Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Neuroepithelial cell-transforming gene 1 protein

Gene

Net1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Acts as guanine nucleotide exchange factor (GEF) for RhoA GTPase. May be involved in activation of the SAPK/JNK pathway. Stimulates genotoxic stress-induced RHOB activity in breast cancer cells leading to their cell death.1 Publication

Miscellaneous

Can be converted to an oncogenic protein by N-terminal deletion that leads to nuclear export and cytoplasmic localization. Transformation seems to require the activity of multiple signaling pathways. The physiological conditions for cytoplasmic relocalization are not known yet.

GO - Molecular functioni

  • GTP-Rho binding Source: MGI
  • Rho guanyl-nucleotide exchange factor activity Source: InterPro

GO - Biological processi

Keywordsi

Molecular functionGuanine-nucleotide releasing factor

Enzyme and pathway databases

ReactomeiR-MMU-193648 NRAGE signals death through JNK
R-MMU-194840 Rho GTPase cycle
R-MMU-416482 G alpha (12/13) signalling events

Names & Taxonomyi

Protein namesi
Recommended name:
Neuroepithelial cell-transforming gene 1 protein
Alternative name(s):
Rho guanine nucleotide exchange factor 8
Gene namesi
Name:Net1
Synonyms:Arhgef8
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 13

Organism-specific databases

MGIiMGI:1927138 Net1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi12 – 16RPRRR → APAAA: Leads to cytoplasmic relocalization; when associated with 67-A--A-70. 1 Publication5
Mutagenesisi67 – 70RKRR → AAAA: Leads to cytoplasmic relocalization; when associated with 12-A--A-16. 1 Publication4
Mutagenesisi321L → E: Inhibits transformation by N-terminal truncated form. 1 Publication1
Mutagenesisi492W → L: Inhibits transformation by N-terminal truncated form. 1 Publication1

Keywords - Diseasei

Proto-oncogene

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000809251 – 595Neuroepithelial cell-transforming gene 1 proteinAdd BLAST595

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineBy similarity1
Modified residuei21PhosphoserineBy similarity1
Modified residuei100PhosphoserineBy similarity1
Modified residuei106PhosphoserineBy similarity1
Modified residuei122PhosphoserineBy similarity1
Modified residuei508PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

PaxDbiQ9Z206
PRIDEiQ9Z206

PTM databases

iPTMnetiQ9Z206
PhosphoSitePlusiQ9Z206

Expressioni

Gene expression databases

BgeeiENSMUSG00000021215
CleanExiMM_NET1
ExpressionAtlasiQ9Z206 baseline and differential
GenevisibleiQ9Z206 MM

Interactioni

Subunit structurei

Interacts with RHOA in its GTP- and GDP-bound states, and with CDC42 in its GTP-bound state. Interacts with the PDZ 1 domain of BAIAP1.2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
Magi1Q6RHR96EBI-7840997,EBI-7440897

GO - Molecular functioni

  • GTP-Rho binding Source: MGI
  • Rho guanyl-nucleotide exchange factor activity Source: InterPro

Protein-protein interaction databases

BioGridi207915, 5 interactors
IntActiQ9Z206, 1 interactor
MINTiQ9Z206
STRINGi10090.ENSMUSP00000089464

Structurei

3D structure databases

ProteinModelPortaliQ9Z206
SMRiQ9Z206
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini174 – 356DHPROSITE-ProRule annotationAdd BLAST183
Domaini386 – 501PHPROSITE-ProRule annotationAdd BLAST116

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 74Necessary for nuclear localizationAdd BLAST74

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi12 – 19Nuclear localization signal8
Motifi66 – 72Nuclear localization signal7

Domaini

The PH domain is sufficient for the nuclear export of the oncogenic N-terminal truncated form. The relocalization is not affected by the Leu-492 mutation.

Phylogenomic databases

eggNOGiKOG4305 Eukaryota
COG5422 LUCA
GeneTreeiENSGT00760000119193
HOGENOMiHOG000034044
HOVERGENiHBG050567
InParanoidiQ9Z206
KOiK20683
OMAiGPNWDFT
OrthoDBiEOG091G05S7
PhylomeDBiQ9Z206
TreeFamiTF328974

Family and domain databases

CDDicd13224 PH_Net1, 1 hit
cd00160 RhoGEF, 1 hit
Gene3Di1.20.900.10, 1 hit
2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR035899 DBL_dom_sf
IPR000219 DH-domain
IPR001331 GDS_CDC24_CS
IPR037853 Net1_PH
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
PfamiView protein in Pfam
PF16652 PH_13, 1 hit
PF00621 RhoGEF, 1 hit
SMARTiView protein in SMART
SM00233 PH, 1 hit
SM00325 RhoGEF, 1 hit
SUPFAMiSSF48065 SSF48065, 1 hit
PROSITEiView protein in PROSITE
PS00741 DH_1, 1 hit
PS50010 DH_2, 1 hit
PS50003 PH_DOMAIN, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9Z206-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEPEPAAQKQ PRPRRRSRRV SMLSEEPAAG LPADTPGPAA NERCSLRRGS
60 70 80 90 100
SFTFLTPGPH WDFTLKRKRR EKDDDAVSLS SLDLKEPSNK RVRPLARVTS
110 120 130 140 150
LANLISPVRN GAVRRFGQTI QSFTLRGDHR SPASAQKSFS RSTVPTPTKR
160 170 180 190 200
RSSALWSEML DINMKESLTT REIKRQEAIY ELSRGEQDLI EDLKLARKAY
210 220 230 240 250
HDPMLKLSIM SEEELTHIFG DLDAYIPLHE DLLARIGEAT KPDGTVEQIG
260 270 280 290 300
HILVNWLPGL NAYRGYCSNQ LAAKALLDQK KQDPRVQDFL QRCLESPFSR
310 320 330 340 350
KLDLWSFLDI PRSRLVKYPL LLKEILRHTP KDHRDVQLLE EAILIIQGVL
360 370 380 390 400
SDINLKKGES ECQYYINKLE YLDEKQKDPR IEASKVLLCH GELKNKSGHK
410 420 430 440 450
LYIFLFQDIL VLTRPVTRNE RHLYQVYRQP IPVQELVLED LQDGDVRMGG
460 470 480 490 500
SFRGAFGNSD KAKNIFRVRF QDPSPGHSHT LQANDVFHKQ QWFNCIRAAI
510 520 530 540 550
APFQRAASPL ELQGLPDLHE ECEENNPSAG NLRAQRRSCV VPGVMQIDEE
560 570 580 590
SALDCGSSVQ TVEDTRNMKA QRPQPGLRRA RDKAQSGGKK KETLV
Length:595
Mass (Da):67,734
Last modified:September 27, 2004 - v2
Checksum:i95614632A87EA4F3
GO
Isoform 2 (identifier: Q9Z206-2) [UniParc]FASTAAdd to basket
Also known as: Net1a

The sequence of this isoform differs from the canonical sequence as follows:
     1-54: Missing.
     55-85: LTPGPHWDFTLKRKRREKDDDAVSLSSLDLK → MVAHDEIGGLLPIKRTIRVLDVNNQPFREQE

Show »
Length:541
Mass (Da):61,765
Checksum:i38993EDD3F34D2DD
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti116F → S in BAC38417 (PubMed:16141072).Curated1
Sequence conflicti412L → W in AAC71772 (PubMed:9670022).Curated1
Sequence conflicti418R → G in AAC71772 (PubMed:9670022).Curated1
Sequence conflicti473P → L in AAC71772 (PubMed:9670022).Curated1
Sequence conflicti581 – 582RD → SH in AAC71772 (PubMed:9670022).Curated2

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0116221 – 54Missing in isoform 2. 3 PublicationsAdd BLAST54
Alternative sequenceiVSP_01162355 – 85LTPGP…SLDLK → MVAHDEIGGLLPIKRTIRVL DVNNQPFREQE in isoform 2. 3 PublicationsAdd BLAST31

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF094520 mRNA Translation: AAC71772.1
AJ010045 mRNA Translation: CAA08973.1
AK082128 mRNA Translation: BAC38417.1
AK088632 mRNA Translation: BAC40466.1
BC004699 mRNA Translation: AAH04699.1
CCDSiCCDS26216.1 [Q9Z206-1]
CCDS36583.1 [Q9Z206-2]
RefSeqiNP_001040624.1, NM_001047159.2 [Q9Z206-2]
NP_062645.2, NM_019671.3 [Q9Z206-1]
UniGeneiMm.22261

Genome annotation databases

EnsembliENSMUST00000091853; ENSMUSP00000089464; ENSMUSG00000021215 [Q9Z206-1]
ENSMUST00000099946; ENSMUSP00000097529; ENSMUSG00000021215 [Q9Z206-2]
GeneIDi56349
KEGGimmu:56349
UCSCiuc007pje.3 mouse [Q9Z206-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiARHG8_MOUSE
AccessioniPrimary (citable) accession number: Q9Z206
Secondary accession number(s): Q8C4I0, Q9Z1L7
Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 27, 2004
Last sequence update: September 27, 2004
Last modified: March 28, 2018
This is version 143 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health