41812Missing in isoform 3.
VSP_001000
Alternative sequence464 – 759296Missing in isoform 7 and isoform 8.
VSP_000999
Alternative sequence562 – 62362IDMIV…ETELP → QEPLPVQSGHEQGPPGQNQA WHKGHQGLGDRCAEQGQYQL WRSLPTLLASCCFLLCFHTV CF in isoform 6.
VSP_001005
Alternative sequence562 – 59736Missing in isoform 4 and isoform 12.
VSP_001002
Alternative sequence562 – 59635IDMIV…PQYSP → QEPLPVQSGHEQGPPGQNQA WHKGHQGLGD in isoform 2.
VSP_001001
Alternative sequence562 – 5709IDMIVGPPP → SCDWRGVLA in isoform 5.
VSP_001003
Alternative sequence571 – 759189Missing in isoform 5.
VSP_001004
Alternative sequence571 – 60636Missing in isoform 13.
VSP_022637
Alternative sequence624 – 759136Missing in isoform 6.
VSP_001006
Alternative sequence747 – 75913LRLER…MMSCH → RIPPPPAHERSLSAYGGGNR ASTEFLRLEGTPACRPSEAA LRDSDTSISIPSVDHEELER SFSGFSISQSKENLDALGSC YAAVAPCAKVRPYIAEGESD TDSDLCTPCGPPPRSATGEG PFGDVAWAGPRK in isoform 12 and isoform 13.
VSP_012366

Experimental info

Sequence conflict1251A → P in BAA37161. Ref.1
Sequence conflict3261P → Q in BAA37160. Ref.1
Sequence conflict3261P → Q in BAA37165. Ref.1
Sequence conflict3261P → Q in AAM09696. Ref.2
Sequence conflict6001H → Q in AAM09696. Ref.2

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (MKQT2.1) [UniParc].

Last modified May 1, 1999. Version 1.
Checksum: C1D12DBFF3979D3F

FASTA75984,450
        10         20         30         40         50         60 
MVQKSRNGGV YPGTSGEKKL KVGFVGLDPG APDSTRDGAL LIAGSEAPKR GSVLSKPRTG 

        70         80         90        100        110        120 
GAGAGKPPKR NAFYRKLQNF LYNVLERPRG WAFIYHAYVF LLVFSCLVLS VFSTIKEYEK 

       130        140        150        160        170        180 
SSEGALYILE IVTIVVFGVE YFVRIWAAGC CCRYRGWRGR LKFARKPFCV IDIMVLIASI 

       190        200        210        220        230        240 
AVLAAGSQGN VFATSALRSL RFLQILRMIR MDRRGGTWKL LGSVVYAHSK ELVTAWYIGF 

       250        260        270        280        290        300 
LCLILASFLV YLAEKGENDH FDTYADALWW GLITLTTIGY GDKYPQTWNG RLLAATFTLI 

       310        320        330        340        350        360 
GVSFFALPAG ILGSGFALKV QEQHRPKHFE KRRNPAAGLI QSAWRFYATN LSRTDLHSTW 

       370        380        390        400        410        420 
QYYERTVTVP MYRLIPPLNQ LELLRNLKSK SGLTFRKEPQ PEPSPSQKVS LKDRVFSSPR 

       430        440        450        460        470        480 
GMAAKGKGSP QAQTVRRSPS ADQSLDDSPS KVPKSWSFGD RSRTRQAFRI KGAASRQNSE 

       490        500        510        520        530        540 
EASLPGEDIV EDNKSCNCEF VTEDLTPGLK VSIRAVCVMR FLVSKRKFKE SLRPYDVMDV 

       550        560        570        580        590        600 
IEQYSAGHLD MLSRIKSLQS RIDMIVGPPP PSTPRDKKYP TKGPTAPSRE SPQYSPRVDH 

       610        620        630        640        650        660 
IVGRGPTITD KDRTKGPAET ELPEDPSMMG RLGKVEKQVL SMEKKLDFLV SIYTQRMGIP 

       670        680        690        700        710        720 
PAETEAYFGA KEPEPAPPYH SPEDSRDHAD KHGCIIKIVR STSSTGQRNY AAPPAIPPAQ 

       730        740        750 
CPPSTSWQQS HQRHGTSPVG DHGSLVLRLE RSAGMMSCH 

« Hide

Isoform 2 (MKQT2.2) [UniParc].

Checksum: E5B9E1302AD1BA3A
Show »

FASTA75483,871
Isoform 3 (MKQT2.3) [UniParc].

Checksum: 7766068E0E4660FA
Show »

FASTA74783,075
Isoform 4 (MKQT2.4) [UniParc].

Checksum: B1A8D7BC05B0AAD2
Show »

FASTA72380,519
Isoform 5 (MKQT2.5) [UniParc].

Checksum: DB5DA2952C6B6D09
Show »

FASTA57063,805
Isoform 6 (MKQT2.6) [UniParc].

Checksum: 8D2C7F4729A2BAB8
Show »

FASTA62369,734
Isoform 7 (MKQT2.7) [UniParc].

Checksum: 3AFED94FA2262127
Show »

FASTA47352,651
Isoform 8 (MKQT2.8) [UniParc].

Checksum: 9E6F79DFE373028A
Show »

FASTA46351,640
Isoform 9 (MKQT2.9) [UniParc].

Checksum: 034B50C777C54EC3
Show »

FASTA34938,652
Isoform 10 (MKQT2.10) [UniParc].

Checksum: 93BEA660ADB9FA73
Show »

FASTA34738,430
Isoform 11 (MKQT2.11) [UniParc].

Checksum: 82520B7C1C01FA2F
Show »

FASTA33837,483
Isoform 12 [UniParc].

Checksum: 59C6E7B4216708AA
Show »

FASTA87095,720
Isoform 13 [UniParc].

Checksum: BB27ADF9FA5BEE5D
Show »

FASTA85293,906

References

« Hide 'large scale' references
[1]"KQT2, a new putative potassium channel family produced by alternative splicing. Isolation, genomic structure, and alternative splicing of the putative potassium channels."
Nakamura M., Watanabe H., Kubo Y., Yokoyama M., Matsumoto T., Sasai H., Nishi Y.
Recept. Channels 5:255-271(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4; 5; 6; 7; 8; 9; 10 AND 11).
Tissue: Brain.
[2]"Calmodulin is an auxiliary subunit of KCNQ2/3 potassium channels."
Wen H., Levitan I.B.
J. Neurosci. 22:7991-8001(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 12).
Strain: BALB/c.
[3]"The transcriptional landscape of the mammalian genome."
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. expand/collapse author list , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 58-759 (ISOFORM 13).
Strain: C57BL/6J.
Tissue: Brain cortex.
[4]"Disruption of the epilepsy KCNQ2 gene results in neural hyperexcitability."
Watanabe H., Nagata E., Kosakai A., Nakamura M., Yokoyama M., Tanaka K., Sasai H.
J. Neurochem. 75:28-33(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: ROLE IN NEURAL HYPEREXCITABILITY.
[5]"Comprehensive identification of phosphorylation sites in postsynaptic density preparations."
Trinidad J.C., Specht C.G., Thalhammer A., Schoepfer R., Burlingame A.L.
Mol. Cell. Proteomics 5:914-922(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Brain.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AB000494 mRNA. Translation: BAA37156.1.
AB000495 mRNA. Translation: BAA37157.1.
AB000496 mRNA. Translation: BAA37158.1.
AB000497 mRNA. Translation: BAA37159.1.
AB000498 mRNA. Translation: BAA37160.1.
AB000499 mRNA. Translation: BAA37161.1.
AB000500 mRNA. Translation: BAA37162.1.
AB000501 mRNA. Translation: BAA37163.1.
AB000502 mRNA. Translation: BAA37164.1.
AB000503 mRNA. Translation: BAA37165.1.
AB000504 mRNA. Translation: BAA37166.1.
AF490773 mRNA. Translation: AAM09696.1.
AK139411 mRNA. Translation: BAE24000.1.
CCDSCCDS17193.1. [Q9Z351-1]
CCDS17194.1. [Q9Z351-2]
CCDS17195.1. [Q9Z351-3]
CCDS17196.1. [Q9Z351-4]
CCDS17197.1. [Q9Z351-5]
CCDS17198.1. [Q9Z351-12]
CCDS17199.1. [Q9Z351-7]
CCDS17200.1. [Q9Z351-9]
CCDS50845.1. [Q9Z351-11]
CCDS50846.1. [Q9Z351-10]
CCDS50847.1. [Q9Z351-8]
CCDS50848.1. [Q9Z351-6]
RefSeqNP_001003824.1. NM_001003824.1.
NP_001003825.1. NM_001003825.2.
NP_001006669.1. NM_001006668.1.
NP_001006670.1. NM_001006669.1.
NP_001006675.1. NM_001006674.1.
NP_001006676.1. NM_001006675.1.
NP_001006677.1. NM_001006676.1.
NP_001006678.1. NM_001006677.1.
NP_001006679.1. NM_001006678.1.
NP_001006680.1. NM_001006679.1.
NP_001006681.1. NM_001006680.1. [Q9Z351-11]
NP_034741.2. NM_010611.2.
UniGeneMm.40615.
Mm.440175.

3D structure databases

ProteinModelPortalQ9Z351.
SMRQ9Z351. Positions 65-391.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid200918. 1 interaction.
IntActQ9Z351. 3 interactions.

Chemistry

BindingDBQ9Z351.
ChEMBLCHEMBL2985.

PTM databases

PhosphoSiteQ9Z351.

Proteomic databases

PaxDbQ9Z351.
PRIDEQ9Z351.

Protocols and materials databases

DNASU16536.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000123336; ENSMUSP00000130700; ENSMUSG00000016346.
ENSMUST00000129361; ENSMUSP00000131756; ENSMUSG00000016346. [Q9Z351-11]
GeneID16536.
KEGGmmu:16536.
UCSCuc008olg.1. mouse. [Q9Z351-11]

Organism-specific databases

CTD3785.
MGIMGI:1309503. Kcnq2.

Phylogenomic databases

eggNOGCOG1226.
GeneTreeENSGT00550000074513.
HOVERGENHBG059014.
KOK04927.

Gene expression databases

ArrayExpressQ9Z351.
BgeeQ9Z351.
GenevestigatorQ9Z351.

Family and domain databases

InterProIPR005821. Ion_trans_dom.
IPR003091. K_chnl.
IPR003937. K_chnl_volt-dep_KCNQ.
IPR003947. K_chnl_volt-dep_KCNQ2.
IPR013821. K_chnl_volt-dep_KCNQ_C.
IPR028325. VG_K_chnl.
[Graphical view]
PANTHERPTHR11537. PTHR11537. 1 hit.
PfamPF00520. Ion_trans. 1 hit.
PF03520. KCNQ_channel. 2 hits.
[Graphical view]
PRINTSPR00169. KCHANNEL.
PR01461. KCNQ2CHANNEL.
PR01459. KCNQCHANNEL.
ProtoNetSearch...

Other

NextBio289965.
PROQ9Z351.
SOURCESearch...

Entry information

Entry nameKCNQ2_MOUSE
AccessionPrimary (citable) accession number: Q9Z351
Secondary accession number(s): Q3UTI0 expand/collapse secondary AC list , Q8R498, Q9QWN9, Q9Z342, Q9Z343, Q9Z344, Q9Z345, Q9Z346, Q9Z347, Q9Z348, Q9Z349, Q9Z350
Entry history
Integrated into UniProtKB/Swiss-Prot: June 1, 2001
Last sequence update: May 1, 1999
Last modified: July 9, 2014
This is version 128 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot