Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein sel-1 homolog 1

Gene

Sel1l

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

May play a role in Notch signaling. May be involved in the endoplasmic reticulum quality control (ERQC) system also called ER-associated degradation (ERAD) involved in ubiquitin-dependent degradation of misfolded endoplasmic reticulum proteins (By similarity).By similarity

GO - Biological processi

  • ERAD pathway Source: MGI
  • Notch signaling pathway Source: UniProtKB-KW
  • response to endoplasmic reticulum stress Source: MGI
  • retrograde protein transport, ER to cytosol Source: MGI
Complete GO annotation...

Keywords - Biological processi

Notch signaling pathway

Enzyme and pathway databases

ReactomeiR-MMU-1912420. Pre-NOTCH Processing in Golgi.
R-MMU-5358346. Hedgehog ligand biogenesis.
R-MMU-901032. ER Quality Control Compartment (ERQC).

Names & Taxonomyi

Protein namesi
Recommended name:
Protein sel-1 homolog 1
Alternative name(s):
Suppressor of lin-12-like protein 1
Short name:
Sel-1L
Gene namesi
Name:Sel1l
Synonyms:Sel1h
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 12

Organism-specific databases

MGIiMGI:1329016. Sel1l.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini22 – 734713LumenalSequence analysisAdd
BLAST
Transmembranei735 – 75521HelicalSequence analysisAdd
BLAST
Topological domaini756 – 79035CytoplasmicSequence analysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2121Sequence analysisAdd
BLAST
Chaini22 – 790769Protein sel-1 homolog 1PRO_0000022296Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei64 – 641PhosphoserineBy similarity
Disulfide bondi123 ↔ 149PROSITE-ProRule annotation
Disulfide bondi137 ↔ 164PROSITE-ProRule annotation
Glycosylationi191 – 1911N-linked (GlcNAc...)Sequence analysis
Glycosylationi213 – 2131N-linked (GlcNAc...)Sequence analysis
Glycosylationi268 – 2681N-linked (GlcNAc...)Sequence analysis
Glycosylationi427 – 4271N-linked (GlcNAc...)Sequence analysis
Glycosylationi604 – 6041N-linked (GlcNAc...)Sequence analysis

Post-translational modificationi

N-glycosylated.By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

EPDiQ9Z2G6.
MaxQBiQ9Z2G6.
PaxDbiQ9Z2G6.
PRIDEiQ9Z2G6.

PTM databases

PhosphoSiteiQ9Z2G6.

Expressioni

Gene expression databases

BgeeiQ9Z2G6.
CleanExiMM_SEL1L.
ExpressionAtlasiQ9Z2G6. baseline and differential.
GenevisibleiQ9Z2G6. MM.

Interactioni

Subunit structurei

Part of a complex containing SEL1L, SYVN1 and DERL2. May form a complex with ERLEC1, HSPA5, OS9, and SYVN1. Interacts with FOXRED2 and EDEM1 (By similarity).By similarity

Protein-protein interaction databases

BioGridi203153. 5 interactions.
IntActiQ9Z2G6. 7 interactions.
MINTiMINT-4134046.
STRINGi10090.ENSMUSP00000021347.

Structurei

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
5B26X-ray2.60A/B/C/D348-533[»]
ProteinModelPortaliQ9Z2G6.
SMRiQ9Z2G6. Positions 112-164, 186-713.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini118 – 16649Fibronectin type-IIPROSITE-ProRule annotationAdd
BLAST
Repeati179 – 21436Sel1-like 1Add
BLAST
Repeati215 – 25036Sel1-like 2Add
BLAST
Repeati251 – 28636Sel1-like 3Add
BLAST
Repeati287 – 32236Sel1-like 4Add
BLAST
Repeati369 – 40537Sel1-like 5Add
BLAST
Repeati406 – 44237Sel1-like 6Add
BLAST
Repeati443 – 47836Sel1-like 7Add
BLAST
Repeati479 – 51436Sel1-like 8Add
BLAST
Repeati515 – 55036Sel1-like 9Add
BLAST
Repeati623 – 65836Sel1-like 10Add
BLAST
Repeati660 – 69536Sel1-like 11Add
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni23 – 733711Interaction with ERLEC1, OS9 and SYVN1By similarityAdd
BLAST
Regioni734 – 79057Mediates retention to the endoplasmic reticulumBy similarityAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi766 – 78924Pro-richAdd
BLAST

Sequence similaritiesi

Belongs to the sel-1 family.Curated
Contains 1 fibronectin type-II domain.PROSITE-ProRule annotation
Contains 11 Sel1-like repeats.Curated

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG1550. Eukaryota.
COG0790. LUCA.
GeneTreeiENSGT00530000063170.
HOVERGENiHBG057766.
InParanoidiQ9Z2G6.
KOiK14026.
OMAiNHTKAME.
OrthoDBiEOG7DRJ2J.
TreeFamiTF315257.

Family and domain databases

Gene3Di1.25.40.10. 3 hits.
2.10.10.10. 1 hit.
InterProiIPR000562. FN_type2_col-bd.
IPR013806. Kringle-like.
IPR006597. Sel1-like.
IPR011990. TPR-like_helical_dom.
[Graphical view]
PfamiPF00040. fn2. 1 hit.
PF08238. Sel1. 12 hits.
[Graphical view]
SMARTiSM00059. FN2. 1 hit.
SM00671. SEL1. 11 hits.
[Graphical view]
SUPFAMiSSF57440. SSF57440. 1 hit.
PROSITEiPS00023. FN2_1. 1 hit.
PS51092. FN2_2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9Z2G6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQVRVRLSLL LLCAVLLGSA AATSDDKTNQ DDSLDSKSSL PTDESVKDHT
60 70 80 90 100
TTGKVVAGQI FVDSEEAEVE SLLQDEEDSS KTQEEEISFL ESPNPSSKTY
110 120 130 140 150
EELKRVRKPV LTAIEGTAHG EPCHFPFLFL DKEYDECTSD GREDGRLWCA
160 170 180 190 200
TTYDYKTDEK WGFCETEEDA AKRRQMQEAE MIYQAGMKIL NGSNRKSQKR
210 220 230 240 250
EAYRYLQKAA GMNHTKALER VSYALLFGDY LTQNIQAAKE MFEKLTEEGS
260 270 280 290 300
PKGQTGLGFL YASGLGVNSS QAKALVYYTF GALGGNLIAH MILGYRYWAG
310 320 330 340 350
IGVLQSCESA LTHYRLVANH VASDISLTGG SVVQRIRLPD EVENPGMNSG
360 370 380 390 400
MLEEDLIQYY QFLAEKGDVQ AQVGLGQLHL HGGRGVEQNH QRAFDYFNLA
410 420 430 440 450
ANAGNSHAMA FLGKMYSEGS DIVPQSNETA LHYFKKAADM GNPVGQSGLG
460 470 480 490 500
MAYLYGRGVQ VNYDLALKYF QKAAEQGWVD GQLQLGSMYY NGIGVKRDYK
510 520 530 540 550
QALKYFNLAS QGGHILAFYN LAQMHASGTG VMRSCHTAVE LFKNVCERGR
560 570 580 590 600
WSERLMTAYN SYKDEDYNAA VVQYLLLAEQ GYEVAQSNAA FILDQREATI
610 620 630 640 650
VGENETYPRA LLHWNRAASQ GYTVARIKLG DYHFYGFGTD VDYETAFIHY
660 670 680 690 700
RLASEQQHSA QAMFNLGYMH EKGLGIKQDI HLAKRFYDMA AEASPDAQVP
710 720 730 740 750
VFLALCKLGV VYFLQYIREA NIRDLFTQLD MDQLLGPEWD LYLMTIIALL
760 770 780 790
LGTVIAYRQR QHQDIPVPRP PGPRPAPPQQ EGPPEQQPPQ
Length:790
Mass (Da):88,340
Last modified:April 27, 2001 - v2
Checksum:i47869F2AFB59B936
GO
Isoform 2 (identifier: Q9Z2G6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     116-166: GTAHGEPCHFPFLFLDKEYDECTSDGREDGRLWCATTYDYKTDEKWGFCET → A

Note: No experimental confirmation available.
Show »
Length:740
Mass (Da):82,457
Checksum:iB51D80A451C28AB1
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei116 – 16651GTAHG…GFCET → A in isoform 2. 1 PublicationVSP_004384Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF063095 mRNA. Translation: AAD05210.1.
AK005023 mRNA. Translation: BAB23750.1.
CCDSiCCDS26091.1. [Q9Z2G6-1]
CCDS49137.1. [Q9Z2G6-2]
RefSeqiNP_001034178.1. NM_001039089.1. [Q9Z2G6-1]
NP_035474.1. NM_011344.2. [Q9Z2G6-2]
UniGeneiMm.250605.

Genome annotation databases

EnsembliENSMUST00000021347; ENSMUSP00000021347; ENSMUSG00000020964. [Q9Z2G6-1]
ENSMUST00000167466; ENSMUSP00000129384; ENSMUSG00000020964. [Q9Z2G6-2]
GeneIDi20338.
KEGGimmu:20338.
UCSCiuc007oky.1. mouse. [Q9Z2G6-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF063095 mRNA. Translation: AAD05210.1.
AK005023 mRNA. Translation: BAB23750.1.
CCDSiCCDS26091.1. [Q9Z2G6-1]
CCDS49137.1. [Q9Z2G6-2]
RefSeqiNP_001034178.1. NM_001039089.1. [Q9Z2G6-1]
NP_035474.1. NM_011344.2. [Q9Z2G6-2]
UniGeneiMm.250605.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
5B26X-ray2.60A/B/C/D348-533[»]
ProteinModelPortaliQ9Z2G6.
SMRiQ9Z2G6. Positions 112-164, 186-713.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi203153. 5 interactions.
IntActiQ9Z2G6. 7 interactions.
MINTiMINT-4134046.
STRINGi10090.ENSMUSP00000021347.

PTM databases

PhosphoSiteiQ9Z2G6.

Proteomic databases

EPDiQ9Z2G6.
MaxQBiQ9Z2G6.
PaxDbiQ9Z2G6.
PRIDEiQ9Z2G6.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000021347; ENSMUSP00000021347; ENSMUSG00000020964. [Q9Z2G6-1]
ENSMUST00000167466; ENSMUSP00000129384; ENSMUSG00000020964. [Q9Z2G6-2]
GeneIDi20338.
KEGGimmu:20338.
UCSCiuc007oky.1. mouse. [Q9Z2G6-1]

Organism-specific databases

CTDi6400.
MGIiMGI:1329016. Sel1l.

Phylogenomic databases

eggNOGiKOG1550. Eukaryota.
COG0790. LUCA.
GeneTreeiENSGT00530000063170.
HOVERGENiHBG057766.
InParanoidiQ9Z2G6.
KOiK14026.
OMAiNHTKAME.
OrthoDBiEOG7DRJ2J.
TreeFamiTF315257.

Enzyme and pathway databases

ReactomeiR-MMU-1912420. Pre-NOTCH Processing in Golgi.
R-MMU-5358346. Hedgehog ligand biogenesis.
R-MMU-901032. ER Quality Control Compartment (ERQC).

Miscellaneous databases

ChiTaRSiSel1l. mouse.
PROiQ9Z2G6.
SOURCEiSearch...

Gene expression databases

BgeeiQ9Z2G6.
CleanExiMM_SEL1L.
ExpressionAtlasiQ9Z2G6. baseline and differential.
GenevisibleiQ9Z2G6. MM.

Family and domain databases

Gene3Di1.25.40.10. 3 hits.
2.10.10.10. 1 hit.
InterProiIPR000562. FN_type2_col-bd.
IPR013806. Kringle-like.
IPR006597. Sel1-like.
IPR011990. TPR-like_helical_dom.
[Graphical view]
PfamiPF00040. fn2. 1 hit.
PF08238. Sel1. 12 hits.
[Graphical view]
SMARTiSM00059. FN2. 1 hit.
SM00671. SEL1. 11 hits.
[Graphical view]
SUPFAMiSSF57440. SSF57440. 1 hit.
PROSITEiPS00023. FN2_1. 1 hit.
PS51092. FN2_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and characterization of Sel-1l, a murine homolog of the C. elegans sel-1 gene."
    Donoviel D.B., Donoviel M.S., Fan E., Hadjantonakis A.-K., Bernstein A.
    Mech. Dev. 78:203-207(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
  2. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Strain: C57BL/6J.
    Tissue: Liver.
  3. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Brain, Brown adipose tissue, Heart, Kidney, Liver, Lung, Pancreas, Spleen and Testis.

Entry informationi

Entry nameiSE1L1_MOUSE
AccessioniPrimary (citable) accession number: Q9Z2G6
Secondary accession number(s): Q9DBD8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 27, 2001
Last sequence update: April 27, 2001
Last modified: June 8, 2016
This is version 134 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.