Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Potassium voltage-gated channel subfamily KQT member 2

Gene

Kcnq2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Associates with KCNQ3 to form a potassium channel with essentially identical properties to the channel underlying the native M-current, a slowly activating and deactivating potassium conductance which plays a critical role in determining the subthreshold electrical excitability of neurons as well as the responsiveness to synaptic inputs. Therefore, it is important in the regulation of neuronal excitability.1 Publication

GO - Molecular functioni

  • ankyrin binding Source: MGI
  • calmodulin binding Source: MGI
  • voltage-gated ion channel activity Source: MGI
  • voltage-gated potassium channel activity Source: UniProtKB

GO - Biological processi

  • potassium ion transmembrane transport Source: UniProtKB
  • transmission of nerve impulse Source: MGI

Keywordsi

Molecular functionIon channel, Potassium channel, Voltage-gated channel
Biological processIon transport, Potassium transport, Transport
LigandPotassium

Names & Taxonomyi

Protein namesi
Recommended name:
Potassium voltage-gated channel subfamily KQT member 2Curated
Alternative name(s):
KQT-like 21 Publication
Potassium channel subunit alpha KvLQT2
Voltage-gated potassium channel subunit Kv7.2
Gene namesi
Name:Kcnq2Imported
Synonyms:Kqt21 Publication
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Unplaced

Organism-specific databases

MGIiMGI:1309503. Kcnq2.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 91CytoplasmicSequence analysisAdd BLAST91
Transmembranei92 – 112Helical; Name=Segment S1Sequence analysisAdd BLAST21
Topological domaini113 – 122ExtracellularSequence analysis10
Transmembranei123 – 143Helical; Name=Segment S2Sequence analysisAdd BLAST21
Topological domaini144 – 166CytoplasmicSequence analysisAdd BLAST23
Transmembranei167 – 187Helical; Name=Segment S3Sequence analysisAdd BLAST21
Topological domaini188 – 197ExtracellularSequence analysis10
Transmembranei198 – 221Helical; Voltage-sensor; Name=Segment S4Sequence analysisAdd BLAST24
Topological domaini222 – 231CytoplasmicSequence analysis10
Transmembranei232 – 252Helical; Name=Segment S5Sequence analysisAdd BLAST21
Topological domaini253 – 264ExtracellularSequence analysisAdd BLAST12
Intramembranei265 – 285Pore-forming; Name=Segment H5Sequence analysisAdd BLAST21
Topological domaini286 – 291ExtracellularSequence analysis6
Transmembranei292 – 312Helical; Name=Segment S6Sequence analysisAdd BLAST21
Topological domaini313 – 759CytoplasmicSequence analysisAdd BLAST447

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Disruption phenotypei

Mice lacking Kcnq2 present no overt phenotype, but die a few hours after birth of pulmonary atelectasis which is not due to the status of epileptic seizures.1 Publication

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi345R → E: Loss of interaction with calmodulin. 1 Publication1
Mutagenesisi525K → E: Loss of interaction with calmodulin; when associated with E-526. 1 Publication1
Mutagenesisi526R → E: Loss of interaction with calmodulin; when associated with E-525. 1 Publication1

Chemistry databases

ChEMBLiCHEMBL2985.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000540311 – 759Potassium voltage-gated channel subfamily KQT member 2Add BLAST759

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei52Phosphoserine; by PKABy similarity1
Modified residuei438PhosphoserineCombined sources1
Modified residuei440PhosphoserineCombined sources1
Modified residuei444PhosphoserineCombined sources1
Modified residuei448PhosphoserineCombined sources1
Modified residuei450PhosphoserineCombined sources1
Modified residuei479PhosphoserineBy similarity1
Modified residuei681PhosphoserineBy similarity1
Isoform 13 (identifier: Q9Z351-13)
Modified residuei813PhosphotyrosineCombined sources1
Isoform 12 (identifier: Q9Z351-12)
Modified residuei831PhosphotyrosineCombined sources1

Post-translational modificationi

KCNQ2/KCNQ3 heteromeric current can be increased by intracellular cyclic AMP, an effect that depends on phosphorylation of Ser-52 in the N-terminal region.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

PRIDEiQ9Z351.

PTM databases

iPTMnetiQ9Z351.
PhosphoSitePlusiQ9Z351.

Expressioni

Tissue specificityi

Exclusively expressed in the brain. Expressed in every neuron-containing regions of the central nervous system examined, such as the cerebellum, cerebral cortex, occipital pole, substantia nigra, amygdala, caudate nucleus, hippocampus and thalamus. Also detected in the cochlea.

Developmental stagei

Detected at day 11, 15 and 17 of the embryonic development. Expression increases by a factor of 2.5 at 1 week after birth. Then the expression level remains stable until the adult stage. The mRNAs for shorter forms (isoforms 9, 10 and 11) are specifically expressed in an embryo on the 11th day after gestation.

Interactioni

Subunit structurei

Heterotetramer with KCNQ3; form the heterotetrameric M potassium channel (By similarity). Interacts with calmodulin; the interaction is calcium-independent, constitutive and participates to the proper assembly of a functional heterotetrameric M channel (PubMed:12223552). May associate with KCNE2 (By similarity).By similarity1 Publication

GO - Molecular functioni

  • ankyrin binding Source: MGI
  • calmodulin binding Source: MGI

Protein-protein interaction databases

BioGridi200918. 1 interactor.
CORUMiQ9Z351.
IntActiQ9Z351. 3 interactors.

Chemistry databases

BindingDBiQ9Z351.

Structurei

3D structure databases

ProteinModelPortaliQ9Z351.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni317 – 512Mediates interaction with calmodulinBy similarityAdd BLAST196

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi277 – 282Selectivity filterBy similarity6

Domaini

The segment S4 is probably the voltage-sensor and is characterized by a series of positively charged amino acids at every third position.By similarity

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

HOVERGENiHBG059014.
InParanoidiQ9Z351.
KOiK04927.

Family and domain databases

InterProiView protein in InterPro
IPR005821. Ion_trans_dom.
IPR003937. K_chnl_volt-dep_KCNQ.
IPR003947. K_chnl_volt-dep_KCNQ2.
IPR013821. K_chnl_volt-dep_KCNQ_C.
IPR028325. VG_K_chnl.
PANTHERiPTHR11537. PTHR11537. 1 hit.
PfamiView protein in Pfam
PF00520. Ion_trans. 1 hit.
PF03520. KCNQ_channel. 2 hits.
PRINTSiPR00169. KCHANNEL.
PR01461. KCNQ2CHANNEL.
PR01459. KCNQCHANNEL.

Sequences (13)i

Sequence statusi: Complete.

This entry describes 13 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9Z351-1) [UniParc]FASTAAdd to basket
Also known as: MKQT2.1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVQKSRNGGV YPGTSGEKKL KVGFVGLDPG APDSTRDGAL LIAGSEAPKR
60 70 80 90 100
GSVLSKPRTG GAGAGKPPKR NAFYRKLQNF LYNVLERPRG WAFIYHAYVF
110 120 130 140 150
LLVFSCLVLS VFSTIKEYEK SSEGALYILE IVTIVVFGVE YFVRIWAAGC
160 170 180 190 200
CCRYRGWRGR LKFARKPFCV IDIMVLIASI AVLAAGSQGN VFATSALRSL
210 220 230 240 250
RFLQILRMIR MDRRGGTWKL LGSVVYAHSK ELVTAWYIGF LCLILASFLV
260 270 280 290 300
YLAEKGENDH FDTYADALWW GLITLTTIGY GDKYPQTWNG RLLAATFTLI
310 320 330 340 350
GVSFFALPAG ILGSGFALKV QEQHRPKHFE KRRNPAAGLI QSAWRFYATN
360 370 380 390 400
LSRTDLHSTW QYYERTVTVP MYRLIPPLNQ LELLRNLKSK SGLTFRKEPQ
410 420 430 440 450
PEPSPSQKVS LKDRVFSSPR GMAAKGKGSP QAQTVRRSPS ADQSLDDSPS
460 470 480 490 500
KVPKSWSFGD RSRTRQAFRI KGAASRQNSE EASLPGEDIV EDNKSCNCEF
510 520 530 540 550
VTEDLTPGLK VSIRAVCVMR FLVSKRKFKE SLRPYDVMDV IEQYSAGHLD
560 570 580 590 600
MLSRIKSLQS RIDMIVGPPP PSTPRDKKYP TKGPTAPSRE SPQYSPRVDH
610 620 630 640 650
IVGRGPTITD KDRTKGPAET ELPEDPSMMG RLGKVEKQVL SMEKKLDFLV
660 670 680 690 700
SIYTQRMGIP PAETEAYFGA KEPEPAPPYH SPEDSRDHAD KHGCIIKIVR
710 720 730 740 750
STSSTGQRNY AAPPAIPPAQ CPPSTSWQQS HQRHGTSPVG DHGSLVLRLE

RSAGMMSCH
Length:759
Mass (Da):84,450
Last modified:May 1, 1999 - v1
Checksum:iC1D12DBFF3979D3F
GO
Isoform 2 (identifier: Q9Z351-2) [UniParc]FASTAAdd to basket
Also known as: MKQT2.2

The sequence of this isoform differs from the canonical sequence as follows:
     562-596: IDMIVGPPPPSTPRDKKYPTKGPTAPSRESPQYSP → QEPLPVQSGHEQGPPGQNQAWHKGHQGLGD

Show »
Length:754
Mass (Da):83,871
Checksum:iE5B9E1302AD1BA3A
GO
Isoform 3 (identifier: Q9Z351-3) [UniParc]FASTAAdd to basket
Also known as: MKQT2.3

The sequence of this isoform differs from the canonical sequence as follows:
     407-418: Missing.

Show »
Length:747
Mass (Da):83,075
Checksum:i7766068E0E4660FA
GO
Isoform 4 (identifier: Q9Z351-4) [UniParc]FASTAAdd to basket
Also known as: MKQT2.4

The sequence of this isoform differs from the canonical sequence as follows:
     562-597: Missing.

Show »
Length:723
Mass (Da):80,519
Checksum:iB1A8D7BC05B0AAD2
GO
Isoform 5 (identifier: Q9Z351-5) [UniParc]FASTAAdd to basket
Also known as: MKQT2.5

The sequence of this isoform differs from the canonical sequence as follows:
     562-570: IDMIVGPPP → SCDWRGVLA
     571-759: Missing.

Show »
Length:570
Mass (Da):63,805
Checksum:iDB5DA2952C6B6D09
GO
Isoform 6 (identifier: Q9Z351-6) [UniParc]FASTAAdd to basket
Also known as: MKQT2.6

The sequence of this isoform differs from the canonical sequence as follows:
     562-623: IDMIVGPPPP...TKGPAETELP → QEPLPVQSGH...FLLCFHTVCF
     624-759: Missing.

Note: May be due to an intron retention.
Show »
Length:623
Mass (Da):69,734
Checksum:i8D2C7F4729A2BAB8
GO
Isoform 7 (identifier: Q9Z351-7) [UniParc]FASTAAdd to basket
Also known as: MKQT2.7

The sequence of this isoform differs from the canonical sequence as follows:
     372-372: Y → YSSQTQTYGAS
     406-463: SQKVSLKDRV...KSWSFGDRSR → RSVPPASSRP...PGTPRVTSQL
     464-759: Missing.

Note: May be due to an intron retention.
Show »
Length:473
Mass (Da):52,651
Checksum:i3AFED94FA2262127
GO
Isoform 8 (identifier: Q9Z351-8) [UniParc]FASTAAdd to basket
Also known as: MKQT2.8

The sequence of this isoform differs from the canonical sequence as follows:
     406-463: SQKVSLKDRV...KSWSFGDRSR → RSVPPASSRP...PGTPRVTSQL
     464-759: Missing.

Note: May be due to an intron retention.
Show »
Length:463
Mass (Da):51,640
Checksum:i9E6F79DFE373028A
GO
Isoform 9 (identifier: Q9Z351-9) [UniParc]FASTAAdd to basket
Also known as: MKQT2.9

The sequence of this isoform differs from the canonical sequence as follows:
     342-349: SAWRFYAT → GQVRCAGH
     350-759: Missing.

Note: May be due to an intron retention.
Show »
Length:349
Mass (Da):38,652
Checksum:i034B50C777C54EC3
GO
Isoform 10 (identifier: Q9Z351-10) [UniParc]FASTAAdd to basket
Also known as: MKQT2.10

The sequence of this isoform differs from the canonical sequence as follows:
     342-347: SAWRFY → VSLSPC
     348-759: Missing.

Note: May be due to an intron retention.
Show »
Length:347
Mass (Da):38,430
Checksum:i93BEA660ADB9FA73
GO
Isoform 11 (identifier: Q9Z351-11) [UniParc]FASTAAdd to basket
Also known as: MKQT2.11

The sequence of this isoform differs from the canonical sequence as follows:
     310-338: GILGSGFALKVQEQHRPKHFEKRRNPAAG → VSPAHLPTLEMLGVLEAPHKAWPWPTCEL
     339-759: Missing.

Note: May be due to an intron retention.
Show »
Length:338
Mass (Da):37,483
Checksum:i82520B7C1C01FA2F
GO
Isoform 12 (identifier: Q9Z351-12) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     372-372: Y → YSSQTQTYGAS
     406-406: S → SKGRPCRGCLCGCCPGHSS
     562-597: Missing.
     747-759: LRLERSAGMMSCH → RIPPPPAHER...GDVAWAGPRK

Show »
Length:870
Mass (Da):95,720
Checksum:i59C6E7B4216708AA
GO
Isoform 13 (identifier: Q9Z351-13) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     372-372: Y → YSSQTQTYGAS
     571-606: Missing.
     747-759: LRLERSAGMMSCH → RIPPPPAHER...GDVAWAGPRK

Show »
Length:852
Mass (Da):93,906
Checksum:iBB27ADF9FA5BEE5D
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti125A → P in BAA37161 (PubMed:9666519).Curated1
Sequence conflicti326P → Q in BAA37160 (PubMed:9666519).Curated1
Sequence conflicti326P → Q in BAA37165 (PubMed:9666519).Curated1
Sequence conflicti326P → Q in AAM09696 (PubMed:12223552).Curated1
Sequence conflicti600H → Q in AAM09696 (PubMed:12223552).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_000991310 – 338GILGS…NPAAG → VSPAHLPTLEMLGVLEAPHK AWPWPTCEL in isoform 11. 1 PublicationAdd BLAST29
Alternative sequenceiVSP_000992339 – 759Missing in isoform 11. 1 PublicationAdd BLAST421
Alternative sequenceiVSP_000993342 – 349SAWRFYAT → GQVRCAGH in isoform 9. 1 Publication8
Alternative sequenceiVSP_000995342 – 347SAWRFY → VSLSPC in isoform 10. 1 Publication6
Alternative sequenceiVSP_000996348 – 759Missing in isoform 10. 1 PublicationAdd BLAST412
Alternative sequenceiVSP_000994350 – 759Missing in isoform 9. 1 PublicationAdd BLAST410
Alternative sequenceiVSP_000997372Y → YSSQTQTYGAS in isoform 7, isoform 12 and isoform 13. 3 Publications1
Alternative sequenceiVSP_000998406 – 463SQKVS…GDRSR → RSVPPASSRPGVCCTHLALL SLCIHHVSWGRATMGPCVCF YVQQVTVCPGTPRVTSQL in isoform 7 and isoform 8. 1 PublicationAdd BLAST58
Alternative sequenceiVSP_012365406S → SKGRPCRGCLCGCCPGHSS in isoform 12. 1 Publication1
Alternative sequenceiVSP_001000407 – 418Missing in isoform 3. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_000999464 – 759Missing in isoform 7 and isoform 8. 1 PublicationAdd BLAST296
Alternative sequenceiVSP_001005562 – 623IDMIV…ETELP → QEPLPVQSGHEQGPPGQNQA WHKGHQGLGDRCAEQGQYQL WRSLPTLLASCCFLLCFHTV CF in isoform 6. 1 PublicationAdd BLAST62
Alternative sequenceiVSP_001002562 – 597Missing in isoform 4 and isoform 12. 2 PublicationsAdd BLAST36
Alternative sequenceiVSP_001001562 – 596IDMIV…PQYSP → QEPLPVQSGHEQGPPGQNQA WHKGHQGLGD in isoform 2. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_001003562 – 570IDMIVGPPP → SCDWRGVLA in isoform 5. 1 Publication9
Alternative sequenceiVSP_001004571 – 759Missing in isoform 5. 1 PublicationAdd BLAST189
Alternative sequenceiVSP_022637571 – 606Missing in isoform 13. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_001006624 – 759Missing in isoform 6. 1 PublicationAdd BLAST136
Alternative sequenceiVSP_012366747 – 759LRLER…MMSCH → RIPPPPAHERSLSAYGGGNR ASTEFLRLEGTPACRPSEAA LRDSDTSISIPSVDHEELER SFSGFSISQSKENLDALGSC YAAVAPCAKVRPYIAEGESD TDSDLCTPCGPPPRSATGEG PFGDVAWAGPRK in isoform 12 and isoform 13. 2 PublicationsAdd BLAST13

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB000494 mRNA. Translation: BAA37156.1.
AB000495 mRNA. Translation: BAA37157.1.
AB000496 mRNA. Translation: BAA37158.1.
AB000497 mRNA. Translation: BAA37159.1.
AB000498 mRNA. Translation: BAA37160.1.
AB000499 mRNA. Translation: BAA37161.1.
AB000500 mRNA. Translation: BAA37162.1.
AB000501 mRNA. Translation: BAA37163.1.
AB000502 mRNA. Translation: BAA37164.1.
AB000503 mRNA. Translation: BAA37165.1.
AB000504 mRNA. Translation: BAA37166.1.
AF490773 mRNA. Translation: AAM09696.1.
AK139411 mRNA. Translation: BAE24000.1.
CCDSiCCDS17193.1. [Q9Z351-1]
CCDS17194.1. [Q9Z351-2]
CCDS17195.1. [Q9Z351-3]
CCDS17196.1. [Q9Z351-4]
CCDS17197.1. [Q9Z351-5]
CCDS17198.1. [Q9Z351-12]
RefSeqiNP_001006675.1. NM_001006674.2.
NP_001289817.1. NM_001302888.1.
NP_034741.2. NM_010611.3.
UniGeneiMm.40615.
Mm.440175.

Genome annotation databases

GeneIDi16536.
KEGGimmu:16536.
UCSCiuc008olg.2. mouse. [Q9Z351-11]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiKCNQ2_MOUSE
AccessioniPrimary (citable) accession number: Q9Z351
Secondary accession number(s): Q3UTI0
, Q8R498, Q9QWN9, Q9Z342, Q9Z343, Q9Z344, Q9Z345, Q9Z346, Q9Z347, Q9Z348, Q9Z349, Q9Z350
Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 1, 2001
Last sequence update: May 1, 1999
Last modified: September 27, 2017
This is version 156 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families