Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein sel-1 homolog 1

Gene

Sel1l

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Plays a role in the endoplasmic reticulum quality control (ERQC) system also called ER-associated degradation (ERAD) involved in ubiquitin-dependent degradation of misfolded endoplasmic reticulum proteins (PubMed:25066055, PubMed:24453213). Enhances SYVN1 stability (PubMed:24453213). Plays a role in LPL maturation and secretion (PubMed:25066055). Required for normal differentiation of the pancreas epithelium, and for normal exocrine function and survival of pancreatic cells (PubMed:20170518, PubMed:24453213). May play a role in Notch signaling (PubMed:20170518).3 Publications

GO - Biological processi

  • ERAD pathway Source: UniProtKB
  • Notch signaling pathway Source: UniProtKB-KW
  • protein secretion Source: UniProtKB
  • response to endoplasmic reticulum stress Source: MGI
  • retrograde protein transport, ER to cytosol Source: MGI
  • triglyceride metabolic process Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

Notch signaling pathway

Enzyme and pathway databases

ReactomeiR-MMU-1912420. Pre-NOTCH Processing in Golgi.
R-MMU-382556. ABC-family proteins mediated transport.
R-MMU-5358346. Hedgehog ligand biogenesis.
R-MMU-901032. ER Quality Control Compartment (ERQC).

Names & Taxonomyi

Protein namesi
Recommended name:
Protein sel-1 homolog 1
Alternative name(s):
Suppressor of lin-12-like protein 1
Short name:
Sel-1L
Gene namesi
Name:Sel1l
Synonyms:Sel1h
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 12

Organism-specific databases

MGIiMGI:1329016. Sel1l.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini22 – 734LumenalSequence analysisAdd BLAST713
Transmembranei735 – 755HelicalSequence analysisAdd BLAST21
Topological domaini756 – 790CytoplasmicSequence analysisAdd BLAST35

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane

Pathology & Biotechi

Disruption phenotypei

Taxomifen-inducible gene disruption in adult mice leads to premature death within 3 weeks after the onset of taxomifen treatment. Mice progressively loose weight and become moribund despite increased food intake and normal blood glucose levels, suggesting nutrient maladsorption. After eight days of treatment, the pancreas was diffusely dark red and soft, suggesting severe pancreas atrophy. Still, the endocrine parts of the pancreas were not affected. Pancreas weight was about half of that of wild-type, the size of secretory zymogen granules was reduced and pancreatic lipase and alpha-amylase levels were strongly reduced. Besides, the morphology of the endoplasmic reticulum in pancreas acinar cells was abnormal, with swollen and fragmented cisternae. Likewise, SYVN1 protein levels are decreased, while those of other ERAD markers are increased (PubMed:24453213). Adipocyte-specific gene disruption does not give rise to any obvious phenotype when mice are kept on a low-fat diet. Mutant mice are resistant to diet-induced obesity when kept on a high-fat diet, in spite of normal food intake and physical activity. Mutant mice show dramatically reduced accumulation of fat mass relative to wild-type, while lean mass is not affected. Intriguingly, mutant mice display enlarged livers that develop steatosis and increased triglyceride levels. Mutant mice display increased fasting serum triglyceride and insulin levels. Likewise, mutant mice display hypertriglyceridemia after feeding, especially on a high-fat diet. In spite of increased cellular LPL levels, LPL secretion is reduced by 80 to 90% (PubMed:25066055).2 Publications

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi512 – 513GG → KK: Abolishes homodimerization. 1 Publication2
Mutagenesisi515 – 516IL → AA: Abolishes homodimerization; when associated with A-519. 1 Publication2
Mutagenesisi519Y → A: Abolishes homodimerization; when associated with 515-A-A-516. 1 Publication1
Mutagenesisi521L → A: Abolishes homodimerization. 1 Publication1

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 21Sequence analysisAdd BLAST21
ChainiPRO_000002229622 – 790Protein sel-1 homolog 1Add BLAST769

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei64PhosphoserineBy similarity1
Disulfide bondi123 ↔ 149PROSITE-ProRule annotation
Disulfide bondi137 ↔ 164PROSITE-ProRule annotation
Glycosylationi191N-linked (GlcNAc...)Sequence analysis1
Glycosylationi213N-linked (GlcNAc...)Sequence analysis1
Glycosylationi268N-linked (GlcNAc...)Sequence analysis1
Glycosylationi427N-linked (GlcNAc...)Sequence analysis1
Glycosylationi604N-linked (GlcNAc...)Sequence analysis1

Post-translational modificationi

N-glycosylated.1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiQ9Z2G6.
PRIDEiQ9Z2G6.

PTM databases

PhosphoSitePlusiQ9Z2G6.

Expressioni

Tissue specificityi

Highly expressed in pancreas, white adipose tissue, liver and spleen (at protein level) (PubMed:25066055, PubMed:24453213). Detected in heart, brain, spleen, lung, liver, kidney and testis (PubMed:9858735).3 Publications

Developmental stagei

First detected at 12.5 dpc in a small number of pancreas epithelial cells. Highly expressed in embryonic pancreas epithelium at later stages of embryonic development.1 Publication

Gene expression databases

BgeeiENSMUSG00000020964.
CleanExiMM_SEL1L.
ExpressionAtlasiQ9Z2G6. baseline and differential.
GenevisibleiQ9Z2G6. MM.

Interactioni

Subunit structurei

Homodimer and homooligomer (PubMed:27064360). Interacts with SYVN1; the interaction is direct (PubMed:25066055, PubMed:27064360). Part of a complex containing SEL1L, SYVN1 and DERL2. May form a complex with ERLEC1, HSPA5, OS9, and SYVN1. Interacts with FOXRED2 and EDEM1 (By similarity). Interacts with LPL and LMF1; may stabilize the complex formed by LPL and LMF1 and thereby promote the export of LPL dimers (PubMed:25066055).By similarity2 Publications

Protein-protein interaction databases

BioGridi203153. 5 interactors.
DIPiDIP-61846N.
IntActiQ9Z2G6. 7 interactors.
MINTiMINT-4134046.
STRINGi10090.ENSMUSP00000021347.

Structurei

Secondary structure

1790
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi354 – 365Combined sources12
Helixi369 – 381Combined sources13
Helixi390 – 402Combined sources13
Helixi406 – 417Combined sources12
Beta strandi421 – 423Combined sources3
Helixi427 – 439Combined sources13
Helixi443 – 454Combined sources12
Beta strandi457 – 459Combined sources3
Helixi463 – 475Combined sources13
Helixi479 – 490Combined sources12
Beta strandi493 – 496Combined sources4
Helixi499 – 510Combined sources12
Helixi517 – 521Combined sources5

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5B26X-ray2.60A/B/C/D348-533[»]
ProteinModelPortaliQ9Z2G6.
SMRiQ9Z2G6.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini118 – 166Fibronectin type-IIPROSITE-ProRule annotationAdd BLAST49
Repeati179 – 214Sel1-like 1Add BLAST36
Repeati215 – 250Sel1-like 2Add BLAST36
Repeati251 – 286Sel1-like 3Add BLAST36
Repeati287 – 322Sel1-like 4Add BLAST36
Repeati369 – 405Sel1-like 5Add BLAST37
Repeati406 – 442Sel1-like 6Add BLAST37
Repeati443 – 478Sel1-like 7Add BLAST36
Repeati479 – 514Sel1-like 8Add BLAST36
Repeati515 – 550Sel1-like 9Add BLAST36
Repeati623 – 658Sel1-like 10Add BLAST36
Repeati660 – 695Sel1-like 11Add BLAST36

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni23 – 733Interaction with ERLEC1, OS9 and SYVN1By similarityAdd BLAST711
Regioni348 – 533Important for homodimerization and oligomerization1 PublicationAdd BLAST186
Regioni639 – 719Interaction with SYVN11 PublicationAdd BLAST81
Regioni734 – 790Mediates retention in the endoplasmic reticulumBy similarityAdd BLAST57

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi766 – 789Pro-richAdd BLAST24

Sequence similaritiesi

Belongs to the sel-1 family.Curated
Contains 1 fibronectin type-II domain.PROSITE-ProRule annotation
Contains 11 Sel1-like repeats.Curated

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG1550. Eukaryota.
COG0790. LUCA.
GeneTreeiENSGT00530000063170.
HOVERGENiHBG057766.
InParanoidiQ9Z2G6.
KOiK14026.
OMAiNHTKAME.
OrthoDBiEOG091G0315.
TreeFamiTF315257.

Family and domain databases

CDDicd00062. FN2. 1 hit.
Gene3Di1.25.40.10. 3 hits.
2.10.10.10. 1 hit.
InterProiIPR000562. FN_type2_col-bd.
IPR013806. Kringle-like.
IPR006597. Sel1-like.
IPR011990. TPR-like_helical_dom.
[Graphical view]
PfamiPF00040. fn2. 1 hit.
PF08238. Sel1. 12 hits.
[Graphical view]
SMARTiSM00059. FN2. 1 hit.
SM00671. SEL1. 11 hits.
[Graphical view]
SUPFAMiSSF57440. SSF57440. 1 hit.
PROSITEiPS00023. FN2_1. 1 hit.
PS51092. FN2_2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9Z2G6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQVRVRLSLL LLCAVLLGSA AATSDDKTNQ DDSLDSKSSL PTDESVKDHT
60 70 80 90 100
TTGKVVAGQI FVDSEEAEVE SLLQDEEDSS KTQEEEISFL ESPNPSSKTY
110 120 130 140 150
EELKRVRKPV LTAIEGTAHG EPCHFPFLFL DKEYDECTSD GREDGRLWCA
160 170 180 190 200
TTYDYKTDEK WGFCETEEDA AKRRQMQEAE MIYQAGMKIL NGSNRKSQKR
210 220 230 240 250
EAYRYLQKAA GMNHTKALER VSYALLFGDY LTQNIQAAKE MFEKLTEEGS
260 270 280 290 300
PKGQTGLGFL YASGLGVNSS QAKALVYYTF GALGGNLIAH MILGYRYWAG
310 320 330 340 350
IGVLQSCESA LTHYRLVANH VASDISLTGG SVVQRIRLPD EVENPGMNSG
360 370 380 390 400
MLEEDLIQYY QFLAEKGDVQ AQVGLGQLHL HGGRGVEQNH QRAFDYFNLA
410 420 430 440 450
ANAGNSHAMA FLGKMYSEGS DIVPQSNETA LHYFKKAADM GNPVGQSGLG
460 470 480 490 500
MAYLYGRGVQ VNYDLALKYF QKAAEQGWVD GQLQLGSMYY NGIGVKRDYK
510 520 530 540 550
QALKYFNLAS QGGHILAFYN LAQMHASGTG VMRSCHTAVE LFKNVCERGR
560 570 580 590 600
WSERLMTAYN SYKDEDYNAA VVQYLLLAEQ GYEVAQSNAA FILDQREATI
610 620 630 640 650
VGENETYPRA LLHWNRAASQ GYTVARIKLG DYHFYGFGTD VDYETAFIHY
660 670 680 690 700
RLASEQQHSA QAMFNLGYMH EKGLGIKQDI HLAKRFYDMA AEASPDAQVP
710 720 730 740 750
VFLALCKLGV VYFLQYIREA NIRDLFTQLD MDQLLGPEWD LYLMTIIALL
760 770 780 790
LGTVIAYRQR QHQDIPVPRP PGPRPAPPQQ EGPPEQQPPQ
Length:790
Mass (Da):88,340
Last modified:April 27, 2001 - v2
Checksum:i47869F2AFB59B936
GO
Isoform 2 (identifier: Q9Z2G6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     116-166: GTAHGEPCHFPFLFLDKEYDECTSDGREDGRLWCATTYDYKTDEKWGFCET → A

Note: No experimental confirmation available.
Show »
Length:740
Mass (Da):82,457
Checksum:iB51D80A451C28AB1
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_004384116 – 166GTAHG…GFCET → A in isoform 2. 1 PublicationAdd BLAST51

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF063095 mRNA. Translation: AAD05210.1.
AK005023 mRNA. Translation: BAB23750.1.
CCDSiCCDS26091.1. [Q9Z2G6-1]
CCDS49137.1. [Q9Z2G6-2]
RefSeqiNP_001034178.1. NM_001039089.1. [Q9Z2G6-1]
NP_035474.1. NM_011344.2. [Q9Z2G6-2]
UniGeneiMm.250605.

Genome annotation databases

EnsembliENSMUST00000021347; ENSMUSP00000021347; ENSMUSG00000020964. [Q9Z2G6-1]
ENSMUST00000167466; ENSMUSP00000129384; ENSMUSG00000020964. [Q9Z2G6-2]
GeneIDi20338.
KEGGimmu:20338.
UCSCiuc007oky.1. mouse. [Q9Z2G6-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF063095 mRNA. Translation: AAD05210.1.
AK005023 mRNA. Translation: BAB23750.1.
CCDSiCCDS26091.1. [Q9Z2G6-1]
CCDS49137.1. [Q9Z2G6-2]
RefSeqiNP_001034178.1. NM_001039089.1. [Q9Z2G6-1]
NP_035474.1. NM_011344.2. [Q9Z2G6-2]
UniGeneiMm.250605.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5B26X-ray2.60A/B/C/D348-533[»]
ProteinModelPortaliQ9Z2G6.
SMRiQ9Z2G6.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi203153. 5 interactors.
DIPiDIP-61846N.
IntActiQ9Z2G6. 7 interactors.
MINTiMINT-4134046.
STRINGi10090.ENSMUSP00000021347.

PTM databases

PhosphoSitePlusiQ9Z2G6.

Proteomic databases

PaxDbiQ9Z2G6.
PRIDEiQ9Z2G6.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000021347; ENSMUSP00000021347; ENSMUSG00000020964. [Q9Z2G6-1]
ENSMUST00000167466; ENSMUSP00000129384; ENSMUSG00000020964. [Q9Z2G6-2]
GeneIDi20338.
KEGGimmu:20338.
UCSCiuc007oky.1. mouse. [Q9Z2G6-1]

Organism-specific databases

CTDi6400.
MGIiMGI:1329016. Sel1l.

Phylogenomic databases

eggNOGiKOG1550. Eukaryota.
COG0790. LUCA.
GeneTreeiENSGT00530000063170.
HOVERGENiHBG057766.
InParanoidiQ9Z2G6.
KOiK14026.
OMAiNHTKAME.
OrthoDBiEOG091G0315.
TreeFamiTF315257.

Enzyme and pathway databases

ReactomeiR-MMU-1912420. Pre-NOTCH Processing in Golgi.
R-MMU-382556. ABC-family proteins mediated transport.
R-MMU-5358346. Hedgehog ligand biogenesis.
R-MMU-901032. ER Quality Control Compartment (ERQC).

Miscellaneous databases

ChiTaRSiSel1l. mouse.
PROiQ9Z2G6.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000020964.
CleanExiMM_SEL1L.
ExpressionAtlasiQ9Z2G6. baseline and differential.
GenevisibleiQ9Z2G6. MM.

Family and domain databases

CDDicd00062. FN2. 1 hit.
Gene3Di1.25.40.10. 3 hits.
2.10.10.10. 1 hit.
InterProiIPR000562. FN_type2_col-bd.
IPR013806. Kringle-like.
IPR006597. Sel1-like.
IPR011990. TPR-like_helical_dom.
[Graphical view]
PfamiPF00040. fn2. 1 hit.
PF08238. Sel1. 12 hits.
[Graphical view]
SMARTiSM00059. FN2. 1 hit.
SM00671. SEL1. 11 hits.
[Graphical view]
SUPFAMiSSF57440. SSF57440. 1 hit.
PROSITEiPS00023. FN2_1. 1 hit.
PS51092. FN2_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiSE1L1_MOUSE
AccessioniPrimary (citable) accession number: Q9Z2G6
Secondary accession number(s): Q9DBD8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 27, 2001
Last sequence update: April 27, 2001
Last modified: November 2, 2016
This is version 138 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Miscellaneous

Gene disruption after residue 465 and replacement of the C-terminus with a beta-galactosidase-neomycin reporter gene construct leads to complete embryonic lethality; most die before 13.5 dpc. Only 5% of the embryos are viable at 15.5 dpc. Mutant embryos display defects in the differentiation of the pancreas epithelium. The defects in pancreas differentiation can be alleviated by pharmacological inhibition of Notch signaling (in vitro).1 Publication

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.