Q9Z351 (KCNQ2_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 116.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Potassium voltage-gated channel subfamily KQT member 2 Alternative name(s): KQT-like 2 Potassium channel subunit alpha KvLQT2 Voltage-gated potassium channel subunit Kv7.2 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 759 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Probably important in the regulation of neuronal excitability. Associates with KCNQ3 to form a potassium channel with essentially identical properties to the channel underlying the native M-current, a slowly activating and deactivating potassium conductance which plays a critical role in determining the subthreshold electrical excitability of neurons as well as the responsiveness to synaptic inputs. Ref.4 |
| Subunit structure | Heteromultimer with KCNQ3. |
| Subcellular location | |
| Tissue specificity | Exclusively expressed in the brain. Expressed in every neuron-containing regions of the central nervous system examined, such as the cerebellum, cerebral cortex, occipital pole, substantia nigra, amygdala, caudate nucleus, hippocampus and thalamus. Also detected in the cochlea. |
| Developmental stage | Detected at day 11, 15 and 17 of the embryonic development. Expression increases by a factor of 2.5 at 1 week after birth. Then the expression level remains stable until the adult stage. The mRNAs for shorter forms (isoforms 9, 10 and 11) are specifically expressed in an embryo on the 11th day after gestation. |
| Domain | The segment S4 is probably the voltage-sensor and is characterized by a series of positively charged amino acids at every third position By similarity. |
| Sequence similarities | Belongs to the potassium channel family. KQT (TC 1.A.1.15) subfamily. Kv7.2/KCNQ2 sub-subfamily. [View classification] |
Ontologies
| Keywords | |
|---|---|
| Biological process | Ion transport Potassium transport Transport |
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Transmembrane Transmembrane helix |
| Ligand | Potassium |
| Molecular function | Ion channel Potassium channel Voltage-gated channel |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | transmission of nerve impulse Inferred from mutant phenotype Ref.4. Source: MGI |
| Cellular_component | axon initial segment Inferred from direct assay PubMed 16525039. Source: BHF-UCL node of RanvierInferred from direct assay PubMed 16525039. Source: BHF-UCL plasma membraneInferred from direct assay PubMed 16525039. Source: BHF-UCL voltage-gated potassium channel complexInferred from electronic annotation. Source: InterPro |
| Molecular_function | delayed rectifier potassium channel activity Inferred from Biological aspect of Ancestor. Source: RefGenome |
| Complete GO annotation... | |
Alternative products
| This entry describes 13 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9Z351-1) Also known as: MKQT2.1; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9Z351-2) Also known as: MKQT2.2; The sequence of this isoform differs from the canonical sequence as follows: 562-596: IDMIVGPPPPSTPRDKKYPTKGPTAPSRESPQYSP → QEPLPVQSGHEQGPPGQNQAWHKGHQGLGD | ||||||
| Isoform 3 (identifier: Q9Z351-3) Also known as: MKQT2.3; The sequence of this isoform differs from the canonical sequence as follows: 407-418: Missing. | ||||||
| Isoform 4 (identifier: Q9Z351-4) Also known as: MKQT2.4; The sequence of this isoform differs from the canonical sequence as follows: 562-597: Missing. | ||||||
| Isoform 5 (identifier: Q9Z351-5) Also known as: MKQT2.5; The sequence of this isoform differs from the canonical sequence as follows: 562-570: IDMIVGPPP → SCDWRGVLA 571-759: Missing. | ||||||
| Isoform 6 (identifier: Q9Z351-6) Also known as: MKQT2.6; The sequence of this isoform differs from the canonical sequence as follows: 562-623: IDMIVGPPPP...TKGPAETELP → QEPLPVQSGH...FLLCFHTVCF 624-759: Missing. | ||||||
| Isoform 7 (identifier: Q9Z351-7) Also known as: MKQT2.7; The sequence of this isoform differs from the canonical sequence as follows: 372-372: Y → YSSQTQTYGAS 406-463: SQKVSLKDRV...KSWSFGDRSR → RSVPPASSRP...PGTPRVTSQL 464-759: Missing. | ||||||
| Isoform 8 (identifier: Q9Z351-8) Also known as: MKQT2.8; The sequence of this isoform differs from the canonical sequence as follows: 406-463: SQKVSLKDRV...KSWSFGDRSR → RSVPPASSRP...PGTPRVTSQL 464-759: Missing. | ||||||
| Isoform 9 (identifier: Q9Z351-9) Also known as: MKQT2.9; The sequence of this isoform differs from the canonical sequence as follows: 342-349: SAWRFYAT → GQVRCAGH 350-759: Missing. | ||||||
| Isoform 10 (identifier: Q9Z351-10) Also known as: MKQT2.10; The sequence of this isoform differs from the canonical sequence as follows: 342-347: SAWRFY → VSLSPC 348-759: Missing. | ||||||
| Isoform 11 (identifier: Q9Z351-11) Also known as: MKQT2.11; The sequence of this isoform differs from the canonical sequence as follows: 310-338: GILGSGFALKVQEQHRPKHFEKRRNPAAG → VSPAHLPTLEMLGVLEAPHKAWPWPTCEL 339-759: Missing. | ||||||
| Isoform 12 (identifier: Q9Z351-12) The sequence of this isoform differs from the canonical sequence as follows: 372-372: Y → YSSQTQTYGAS 406-406: S → SKGRPCRGCLCGCCPGHSS 562-597: Missing. 747-759: LRLERSAGMMSCH → RIPPPPAHER...GDVAWAGPRK | ||||||
| Isoform 13 (identifier: Q9Z351-13) The sequence of this isoform differs from the canonical sequence as follows: 372-372: Y → YSSQTQTYGAS 571-606: Missing. 747-759: LRLERSAGMMSCH → RIPPPPAHER...GDVAWAGPRK |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 759 | 759 | Potassium voltage-gated channel subfamily KQT member 2 | PRO_0000054031 | |||||
Regions | |||||||||
| Transmembrane | 92 – 112 | 21 | Helical; Name=Segment S1; Potential | ||||||
| Topological domain | 113 – 122 | 10 | Extracellular Potential | ||||||
| Transmembrane | 123 – 143 | 21 | Helical; Name=Segment S2; Potential | ||||||
| Topological domain | 144 – 166 | 23 | Cytoplasmic Potential | ||||||
| Transmembrane | 167 – 187 | 21 | Helical; Name=Segment S3; Potential | ||||||
| Topological domain | 188 – 197 | 10 | Extracellular Potential | ||||||
| Transmembrane | 198 – 221 | 24 | Helical; Voltage-sensor; Name=Segment S4; Potential | ||||||
| Topological domain | 222 – 231 | 10 | Cytoplasmic Potential | ||||||
| Transmembrane | 232 – 252 | 21 | Helical; Name=Segment S5; Potential | ||||||
| Topological domain | 253 – 264 | 12 | Extracellular Potential | ||||||
| Intramembrane | 265 – 285 | 21 | Pore-forming; Name=Segment H5; Potential | ||||||
| Topological domain | 286 – 291 | 6 | Extracellular Potential | ||||||
| Transmembrane | 292 – 312 | 21 | Helical; Name=Segment S6; Potential | ||||||
| Topological domain | 313 – 759 | 447 | Cytoplasmic Potential | ||||||
| Motif | 277 – 282 | 6 | Selectivity filter By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 52 | 1 | Phosphoserine; by PKA By similarity | ||||||
| Modified residue | 217 | 1 | Phosphothreonine By similarity | ||||||
| Modified residue | 438 | 1 | Phosphoserine Ref.5 | ||||||
| Modified residue | 440 | 1 | Phosphoserine Ref.5 | ||||||
Natural variations | |||||||||
| Alternative sequence | 310 – 338 | 29 | GILGS…NPAAG → VSPAHLPTLEMLGVLEAPHK AWPWPTCEL in isoform 11. | VSP_000991 | |||||
| Alternative sequence | 339 – 759 | 421 | Missing in isoform 11. | VSP_000992 | |||||
| Alternative sequence | 342 – 349 | 8 | SAWRFYAT → GQVRCAGH in isoform 9. | VSP_000993 | |||||
| Alternative sequence | 342 – 347 | 6 | SAWRFY → VSLSPC in isoform 10. | VSP_000995 | |||||
| Alternative sequence | 348 – 759 | 412 | Missing in isoform 10. | VSP_000996 | |||||
| Alternative sequence | 350 – 759 | 410 | Missing in isoform 9. | VSP_000994 | |||||
| Alternative sequence | 372 | 1 | Y → YSSQTQTYGAS in isoform 7, isoform 12 and isoform 13. | VSP_000997 | |||||
| Alternative sequence | 406 – 463 | 58 | SQKVS…GDRSR → RSVPPASSRPGVCCTHLALL SLCIHHVSWGRATMGPCVCF YVQQVTVCPGTPRVTSQL in isoform 7 and isoform 8. | VSP_000998 | |||||
| Alternative sequence | 406 | 1 | S → SKGRPCRGCLCGCCPGHSS in isoform 12. | VSP_012365 | |||||
| Alternative sequence | 407 – 418 | 12 | Missing in isoform 3. | VSP_001000 | |||||
| Alternative sequence | 464 – 759 | 296 | Missing in isoform 7 and isoform 8. | VSP_000999 | |||||
| Alternative sequence | 562 – 623 | 62 | IDMIV…ETELP → QEPLPVQSGHEQGPPGQNQA WHKGHQGLGDRCAEQGQYQL WRSLPTLLASCCFLLCFHTV CF in isoform 6. | VSP_001005 | |||||
| Alternative sequence | 562 – 597 | 36 | Missing in isoform 4 and isoform 12. | VSP_001002 | |||||
| Alternative sequence | 562 – 596 | 35 | IDMIV…PQYSP → QEPLPVQSGHEQGPPGQNQA WHKGHQGLGD in isoform 2. | VSP_001001 | |||||
| Alternative sequence | 562 – 570 | 9 | IDMIVGPPP → SCDWRGVLA in isoform 5. | VSP_001003 | |||||
| Alternative sequence | 571 – 759 | 189 | Missing in isoform 5. | VSP_001004 | |||||
| Alternative sequence | 571 – 606 | 36 | Missing in isoform 13. | VSP_022637 | |||||
| Alternative sequence | 624 – 759 | 136 | Missing in isoform 6. | VSP_001006 | |||||
| Alternative sequence | 747 – 759 | 13 | LRLER…MMSCH → RIPPPPAHERSLSAYGGGNR ASTEFLRLEGTPACRPSEAA LRDSDTSISIPSVDHEELER SFSGFSISQSKENLDALGSC YAAVAPCAKVRPYIAEGESD TDSDLCTPCGPPPRSATGEG PFGDVAWAGPRK in isoform 12 and isoform 13. | VSP_012366 | |||||
Experimental info | |||||||||
| Sequence conflict | 125 | 1 | A → P in BAA37161. Ref.1 | ||||||
| Sequence conflict | 326 | 1 | P → Q in BAA37160. Ref.1 | ||||||
| Sequence conflict | 326 | 1 | P → Q in BAA37165. Ref.1 | ||||||
| Sequence conflict | 326 | 1 | P → Q in AAM09696. Ref.2 | ||||||
| Sequence conflict | 600 | 1 | H → Q in AAM09696. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "KQT2, a new putative potassium channel family produced by alternative splicing. Isolation, genomic structure, and alternative splicing of the putative potassium channels." Nakamura M., Watanabe H., Kubo Y., Yokoyama M., Matsumoto T., Sasai H., Nishi Y. Recept. Channels 5:255-271(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4; 5; 6; 7; 8; 9; 10 AND 11). Tissue: Brain. |
| [2] | "Calmodulin is an auxiliary subunit of KCNQ2/3 potassium channels." Wen H., Levitan I.B. J. Neurosci. 22:7991-8001(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 12). Strain: BALB/c. |
| [3] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 58-759 (ISOFORM 13). Strain: C57BL/6J. Tissue: Brain cortex. |
| [4] | "Disruption of the epilepsy KCNQ2 gene results in neural hyperexcitability." Watanabe H., Nagata E., Kosakai A., Nakamura M., Yokoyama M., Tanaka K., Sasai H. J. Neurochem. 75:28-33(2000) [PubMed] [Europe PMC] [Abstract] Cited for: ROLE IN NEURAL HYPEREXCITABILITY. |
| [5] | "Qualitative and quantitative analyses of protein phosphorylation in naive and stimulated mouse synaptosomal preparations." Munton R.P., Tweedie-Cullen R., Livingstone-Zatchej M., Weinandy F., Waidelich M., Longo D., Gehrig P., Potthast F., Rutishauser D., Gerrits B., Panse C., Schlapbach R., Mansuy I.M. Mol. Cell. Proteomics 6:283-293(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-438 AND SER-440, MASS SPECTROMETRY. Tissue: Brain cortex. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB000494 mRNA. Translation: BAA37156.1. AB000495 mRNA. Translation: BAA37157.1. AB000496 mRNA. Translation: BAA37158.1. AB000497 mRNA. Translation: BAA37159.1. AB000498 mRNA. Translation: BAA37160.1. AB000499 mRNA. Translation: BAA37161.1. AB000500 mRNA. Translation: BAA37162.1. AB000501 mRNA. Translation: BAA37163.1. AB000502 mRNA. Translation: BAA37164.1. AB000503 mRNA. Translation: BAA37165.1. AB000504 mRNA. Translation: BAA37166.1. AF490773 mRNA. Translation: AAM09696.1. AK139411 mRNA. Translation: BAE24000.1. |
| IPI | IPI00227840. IPI00229672. IPI00229673. IPI00229676. IPI00229677. IPI00229678. IPI00229679. IPI00230658. IPI00230659. IPI00463003. IPI00474530. IPI00751435. IPI00922989. |
| RefSeq | NP_001003824.1. NM_001003824.1. NP_001003825.1. NM_001003825.2. NP_001006669.1. NM_001006668.1. NP_001006670.1. NM_001006669.1. NP_001006675.1. NM_001006674.1. NP_001006676.1. NM_001006675.1. NP_001006677.1. NM_001006676.1. NP_001006678.1. NM_001006677.1. NP_001006679.1. NM_001006678.1. NP_001006680.1. NM_001006679.1. NP_001006681.1. NM_001006680.1. NP_034741.2. NM_010611.2. |
| UniGene | Mm.40615. Mm.440175. |
3D structure databases | |
| ProteinModelPortal | Q9Z351. |
| SMR | Q9Z351. Positions 65-316, 503-528. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9Z351. 3 interactions. |
PTM databases | |
| PhosphoSite | Q9Z351. |
Proteomic databases | |
| PaxDb | Q9Z351. |
| PRIDE | Q9Z351. |
Protocols and materials databases | |
| DNASU | 16536. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000123336; ENSMUSP00000130700; ENSMUSG00000016346. ENSMUST00000129361; ENSMUSP00000131756; ENSMUSG00000016346. |
| GeneID | 16536. |
| KEGG | mmu:16536. |
| UCSC | uc008olb.1. mouse. uc008olc.1. mouse. uc008old.1. mouse. uc008olg.1. mouse. |
Organism-specific databases | |
| CTD | 3785. |
| MGI | MGI:1309503. Kcnq2. |
Phylogenomic databases | |
| eggNOG | COG1226. |
| GeneTree | ENSGT00550000074513. |
| HOVERGEN | HBG059014. |
| KO | K04927. |
| OrthoDB | EOG41VK29. |
Gene expression databases | |
| ArrayExpress | Q9Z351. |
| Bgee | Q9Z351. |
| Genevestigator | Q9Z351. |
| GermOnline | ENSMUSG00000016346. Mus musculus. |
Family and domain databases | |
| InterPro | IPR005821. Ion_trans_dom. IPR003091. K_chnl. IPR003937. K_chnl_volt-dep_KCNQ. IPR003947. K_chnl_volt-dep_KCNQ2. IPR013821. K_chnl_volt-dep_KCNQ_C. [Graphical view] |
| PANTHER | PTHR11537. PTHR11537. 1 hit. |
| Pfam | PF00520. Ion_trans. 1 hit. PF03520. KCNQ_channel. 2 hits. [Graphical view] |
| PRINTS | PR00169. KCHANNEL. PR01461. KCNQ2CHANNEL. PR01459. KCNQCHANNEL. |
| ProtoNet | Search... |
Other | |
| BindingDB | Q9Z351. |
| ChEMBL | CHEMBL2985. |
| NextBio | 289965. |
| SOURCE | Search... |
Entry information
| Entry name | KCNQ2_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q9Z351 Secondary accession number(s): Q3UTI0 Q9Z350 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| Recent format changes Overview of recent format changes |
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
