Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9Z351

- KCNQ2_MOUSE

UniProt

Q9Z351 - KCNQ2_MOUSE

Protein

Potassium voltage-gated channel subfamily KQT member 2

Gene

Kcnq2

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 130 (01 Oct 2014)
      Sequence version 1 (01 May 1999)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Probably important in the regulation of neuronal excitability. Associates with KCNQ3 to form a potassium channel with essentially identical properties to the channel underlying the native M-current, a slowly activating and deactivating potassium conductance which plays a critical role in determining the subthreshold electrical excitability of neurons as well as the responsiveness to synaptic inputs.1 Publication

    GO - Molecular functioni

    1. delayed rectifier potassium channel activity Source: RefGenome

    GO - Biological processi

    1. transmission of nerve impulse Source: MGI

    Keywords - Molecular functioni

    Ion channel, Potassium channel, Voltage-gated channel

    Keywords - Biological processi

    Ion transport, Potassium transport, Transport

    Keywords - Ligandi

    Potassium

    Enzyme and pathway databases

    ReactomeiREACT_199077. Voltage gated Potassium channels.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Potassium voltage-gated channel subfamily KQT member 2
    Alternative name(s):
    KQT-like 2
    Potassium channel subunit alpha KvLQT2
    Voltage-gated potassium channel subunit Kv7.2
    Gene namesi
    Name:Kcnq2
    Synonyms:Kqt2
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 2

    Organism-specific databases

    MGIiMGI:1309503. Kcnq2.

    Subcellular locationi

    GO - Cellular componenti

    1. axon initial segment Source: BHF-UCL
    2. node of Ranvier Source: BHF-UCL
    3. plasma membrane Source: BHF-UCL
    4. voltage-gated potassium channel complex Source: InterPro

    Keywords - Cellular componenti

    Membrane

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 759759Potassium voltage-gated channel subfamily KQT member 2PRO_0000054031Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei52 – 521Phosphoserine; by PKABy similarity

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    PaxDbiQ9Z351.
    PRIDEiQ9Z351.

    PTM databases

    PhosphoSiteiQ9Z351.

    Expressioni

    Tissue specificityi

    Exclusively expressed in the brain. Expressed in every neuron-containing regions of the central nervous system examined, such as the cerebellum, cerebral cortex, occipital pole, substantia nigra, amygdala, caudate nucleus, hippocampus and thalamus. Also detected in the cochlea.

    Developmental stagei

    Detected at day 11, 15 and 17 of the embryonic development. Expression increases by a factor of 2.5 at 1 week after birth. Then the expression level remains stable until the adult stage. The mRNAs for shorter forms (isoforms 9, 10 and 11) are specifically expressed in an embryo on the 11th day after gestation.

    Gene expression databases

    ArrayExpressiQ9Z351.
    BgeeiQ9Z351.
    GenevestigatoriQ9Z351.

    Interactioni

    Subunit structurei

    Heteromultimer with KCNQ3.

    Protein-protein interaction databases

    BioGridi200918. 1 interaction.
    IntActiQ9Z351. 3 interactions.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9Z351.
    SMRiQ9Z351. Positions 65-391.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini113 – 12210ExtracellularSequence Analysis
    Topological domaini144 – 16623CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini188 – 19710ExtracellularSequence Analysis
    Topological domaini222 – 23110CytoplasmicSequence Analysis
    Topological domaini253 – 26412ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini286 – 2916ExtracellularSequence Analysis
    Topological domaini313 – 759447CytoplasmicSequence AnalysisAdd
    BLAST

    Intramembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Intramembranei265 – 28521Pore-forming; Name=Segment H5Sequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei92 – 11221Helical; Name=Segment S1Sequence AnalysisAdd
    BLAST
    Transmembranei123 – 14321Helical; Name=Segment S2Sequence AnalysisAdd
    BLAST
    Transmembranei167 – 18721Helical; Name=Segment S3Sequence AnalysisAdd
    BLAST
    Transmembranei198 – 22124Helical; Voltage-sensor; Name=Segment S4Sequence AnalysisAdd
    BLAST
    Transmembranei232 – 25221Helical; Name=Segment S5Sequence AnalysisAdd
    BLAST
    Transmembranei292 – 31221Helical; Name=Segment S6Sequence AnalysisAdd
    BLAST

    Family & Domainsi

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi277 – 2826Selectivity filterBy similarity

    Domaini

    The segment S4 is probably the voltage-sensor and is characterized by a series of positively charged amino acids at every third position.By similarity

    Sequence similaritiesi

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiCOG1226.
    GeneTreeiENSGT00550000074513.
    HOVERGENiHBG059014.
    KOiK04927.

    Family and domain databases

    InterProiIPR005821. Ion_trans_dom.
    IPR003091. K_chnl.
    IPR003937. K_chnl_volt-dep_KCNQ.
    IPR003947. K_chnl_volt-dep_KCNQ2.
    IPR013821. K_chnl_volt-dep_KCNQ_C.
    IPR028325. VG_K_chnl.
    [Graphical view]
    PANTHERiPTHR11537. PTHR11537. 1 hit.
    PfamiPF00520. Ion_trans. 1 hit.
    PF03520. KCNQ_channel. 2 hits.
    [Graphical view]
    PRINTSiPR00169. KCHANNEL.
    PR01461. KCNQ2CHANNEL.
    PR01459. KCNQCHANNEL.

    Sequences (13)i

    Sequence statusi: Complete.

    This entry describes 13 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9Z351-1) [UniParc]FASTAAdd to Basket

    Also known as: MKQT2.1

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MVQKSRNGGV YPGTSGEKKL KVGFVGLDPG APDSTRDGAL LIAGSEAPKR    50
    GSVLSKPRTG GAGAGKPPKR NAFYRKLQNF LYNVLERPRG WAFIYHAYVF 100
    LLVFSCLVLS VFSTIKEYEK SSEGALYILE IVTIVVFGVE YFVRIWAAGC 150
    CCRYRGWRGR LKFARKPFCV IDIMVLIASI AVLAAGSQGN VFATSALRSL 200
    RFLQILRMIR MDRRGGTWKL LGSVVYAHSK ELVTAWYIGF LCLILASFLV 250
    YLAEKGENDH FDTYADALWW GLITLTTIGY GDKYPQTWNG RLLAATFTLI 300
    GVSFFALPAG ILGSGFALKV QEQHRPKHFE KRRNPAAGLI QSAWRFYATN 350
    LSRTDLHSTW QYYERTVTVP MYRLIPPLNQ LELLRNLKSK SGLTFRKEPQ 400
    PEPSPSQKVS LKDRVFSSPR GMAAKGKGSP QAQTVRRSPS ADQSLDDSPS 450
    KVPKSWSFGD RSRTRQAFRI KGAASRQNSE EASLPGEDIV EDNKSCNCEF 500
    VTEDLTPGLK VSIRAVCVMR FLVSKRKFKE SLRPYDVMDV IEQYSAGHLD 550
    MLSRIKSLQS RIDMIVGPPP PSTPRDKKYP TKGPTAPSRE SPQYSPRVDH 600
    IVGRGPTITD KDRTKGPAET ELPEDPSMMG RLGKVEKQVL SMEKKLDFLV 650
    SIYTQRMGIP PAETEAYFGA KEPEPAPPYH SPEDSRDHAD KHGCIIKIVR 700
    STSSTGQRNY AAPPAIPPAQ CPPSTSWQQS HQRHGTSPVG DHGSLVLRLE 750
    RSAGMMSCH 759
    Length:759
    Mass (Da):84,450
    Last modified:May 1, 1999 - v1
    Checksum:iC1D12DBFF3979D3F
    GO
    Isoform 2 (identifier: Q9Z351-2) [UniParc]FASTAAdd to Basket

    Also known as: MKQT2.2

    The sequence of this isoform differs from the canonical sequence as follows:
         562-596: IDMIVGPPPPSTPRDKKYPTKGPTAPSRESPQYSP → QEPLPVQSGHEQGPPGQNQAWHKGHQGLGD

    Show »
    Length:754
    Mass (Da):83,871
    Checksum:iE5B9E1302AD1BA3A
    GO
    Isoform 3 (identifier: Q9Z351-3) [UniParc]FASTAAdd to Basket

    Also known as: MKQT2.3

    The sequence of this isoform differs from the canonical sequence as follows:
         407-418: Missing.

    Show »
    Length:747
    Mass (Da):83,075
    Checksum:i7766068E0E4660FA
    GO
    Isoform 4 (identifier: Q9Z351-4) [UniParc]FASTAAdd to Basket

    Also known as: MKQT2.4

    The sequence of this isoform differs from the canonical sequence as follows:
         562-597: Missing.

    Show »
    Length:723
    Mass (Da):80,519
    Checksum:iB1A8D7BC05B0AAD2
    GO
    Isoform 5 (identifier: Q9Z351-5) [UniParc]FASTAAdd to Basket

    Also known as: MKQT2.5

    The sequence of this isoform differs from the canonical sequence as follows:
         562-570: IDMIVGPPP → SCDWRGVLA
         571-759: Missing.

    Show »
    Length:570
    Mass (Da):63,805
    Checksum:iDB5DA2952C6B6D09
    GO
    Isoform 6 (identifier: Q9Z351-6) [UniParc]FASTAAdd to Basket

    Also known as: MKQT2.6

    The sequence of this isoform differs from the canonical sequence as follows:
         562-623: IDMIVGPPPP...TKGPAETELP → QEPLPVQSGH...FLLCFHTVCF
         624-759: Missing.

    Show »
    Length:623
    Mass (Da):69,734
    Checksum:i8D2C7F4729A2BAB8
    GO
    Isoform 7 (identifier: Q9Z351-7) [UniParc]FASTAAdd to Basket

    Also known as: MKQT2.7

    The sequence of this isoform differs from the canonical sequence as follows:
         372-372: Y → YSSQTQTYGAS
         406-463: SQKVSLKDRV...KSWSFGDRSR → RSVPPASSRP...PGTPRVTSQL
         464-759: Missing.

    Show »
    Length:473
    Mass (Da):52,651
    Checksum:i3AFED94FA2262127
    GO
    Isoform 8 (identifier: Q9Z351-8) [UniParc]FASTAAdd to Basket

    Also known as: MKQT2.8

    The sequence of this isoform differs from the canonical sequence as follows:
         406-463: SQKVSLKDRV...KSWSFGDRSR → RSVPPASSRP...PGTPRVTSQL
         464-759: Missing.

    Show »
    Length:463
    Mass (Da):51,640
    Checksum:i9E6F79DFE373028A
    GO
    Isoform 9 (identifier: Q9Z351-9) [UniParc]FASTAAdd to Basket

    Also known as: MKQT2.9

    The sequence of this isoform differs from the canonical sequence as follows:
         342-349: SAWRFYAT → GQVRCAGH
         350-759: Missing.

    Show »
    Length:349
    Mass (Da):38,652
    Checksum:i034B50C777C54EC3
    GO
    Isoform 10 (identifier: Q9Z351-10) [UniParc]FASTAAdd to Basket

    Also known as: MKQT2.10

    The sequence of this isoform differs from the canonical sequence as follows:
         342-347: SAWRFY → VSLSPC
         348-759: Missing.

    Show »
    Length:347
    Mass (Da):38,430
    Checksum:i93BEA660ADB9FA73
    GO
    Isoform 11 (identifier: Q9Z351-11) [UniParc]FASTAAdd to Basket

    Also known as: MKQT2.11

    The sequence of this isoform differs from the canonical sequence as follows:
         310-338: GILGSGFALKVQEQHRPKHFEKRRNPAAG → VSPAHLPTLEMLGVLEAPHKAWPWPTCEL
         339-759: Missing.

    Show »
    Length:338
    Mass (Da):37,483
    Checksum:i82520B7C1C01FA2F
    GO
    Isoform 12 (identifier: Q9Z351-12) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         372-372: Y → YSSQTQTYGAS
         406-406: S → SKGRPCRGCLCGCCPGHSS
         562-597: Missing.
         747-759: LRLERSAGMMSCH → RIPPPPAHER...GDVAWAGPRK

    Show »
    Length:870
    Mass (Da):95,720
    Checksum:i59C6E7B4216708AA
    GO
    Isoform 13 (identifier: Q9Z351-13) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         372-372: Y → YSSQTQTYGAS
         571-606: Missing.
         747-759: LRLERSAGMMSCH → RIPPPPAHER...GDVAWAGPRK

    Show »
    Length:852
    Mass (Da):93,906
    Checksum:iBB27ADF9FA5BEE5D
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti125 – 1251A → P in BAA37161. (PubMed:9666519)Curated
    Sequence conflicti326 – 3261P → Q in BAA37160. (PubMed:9666519)Curated
    Sequence conflicti326 – 3261P → Q in BAA37165. (PubMed:9666519)Curated
    Sequence conflicti326 – 3261P → Q in AAM09696. (PubMed:12223552)Curated
    Sequence conflicti600 – 6001H → Q in AAM09696. (PubMed:12223552)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei310 – 33829GILGS…NPAAG → VSPAHLPTLEMLGVLEAPHK AWPWPTCEL in isoform 11. 1 PublicationVSP_000991Add
    BLAST
    Alternative sequencei339 – 759421Missing in isoform 11. 1 PublicationVSP_000992Add
    BLAST
    Alternative sequencei342 – 3498SAWRFYAT → GQVRCAGH in isoform 9. 1 PublicationVSP_000993
    Alternative sequencei342 – 3476SAWRFY → VSLSPC in isoform 10. 1 PublicationVSP_000995
    Alternative sequencei348 – 759412Missing in isoform 10. 1 PublicationVSP_000996Add
    BLAST
    Alternative sequencei350 – 759410Missing in isoform 9. 1 PublicationVSP_000994Add
    BLAST
    Alternative sequencei372 – 3721Y → YSSQTQTYGAS in isoform 7, isoform 12 and isoform 13. 3 PublicationsVSP_000997
    Alternative sequencei406 – 46358SQKVS…GDRSR → RSVPPASSRPGVCCTHLALL SLCIHHVSWGRATMGPCVCF YVQQVTVCPGTPRVTSQL in isoform 7 and isoform 8. 1 PublicationVSP_000998Add
    BLAST
    Alternative sequencei406 – 4061S → SKGRPCRGCLCGCCPGHSS in isoform 12. 1 PublicationVSP_012365
    Alternative sequencei407 – 41812Missing in isoform 3. 1 PublicationVSP_001000Add
    BLAST
    Alternative sequencei464 – 759296Missing in isoform 7 and isoform 8. 1 PublicationVSP_000999Add
    BLAST
    Alternative sequencei562 – 62362IDMIV…ETELP → QEPLPVQSGHEQGPPGQNQA WHKGHQGLGDRCAEQGQYQL WRSLPTLLASCCFLLCFHTV CF in isoform 6. 1 PublicationVSP_001005Add
    BLAST
    Alternative sequencei562 – 59736Missing in isoform 4 and isoform 12. 2 PublicationsVSP_001002Add
    BLAST
    Alternative sequencei562 – 59635IDMIV…PQYSP → QEPLPVQSGHEQGPPGQNQA WHKGHQGLGD in isoform 2. 1 PublicationVSP_001001Add
    BLAST
    Alternative sequencei562 – 5709IDMIVGPPP → SCDWRGVLA in isoform 5. 1 PublicationVSP_001003
    Alternative sequencei571 – 759189Missing in isoform 5. 1 PublicationVSP_001004Add
    BLAST
    Alternative sequencei571 – 60636Missing in isoform 13. 1 PublicationVSP_022637Add
    BLAST
    Alternative sequencei624 – 759136Missing in isoform 6. 1 PublicationVSP_001006Add
    BLAST
    Alternative sequencei747 – 75913LRLER…MMSCH → RIPPPPAHERSLSAYGGGNR ASTEFLRLEGTPACRPSEAA LRDSDTSISIPSVDHEELER SFSGFSISQSKENLDALGSC YAAVAPCAKVRPYIAEGESD TDSDLCTPCGPPPRSATGEG PFGDVAWAGPRK in isoform 12 and isoform 13. 2 PublicationsVSP_012366Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB000494 mRNA. Translation: BAA37156.1.
    AB000495 mRNA. Translation: BAA37157.1.
    AB000496 mRNA. Translation: BAA37158.1.
    AB000497 mRNA. Translation: BAA37159.1.
    AB000498 mRNA. Translation: BAA37160.1.
    AB000499 mRNA. Translation: BAA37161.1.
    AB000500 mRNA. Translation: BAA37162.1.
    AB000501 mRNA. Translation: BAA37163.1.
    AB000502 mRNA. Translation: BAA37164.1.
    AB000503 mRNA. Translation: BAA37165.1.
    AB000504 mRNA. Translation: BAA37166.1.
    AF490773 mRNA. Translation: AAM09696.1.
    AK139411 mRNA. Translation: BAE24000.1.
    CCDSiCCDS17193.1. [Q9Z351-1]
    CCDS17194.1. [Q9Z351-2]
    CCDS17195.1. [Q9Z351-3]
    CCDS17196.1. [Q9Z351-4]
    CCDS17197.1. [Q9Z351-5]
    CCDS17198.1. [Q9Z351-12]
    CCDS17199.1. [Q9Z351-7]
    CCDS17200.1. [Q9Z351-9]
    CCDS50845.1. [Q9Z351-11]
    CCDS50846.1. [Q9Z351-10]
    CCDS50847.1. [Q9Z351-8]
    CCDS50848.1. [Q9Z351-6]
    RefSeqiNP_001003824.1. NM_001003824.1.
    NP_001003825.1. NM_001003825.2.
    NP_001006669.1. NM_001006668.1.
    NP_001006670.1. NM_001006669.1.
    NP_001006675.1. NM_001006674.1.
    NP_001006676.1. NM_001006675.1.
    NP_001006677.1. NM_001006676.1.
    NP_001006678.1. NM_001006677.1.
    NP_001006679.1. NM_001006678.1.
    NP_001006680.1. NM_001006679.1.
    NP_001006681.1. NM_001006680.1. [Q9Z351-11]
    NP_034741.2. NM_010611.2.
    UniGeneiMm.40615.
    Mm.440175.

    Genome annotation databases

    EnsembliENSMUST00000123336; ENSMUSP00000130700; ENSMUSG00000016346.
    ENSMUST00000129361; ENSMUSP00000131756; ENSMUSG00000016346. [Q9Z351-11]
    GeneIDi16536.
    KEGGimmu:16536.
    UCSCiuc008olg.1. mouse. [Q9Z351-11]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB000494 mRNA. Translation: BAA37156.1 .
    AB000495 mRNA. Translation: BAA37157.1 .
    AB000496 mRNA. Translation: BAA37158.1 .
    AB000497 mRNA. Translation: BAA37159.1 .
    AB000498 mRNA. Translation: BAA37160.1 .
    AB000499 mRNA. Translation: BAA37161.1 .
    AB000500 mRNA. Translation: BAA37162.1 .
    AB000501 mRNA. Translation: BAA37163.1 .
    AB000502 mRNA. Translation: BAA37164.1 .
    AB000503 mRNA. Translation: BAA37165.1 .
    AB000504 mRNA. Translation: BAA37166.1 .
    AF490773 mRNA. Translation: AAM09696.1 .
    AK139411 mRNA. Translation: BAE24000.1 .
    CCDSi CCDS17193.1. [Q9Z351-1 ]
    CCDS17194.1. [Q9Z351-2 ]
    CCDS17195.1. [Q9Z351-3 ]
    CCDS17196.1. [Q9Z351-4 ]
    CCDS17197.1. [Q9Z351-5 ]
    CCDS17198.1. [Q9Z351-12 ]
    CCDS17199.1. [Q9Z351-7 ]
    CCDS17200.1. [Q9Z351-9 ]
    CCDS50845.1. [Q9Z351-11 ]
    CCDS50846.1. [Q9Z351-10 ]
    CCDS50847.1. [Q9Z351-8 ]
    CCDS50848.1. [Q9Z351-6 ]
    RefSeqi NP_001003824.1. NM_001003824.1.
    NP_001003825.1. NM_001003825.2.
    NP_001006669.1. NM_001006668.1.
    NP_001006670.1. NM_001006669.1.
    NP_001006675.1. NM_001006674.1.
    NP_001006676.1. NM_001006675.1.
    NP_001006677.1. NM_001006676.1.
    NP_001006678.1. NM_001006677.1.
    NP_001006679.1. NM_001006678.1.
    NP_001006680.1. NM_001006679.1.
    NP_001006681.1. NM_001006680.1. [Q9Z351-11 ]
    NP_034741.2. NM_010611.2.
    UniGenei Mm.40615.
    Mm.440175.

    3D structure databases

    ProteinModelPortali Q9Z351.
    SMRi Q9Z351. Positions 65-391.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 200918. 1 interaction.
    IntActi Q9Z351. 3 interactions.

    Chemistry

    BindingDBi Q9Z351.
    ChEMBLi CHEMBL2985.

    PTM databases

    PhosphoSitei Q9Z351.

    Proteomic databases

    PaxDbi Q9Z351.
    PRIDEi Q9Z351.

    Protocols and materials databases

    DNASUi 16536.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000123336 ; ENSMUSP00000130700 ; ENSMUSG00000016346 .
    ENSMUST00000129361 ; ENSMUSP00000131756 ; ENSMUSG00000016346 . [Q9Z351-11 ]
    GeneIDi 16536.
    KEGGi mmu:16536.
    UCSCi uc008olg.1. mouse. [Q9Z351-11 ]

    Organism-specific databases

    CTDi 3785.
    MGIi MGI:1309503. Kcnq2.

    Phylogenomic databases

    eggNOGi COG1226.
    GeneTreei ENSGT00550000074513.
    HOVERGENi HBG059014.
    KOi K04927.

    Enzyme and pathway databases

    Reactomei REACT_199077. Voltage gated Potassium channels.

    Miscellaneous databases

    NextBioi 289965.
    PROi Q9Z351.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9Z351.
    Bgeei Q9Z351.
    Genevestigatori Q9Z351.

    Family and domain databases

    InterProi IPR005821. Ion_trans_dom.
    IPR003091. K_chnl.
    IPR003937. K_chnl_volt-dep_KCNQ.
    IPR003947. K_chnl_volt-dep_KCNQ2.
    IPR013821. K_chnl_volt-dep_KCNQ_C.
    IPR028325. VG_K_chnl.
    [Graphical view ]
    PANTHERi PTHR11537. PTHR11537. 1 hit.
    Pfami PF00520. Ion_trans. 1 hit.
    PF03520. KCNQ_channel. 2 hits.
    [Graphical view ]
    PRINTSi PR00169. KCHANNEL.
    PR01461. KCNQ2CHANNEL.
    PR01459. KCNQCHANNEL.
    ProtoNeti Search...

    Publicationsi

    1. "KQT2, a new putative potassium channel family produced by alternative splicing. Isolation, genomic structure, and alternative splicing of the putative potassium channels."
      Nakamura M., Watanabe H., Kubo Y., Yokoyama M., Matsumoto T., Sasai H., Nishi Y.
      Recept. Channels 5:255-271(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4; 5; 6; 7; 8; 9; 10 AND 11).
      Tissue: Brain.
    2. "Calmodulin is an auxiliary subunit of KCNQ2/3 potassium channels."
      Wen H., Levitan I.B.
      J. Neurosci. 22:7991-8001(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 12).
      Strain: BALB/c.
    3. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 58-759 (ISOFORM 13).
      Strain: C57BL/6J.
      Tissue: Brain cortex.
    4. "Disruption of the epilepsy KCNQ2 gene results in neural hyperexcitability."
      Watanabe H., Nagata E., Kosakai A., Nakamura M., Yokoyama M., Tanaka K., Sasai H.
      J. Neurochem. 75:28-33(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: ROLE IN NEURAL HYPEREXCITABILITY.
    5. "Comprehensive identification of phosphorylation sites in postsynaptic density preparations."
      Trinidad J.C., Specht C.G., Thalhammer A., Schoepfer R., Burlingame A.L.
      Mol. Cell. Proteomics 5:914-922(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Brain.

    Entry informationi

    Entry nameiKCNQ2_MOUSE
    AccessioniPrimary (citable) accession number: Q9Z351
    Secondary accession number(s): Q3UTI0
    , Q8R498, Q9QWN9, Q9Z342, Q9Z343, Q9Z344, Q9Z345, Q9Z346, Q9Z347, Q9Z348, Q9Z349, Q9Z350
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: June 1, 2001
    Last sequence update: May 1, 1999
    Last modified: October 1, 2014
    This is version 130 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3