Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Phospholipase D1

Gene

Pld1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

Implicated as a critical step in numerous cellular pathways, including signal transduction, membrane trafficking, and the regulation of mitosis. May be involved in the regulation of perinuclear intravesicular membrane traffic.

Catalytic activityi

A phosphatidylcholine + H2O = choline + a phosphatidate.

Enzyme regulationi

Stimulated by phosphatidylinositol 4,5-bisphosphate and phosphatidylinositol 3,4,5-trisphosphate, activated by the phosphokinase C-alpha, by the ADP-ribosylation factor-1 (ARF-1), and to a lesser extent by GTP-binding proteins: RHO A, RAC-1 and CDC42.

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Biological processi

Lipid degradation, Lipid metabolism

Enzyme and pathway databases

BRENDAi3.1.4.4. 3474.
ReactomeiR-MMU-1483148. Synthesis of PG.

Names & Taxonomyi

Protein namesi
Recommended name:
Phospholipase D1 (EC:3.1.4.4)
Short name:
PLD 1
Short name:
mPLD1
Alternative name(s):
Choline phosphatase 1
Phosphatidylcholine-hydrolyzing phospholipase D1
Gene namesi
Name:Pld1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Unplaced

Organism-specific databases

MGIiMGI:109585. Pld1.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Endoplasmic reticulum, Endosome, Golgi apparatus, Membrane

Pathology & Biotechi

Involvement in diseasei

Defects in Pld1 may result in coa which is associated with coat color dilution and white spotting. It is also associated with platelet-storage pool deficiency characterized by decreased levels in serotonin and dense granules.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002188031 – 1074Phospholipase D1Add BLAST1074

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Lipidationi240S-palmitoyl cysteineBy similarity1
Lipidationi241S-palmitoyl cysteineBy similarity1
Modified residuei499PhosphoserineBy similarity1
Modified residuei561PhosphoserineBy similarity1
Modified residuei629PhosphoserineBy similarity1

Keywords - PTMi

Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

PaxDbiQ9Z280.
PRIDEiQ9Z280.

PTM databases

iPTMnetiQ9Z280.
PhosphoSitePlusiQ9Z280.

Expressioni

Tissue specificityi

Expressed in kidney, lung, and at a much lower levels, in brain, liver, heart, testis and spleen.

Developmental stagei

Expressed most strikingly in selected ventricular cells lining the spinal cord and brain. The level of expression decreases dramatically as the cells differentiate into neurons and migrate to the outer layer of the spinal cord and brain. Expression is observed during development in a restricted region of the nasal neuroepithelium.

Gene expression databases

CleanExiMM_PLD1.

Interactioni

Subunit structurei

Interacts with PIP5K1B.By similarity

Protein-protein interaction databases

DIPiDIP-61103N.
STRINGi10090.ENSMUSP00000064694.

Structurei

3D structure databases

ProteinModelPortaliQ9Z280.
SMRiQ9Z280.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini81 – 212PXPROSITE-ProRule annotationAdd BLAST132
Domaini219 – 328PHPROSITE-ProRule annotationAdd BLAST110
Domaini459 – 486PLD phosphodiesterase 1PROSITE-ProRule annotationAdd BLAST28
Domaini891 – 918PLD phosphodiesterase 2PROSITE-ProRule annotationAdd BLAST28

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni463 – 928CatalyticAdd BLAST466

Sequence similaritiesi

Belongs to the phospholipase D family.Curated
Contains 1 PH domain.PROSITE-ProRule annotation
Contains 2 PLD phosphodiesterase domains.PROSITE-ProRule annotation
Contains 1 PX (phox homology) domain.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG1329. Eukaryota.
COG1502. LUCA.
HOGENOMiHOG000246972.
HOVERGENiHBG006650.
InParanoidiQ9Z280.
PhylomeDBiQ9Z280.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
3.30.1520.10. 1 hit.
InterProiIPR011993. PH_dom-like.
IPR001849. PH_domain.
IPR001683. Phox.
IPR025202. PLD-like_dom.
IPR001736. PLipase_D/transphosphatidylase.
IPR016555. PLipase_D1/D2.
IPR015679. PLipase_D_fam.
[Graphical view]
PANTHERiPTHR18896. PTHR18896. 2 hits.
PfamiPF00169. PH. 1 hit.
PF00614. PLDc. 1 hit.
PF13091. PLDc_2. 1 hit.
PF00787. PX. 1 hit.
[Graphical view]
PIRSFiPIRSF009376. Phospholipase_D_euk. 1 hit.
SMARTiSM00233. PH. 1 hit.
SM00155. PLDc. 2 hits.
SM00312. PX. 1 hit.
[Graphical view]
SUPFAMiSSF50729. SSF50729. 1 hit.
SSF64268. SSF64268. 1 hit.
PROSITEiPS50003. PH_DOMAIN. 1 hit.
PS50035. PLD. 2 hits.
PS50195. PX. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform PLD1A (identifier: Q9Z280-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSLKSETRVN TSTLQKIAAD MSNLIENLDT RELHFEGEEV EYDASPGDPK
60 70 80 90 100
AQEGCIPFSS IYNTQGFKEP NIQTYLSGCP IKAQVLEVER FTSTSRVPSI
110 120 130 140 150
NLYTIELTHG EFTWQVKRKF KHFQEFHREL LKYKAFIRIP IPTKRHTFRR
160 170 180 190 200
QNVKEEPREM PSLPRSSENA IQEEQFFGRR KQLEDYLTKI LKMPMYRNYH
210 220 230 240 250
ATTEFLDVSQ LSFIHDLGPK GLEGMIMKRS GGHRIPGVNC CGHGRACYRW
260 270 280 290 300
SKRWLIVKDS FLLYMKPDSG AIAFVLLVDK EFRVKVGRKE TETKYGLRID
310 320 330 340 350
NLSRTLILKC NSYRHARWWG GAIEEFIRKH GADFLKDHRF GSYAALHENT
360 370 380 390 400
LAKWYVNAKG YFEDIANAME EASEEIFITD WWLSPEIFLK RPVVEGNRWR
410 420 430 440 450
LDCILKRKAQ QGVRIFIMLY KEVELALGIN SEYSKRTLMR LHPNIKVMRH
460 470 480 490 500
PDHVSSSVYL WAHHEKLVII DQSVAFVGGI DLAYGRWDDN EHRLTDVGSV
510 520 530 540 550
KRVTSGLSLG SLTAASVESM ESLSLKDKHE FHKKEPISKI VDETDMKLKG
560 570 580 590 600
IGKSRKFSKF SLYRQLHRHH LHNADSISSI DSTSSYFSHC RSHQNLIHGL
610 620 630 640 650
KPHLKLFHPS SESEQGLTRH STDTGSIRSV QTGVGELHGE TRFWHGKDYC
660 670 680 690 700
NFVFKDWVQL DKPFADFIDR YSTPRMPWHD IGSVVHGKAA RDVARHFIQR
710 720 730 740 750
WNFTKIMKPK YRSLSYPFLL PKSQATAHEL RYQVPGAVPA KVQLLRSAAD
760 770 780 790 800
WSAGIKHHEE SIHAAYIHVI ENSKHYIYIE NQFFISCADD KVVFNKVGDR
810 820 830 840 850
IAQRILKAHR EGQRYRVYIV IPLLPGFEGD ISTGGGNALQ AIMHFNYRTM
860 870 880 890 900
CRGESSILEQ LKPELGNKWI NYISFCGLRT HAELEGNLVT ELIYVHSKLL
910 920 930 940 950
IADDNTVIIG SANINDRSML GKRDSEMAVI VQDTETVPSV MDGKEYQAGR
960 970 980 990 1000
FARDLRLECF RLVLGYLSDP SEDLQDPVSD KFFKEIWVST AARNATIYDK
1010 1020 1030 1040 1050
VFRCLPNDEV HNLIQLRDFI NKPILAKEDA LRAEEELRKI RGFLVQFPLY
1060 1070
FLSEENLLPS VGTKEAIVPM EVWT
Length:1,074
Mass (Da):123,969
Last modified:May 1, 1999 - v1
Checksum:iE11260982A217280
GO
Isoform PLD1B (identifier: Q9Z280-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     585-623: SYFSHCRSHQNLIHGLKPHLKLFHPSSESEQGLTRHSTD → N

Show »
Length:1,036
Mass (Da):119,588
Checksum:i39AFFFE7032D487A
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti71 – 74NIQT → QHPD in AAB81245 (PubMed:9307024).Curated4
Sequence conflicti574A → V in AAB81245 (PubMed:9307024).Curated1
Sequence conflicti675R → G in AAB81245 (PubMed:9307024).Curated1
Sequence conflicti781N → I in AAB81245 (PubMed:9307024).Curated1
Sequence conflicti876C → V in AAB81245 (PubMed:9307024).Curated1
Sequence conflicti990T → A in AAB81245 (PubMed:9307024).Curated1
Sequence conflicti1071 – 1073EVW → SLT (PubMed:9307024).Curated3

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_005023585 – 623SYFSH…RHSTD → N in isoform PLD1B. 1 PublicationAdd BLAST39

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U87868 mRNA. Translation: AAB81245.1.
AF083497
, AF083475, AF083476, AF083478, AF083479, AF083480, AF083481, AF083483, AF083484, AF083485, AF083486, AF083488, AF083489, AF083490, AF083492, AF083494, AF083495, AF083496 Genomic DNA. Translation: AAC84041.1.
CCDSiCCDS17275.1. [Q9Z280-2]
PIRiT17203.
T42093.
UniGeneiMm.212039.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U87868 mRNA. Translation: AAB81245.1.
AF083497
, AF083475, AF083476, AF083478, AF083479, AF083480, AF083481, AF083483, AF083484, AF083485, AF083486, AF083488, AF083489, AF083490, AF083492, AF083494, AF083495, AF083496 Genomic DNA. Translation: AAC84041.1.
CCDSiCCDS17275.1. [Q9Z280-2]
PIRiT17203.
T42093.
UniGeneiMm.212039.

3D structure databases

ProteinModelPortaliQ9Z280.
SMRiQ9Z280.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

DIPiDIP-61103N.
STRINGi10090.ENSMUSP00000064694.

PTM databases

iPTMnetiQ9Z280.
PhosphoSitePlusiQ9Z280.

Proteomic databases

PaxDbiQ9Z280.
PRIDEiQ9Z280.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Organism-specific databases

MGIiMGI:109585. Pld1.

Phylogenomic databases

eggNOGiKOG1329. Eukaryota.
COG1502. LUCA.
HOGENOMiHOG000246972.
HOVERGENiHBG006650.
InParanoidiQ9Z280.
PhylomeDBiQ9Z280.

Enzyme and pathway databases

BRENDAi3.1.4.4. 3474.
ReactomeiR-MMU-1483148. Synthesis of PG.

Miscellaneous databases

PROiQ9Z280.
SOURCEiSearch...

Gene expression databases

CleanExiMM_PLD1.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
3.30.1520.10. 1 hit.
InterProiIPR011993. PH_dom-like.
IPR001849. PH_domain.
IPR001683. Phox.
IPR025202. PLD-like_dom.
IPR001736. PLipase_D/transphosphatidylase.
IPR016555. PLipase_D1/D2.
IPR015679. PLipase_D_fam.
[Graphical view]
PANTHERiPTHR18896. PTHR18896. 2 hits.
PfamiPF00169. PH. 1 hit.
PF00614. PLDc. 1 hit.
PF13091. PLDc_2. 1 hit.
PF00787. PX. 1 hit.
[Graphical view]
PIRSFiPIRSF009376. Phospholipase_D_euk. 1 hit.
SMARTiSM00233. PH. 1 hit.
SM00155. PLDc. 2 hits.
SM00312. PX. 1 hit.
[Graphical view]
SUPFAMiSSF50729. SSF50729. 1 hit.
SSF64268. SSF64268. 1 hit.
PROSITEiPS50003. PH_DOMAIN. 1 hit.
PS50035. PLD. 2 hits.
PS50195. PX. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiPLD1_MOUSE
AccessioniPrimary (citable) accession number: Q9Z280
Secondary accession number(s): O35911
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 21, 2001
Last sequence update: May 1, 1999
Last modified: November 2, 2016
This is version 141 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.