Reviewed,
UniProtKB/Swiss-Prot Q9Z280 (PLD1_MOUSE)
Last modified
June 16, 2009.
Version 77.
History...
Clusters with 100%,
90%,
50% identity |
Documents (2) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Phospholipase D1 Short name=PLD 1 Short name=mPLD1 EC=3.1.4.4 Alternative name(s): Choline phosphatase 1 Phosphatidylcholine-hydrolyzing phospholipase D1 | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus |
Protein attributes
| Sequence length | 1074 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Implicated as a critical step in numerous cellular pathways, including signal transduction, membrane trafficking, and the regulation of mitosis. May be involved in the regulation of perinuclear intravesicular membrane traffic. |
| Catalytic activity | A phosphatidylcholine + H2O = choline + a phosphatidate. |
| Enzyme regulation | Stimulated by phosphatidylinositol 4,5-bisphosphate and phosphatidylinositol 3,4,5-trisphosphate, activated by the phosphokinase C-alpha, by the ADP-ribosylation factor-1 (ARF-1), and to a lesser extent by GTP-binding proteins: RHO A, RAC-1 and CDC42. |
| Subunit structure | Interacts with PIP5K1A By similarity. |
| Subcellular location | Cytoplasm › perinuclear region. Endoplasmic reticulum membrane; Lipid-anchor; Cytoplasmic side Potential. Golgi apparatus membrane; Lipid-anchor; Cytoplasmic side Potential. Late endosome membrane; Lipid-anchor; Cytoplasmic side Potential. |
| Tissue specificity | Expressed in kidney, lung, and at a much lower levels, in brain, liver, heart, testis and spleen. |
| Developmental stage | Expressed most strikingly in selected ventricular cells lining the spinal cord and brain. The level of expression decreases dramatically as the cells differentiate into neurons and migrate to the outer layer of the spinal cord and brain. Expression is observed during development in a restricted region of the nasal neuroepithelium. |
| Involvement in disease | Defects in Pld1 may result in coa which is associated with coat color dilution and white spotting. It is also associated with platelet-storage pool deficiency characterized by decreased levels in serotonin and dense granules. |
| Sequence similarities | Belongs to the phospholipase D family. Contains 1 PH domain. Contains 2 PLD phosphodiesterase domains. Contains 1 PX (phox homology) domain. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform PLD1A (identifier: Q9Z280-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform PLD1B (identifier: Q9Z280-2) The sequence of this isoform differs from the canonical sequence as follows: 585-623: SYFSHCRSHQNLIHGLKPHLKLFHPSSESEQGLTRHSTD → N |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1074 | 1074 | Phospholipase D1 | PRO_0000218803 | |||||
Regions | |||||||||
| Domain | 81 – 212 | 132 | PX | ||||||
| Domain | 219 – 328 | 110 | PH | ||||||
| Domain | 459 – 486 | 28 | PLD phosphodiesterase 1 | ||||||
| Domain | 891 – 918 | 28 | PLD phosphodiesterase 2 | ||||||
| Region | 463 – 928 | 466 | Catalytic | ||||||
Amino acid modifications | |||||||||
| Modified residue | 538 | 1 | Phosphoserine Ref.4 | ||||||
| Modified residue | 629 | 1 | Phosphoserine By similarity | ||||||
| Lipidation | 240 | 1 | S-palmitoyl cysteine By similarity | ||||||
| Lipidation | 241 | 1 | S-palmitoyl cysteine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 585 – 623 | 39 | SYFSH…RHSTD → N in isoform PLD1B. | VSP_005023 | |||||
Experimental info | |||||||||
| Sequence conflict | 71 – 74 | 4 | NIQT → QHPD in AAB81245. Ref.1 | ||||||
| Sequence conflict | 574 | 1 | A → V in AAB81245. Ref.1 | ||||||
| Sequence conflict | 675 | 1 | R → G in AAB81245. Ref.1 | ||||||
| Sequence conflict | 781 | 1 | N → I in AAB81245. Ref.1 | ||||||
| Sequence conflict | 876 | 1 | C → V in AAB81245. Ref.1 | ||||||
| Sequence conflict | 990 | 1 | T → A in AAB81245. Ref.1 | ||||||
| Sequence conflict | 1071 – 1073 | 3 | EVW → SLT Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and expression analysis of murine phospholipase D1." Colley W.C., Altshuller Y.M., Sue-Ling C.K., Copeland N.G., Gilbert D.J., Jenkins N.A., Branch K.D., Tsirka S.E., Bollag R.J., Bollag W.B., Frohman M.A. Biochem. J. 326:745-753(1997) [PubMed: 9307024] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS PLD1A AND PLD1B). Strain: 129. Tissue: Embryonic brain and Neonatal brain. |
| [2] | "Genomic analysis of murine phospholipase D1 and comparison to phospholipase D2 reveals an unusual difference in gene size." Redina O.E., Frohman M.A. Gene 222:53-60(1998) [PubMed: 9813240] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM PLD1A). Strain: 129. |
| [3] | "Phospholipase D2, a distinct phospholipase D isoform with novel regulatory properties that provokes cytoskeletal reorganization." Colley W.C., Sung T.-C., Roll R., Jenco J.M., Hammond S.M., Altshuller Y.M., Bar-Sagi D., Morris A.J., Frohman M.A. Curr. Biol. 7:191-201(1997) [PubMed: 9395408] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [4] | "Protein phosphorylation and expression profiling by Yin-yang multidimensional liquid chromatography (Yin-yang MDLC) mass spectrometry." Dai J., Jin W.-H., Sheng Q.-H., Shieh C.-H., Wu J.-R., Zeng R. J. Proteome Res. 6:250-262(2007) [PubMed: 17203969] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-538, MASS SPECTROMETRY. Tissue: Liver. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| U87868 mRNA. Translation: AAB81245.1. AF083497 AF083496 Genomic DNA. Translation: AAC84041.1. | |
| IPI | IPI00130629. IPI00229888. |
| PIR | T17203. T42093. |
| UniGene | Mm.212039 |
3D structure databases | |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | Q9Z280. |
Proteomic databases | |
| PRIDE | Q9Z280. |
Genome annotation databases | |
| Ensembl | ENSMUSG00000027695. Mus musculus. [Contig view] |
Organism-specific databases | |
| MGI | MGI:109585. Pld1. |
Phylogenomic databases | |
| HOGENOM | Q9Z280. |
| HOVERGEN | Q9Z280. |
Enzyme and pathway databases | |
| BRENDA | 3.1.4.4. 244. |
Gene expression databases | |
| ArrayExpress | Q9Z280. |
| Bgee | Q9Z280. |
| CleanEx | MM_PLD1. |
| GermOnline | ENSMUSG00000027695. Mus musculus. |
Family and domain databases | |
| InterPro | IPR011993. PH_type. IPR015679. Phospholipase_D. IPR001849. Pleckstrin_homology. IPR001736. PLipase_D/transphosphatidylase. IPR016555. PLipase_D_euk. IPR001683. PX. [Graphical view] |
| Gene3D | G3DSA:2.30.29.30. PH_type. 1 hit. G3DSA:3.30.1520.10. PX. 1 hit. |
| PANTHER | PTHR18896. Phospholipase_D. 1 hit. |
| Pfam | PF00169. PH. 1 hit. PF00614. PLDc. 2 hits. PF00787. PX. 1 hit. [Graphical view] |
| PIRSF | PIRSF009376. Phospholipase_D_euk. 1 hit. |
| SMART | SM00233. PH. 1 hit. SM00155. PLDc. 2 hits. SM00312. PX. 1 hit. [Graphical view] |
| PROSITE | PS50003. PH_DOMAIN. 1 hit. PS50035. PLD. 2 hits. PS50195. PX. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| SOURCE | Search... |
Entry information
| Entry name | PLD1_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q9Z280 Secondary accession number(s): O35911 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


