Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9Z1X0

- CCL27_MOUSE

UniProt

Q9Z1X0 - CCL27_MOUSE

Protein

C-C motif chemokine 27

Gene

Ccl27

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
  1. Functioni

    Chemotactic factor that attracts skin-associated memory T-lymphocytes. May play a role in mediating homing of lymphocytes to cutaneous sites. May play a role in cell migration during embryogenesis. Nuclear forms may facilitate cellular migration by inducing cytoskeletal relaxation. Binds to CCR10.

    GO - Biological processi

    1. cell chemotaxis Source: GOC
    2. immune response Source: InterPro

    Keywords - Molecular functioni

    Cytokine

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    C-C motif chemokine 27
    Alternative name(s):
    CC chemokine ILC
    Cutaneous T-cell-attracting chemokine
    Short name:
    CTACK
    ESkine
    IL-11 R-alpha-locus chemokine
    Short name:
    ALP
    Short name:
    mILC
    Skinkine
    Small-inducible cytokine A27
    Gene namesi
    Name:Ccl27
    Synonyms:Ilc, Scya27
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 4

    Organism-specific databases

    MGIiMGI:1343459. Ccl27.

    Subcellular locationi

    Isoform 1 : Secreted. Nucleus
    Note: May also be nuclear when following receptor (CCR10)-mediated internalization.

    GO - Cellular componenti

    1. extracellular space Source: UniProtKB-KW
    2. nucleus Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Nucleus, Secreted

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2525Sequence AnalysisAdd
    BLAST
    Chaini26 – 12095C-C motif chemokine 27PRO_0000005240Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi34 ↔ 63By similarity
    Disulfide bondi35 ↔ 78By similarity

    Keywords - PTMi

    Disulfide bond

    Proteomic databases

    PRIDEiQ9Z1X0.

    Expressioni

    Tissue specificityi

    Isoform 1 is predominantly expressed in placenta and weakly in skin. Isoform 2 is predominantly expressed in testes and brain, weakly in kidney and liver and even lower in heart and muscle. Low expression of both isoforms in other tissues.

    Developmental stagei

    Expressed during development.

    Gene expression databases

    ArrayExpressiQ9Z1X0.
    BgeeiQ9Z1X0.
    CleanExiMM_CCL27.
    GenevestigatoriQ9Z1X0.

    Interactioni

    Subunit structurei

    Monomer, dimer, and tetramer. Heparin avidly promotes oligomerization By similarity.By similarity

    Protein-protein interaction databases

    DIPiDIP-5905N.
    MINTiMINT-125205.
    STRINGi10090.ENSMUSP00000103639.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9Z1X0.
    SMRiQ9Z1X0. Positions 28-112.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Keywords - Domaini

    Signal

    Phylogenomic databases

    eggNOGiNOG47743.
    GeneTreeiENSGT00530000063923.
    HOGENOMiHOG000231671.
    HOVERGENiHBG050833.
    KOiK16598.
    OMAiPLTGWHP.
    OrthoDBiEOG70W3G4.
    PhylomeDBiQ9Z1X0.
    TreeFamiTF337014.

    Family and domain databases

    InterProiIPR001811. Chemokine_IL8-like_dom.
    [Graphical view]
    PfamiPF00048. IL8. 1 hit.
    [Graphical view]
    SMARTiSM00199. SCY. 1 hit.
    [Graphical view]
    SUPFAMiSSF54117. SSF54117. 1 hit.

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9Z1X0-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MMEGLSPASS LPLLLLLLSP APEAALPLPS STSCCTQLYR QPLPSRLLRR    50
    IVHMELQEAD GDCHLQAVVL HLARRSVCVH PQNRSLARWL ERQGKRLQGT 100
    VPSLNLVLQK KMYSHPQQQN 120
    Length:120
    Mass (Da):13,464
    Last modified:December 13, 2002 - v2
    Checksum:iD1EEE1270AB580BF
    GO
    Isoform 2 (identifier: Q9Z1X0-2) [UniParc]FASTAAdd to Basket

    Also known as: PESKY

    The sequence of this isoform differs from the canonical sequence as follows:
         1-24: MMEGLSPASSLPLLLLLLSPAPEA → MWRRERSPMSPTSQRLSLEAPSLPLRSWHPWNKTKQKQE

    Show »
    Length:135
    Mass (Da):15,774
    Checksum:i956BBE8984B74389
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti115 – 1151H → N in AAD04163. (PubMed:10329455)Curated
    Sequence conflicti115 – 1151H → N in BAA88474. (PubMed:10556532)Curated
    Sequence conflicti115 – 1151H → N in AAD41237. (PubMed:10588729)Curated
    Sequence conflicti115 – 1151H → N in BAB24001. (PubMed:16141072)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 2424MMEGL…PAPEA → MWRRERSPMSPTSQRLSLEA PSLPLRSWHPWNKTKQKQE in isoform 2. 1 PublicationVSP_001065Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF099931 mRNA. Translation: AAD04163.1.
    AB013398 mRNA. Translation: BAA88474.1.
    AF082392 mRNA. Translation: AAD41237.1.
    AK005520 mRNA. Translation: BAB24095.1.
    AK005398 mRNA. Translation: BAB24001.1.
    BC028511 mRNA. Translation: AAH28511.1.
    BC107226 mRNA. Translation: AAI07227.1.
    CCDSiCCDS18072.1. [Q9Z1X0-1]
    RefSeqiNP_001157518.1. NM_001164046.1. [Q9Z1X0-1]
    NP_001186888.1. NM_001199959.1. [Q9Z1X0-1]
    NP_001186890.1. NM_001199961.1. [Q9Z1X0-2]
    NP_001186891.1. NM_001199962.1. [Q9Z1X0-2]
    NP_001186894.1. NM_001199965.1. [Q9Z1X0-1]
    NP_001254631.1. NM_001267702.1. [Q9Z1X0-2]
    NP_001254633.1. NM_001267704.1. [Q9Z1X0-1]
    NP_035466.1. NM_011336.1.
    XP_006543909.1. XM_006543846.1. [Q9Z1X0-1]
    UniGeneiMm.335946.
    Mm.425176.
    Mm.441242.
    Mm.463309.
    Mm.490604.
    Mm.6660.

    Genome annotation databases

    EnsembliENSMUST00000074387; ENSMUSP00000073990; ENSMUSG00000073888.
    ENSMUST00000098122; ENSMUSP00000095726; ENSMUSG00000073877. [Q9Z1X0-1]
    ENSMUST00000108018; ENSMUSP00000103653; ENSMUSG00000073877. [Q9Z1X0-2]
    ENSMUST00000177785; ENSMUSP00000137284; ENSMUSG00000096826. [Q9Z1X0-1]
    ENSMUST00000177905; ENSMUSP00000136552; ENSMUSG00000093828. [Q9Z1X0-1]
    ENSMUST00000179281; ENSMUSP00000136040; ENSMUSG00000095247. [Q9Z1X0-1]
    ENSMUST00000179871; ENSMUSP00000137101; ENSMUSG00000095247. [Q9Z1X0-2]
    GeneIDi100039863.
    100039939.
    100040048.
    100861978.
    102641963.
    20301.
    KEGGimmu:100039863.
    mmu:100039939.
    mmu:100040048.
    mmu:100861978.
    mmu:102641963.
    mmu:20301.
    UCSCiuc008sln.2. mouse. [Q9Z1X0-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Web resourcesi

    Wikipedia

    CCL27 entry

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF099931 mRNA. Translation: AAD04163.1 .
    AB013398 mRNA. Translation: BAA88474.1 .
    AF082392 mRNA. Translation: AAD41237.1 .
    AK005520 mRNA. Translation: BAB24095.1 .
    AK005398 mRNA. Translation: BAB24001.1 .
    BC028511 mRNA. Translation: AAH28511.1 .
    BC107226 mRNA. Translation: AAI07227.1 .
    CCDSi CCDS18072.1. [Q9Z1X0-1 ]
    RefSeqi NP_001157518.1. NM_001164046.1. [Q9Z1X0-1 ]
    NP_001186888.1. NM_001199959.1. [Q9Z1X0-1 ]
    NP_001186890.1. NM_001199961.1. [Q9Z1X0-2 ]
    NP_001186891.1. NM_001199962.1. [Q9Z1X0-2 ]
    NP_001186894.1. NM_001199965.1. [Q9Z1X0-1 ]
    NP_001254631.1. NM_001267702.1. [Q9Z1X0-2 ]
    NP_001254633.1. NM_001267704.1. [Q9Z1X0-1 ]
    NP_035466.1. NM_011336.1.
    XP_006543909.1. XM_006543846.1. [Q9Z1X0-1 ]
    UniGenei Mm.335946.
    Mm.425176.
    Mm.441242.
    Mm.463309.
    Mm.490604.
    Mm.6660.

    3D structure databases

    ProteinModelPortali Q9Z1X0.
    SMRi Q9Z1X0. Positions 28-112.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    DIPi DIP-5905N.
    MINTi MINT-125205.
    STRINGi 10090.ENSMUSP00000103639.

    Proteomic databases

    PRIDEi Q9Z1X0.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000074387 ; ENSMUSP00000073990 ; ENSMUSG00000073888 .
    ENSMUST00000098122 ; ENSMUSP00000095726 ; ENSMUSG00000073877 . [Q9Z1X0-1 ]
    ENSMUST00000108018 ; ENSMUSP00000103653 ; ENSMUSG00000073877 . [Q9Z1X0-2 ]
    ENSMUST00000177785 ; ENSMUSP00000137284 ; ENSMUSG00000096826 . [Q9Z1X0-1 ]
    ENSMUST00000177905 ; ENSMUSP00000136552 ; ENSMUSG00000093828 . [Q9Z1X0-1 ]
    ENSMUST00000179281 ; ENSMUSP00000136040 ; ENSMUSG00000095247 . [Q9Z1X0-1 ]
    ENSMUST00000179871 ; ENSMUSP00000137101 ; ENSMUSG00000095247 . [Q9Z1X0-2 ]
    GeneIDi 100039863.
    100039939.
    100040048.
    100861978.
    102641963.
    20301.
    KEGGi mmu:100039863.
    mmu:100039939.
    mmu:100040048.
    mmu:100861978.
    mmu:102641963.
    mmu:20301.
    UCSCi uc008sln.2. mouse. [Q9Z1X0-1 ]

    Organism-specific databases

    CTDi 100040048.
    20301.
    MGIi MGI:1343459. Ccl27.

    Phylogenomic databases

    eggNOGi NOG47743.
    GeneTreei ENSGT00530000063923.
    HOGENOMi HOG000231671.
    HOVERGENi HBG050833.
    KOi K16598.
    OMAi PLTGWHP.
    OrthoDBi EOG70W3G4.
    PhylomeDBi Q9Z1X0.
    TreeFami TF337014.

    Miscellaneous databases

    NextBioi 298041.
    PROi Q9Z1X0.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9Z1X0.
    Bgeei Q9Z1X0.
    CleanExi MM_CCL27.
    Genevestigatori Q9Z1X0.

    Family and domain databases

    InterProi IPR001811. Chemokine_IL8-like_dom.
    [Graphical view ]
    Pfami PF00048. IL8. 1 hit.
    [Graphical view ]
    SMARTi SM00199. SCY. 1 hit.
    [Graphical view ]
    SUPFAMi SSF54117. SSF54117. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Isolation of ALP, a novel divergent murine CC chemokine with a unique carboxy terminal extension."
      Hromas R., Broxmeyer H.E., Kim C., Christopherson K. II, Hou Y.-H.
      Biochem. Biophys. Res. Commun. 258:737-740(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    2. "Molecular cloning of a novel CC chemokine, interleukin-11 receptor alpha-locus chemokine (ILC), which is located on chromosome 9p13 and a potential homologue of a CC chemokine encoded by molluscum contagiosum virus."
      Ishikawa-Mochizuki I., Kitaura M., Baba M., Nakayama T., Izawa D., Imai T., Yamada H., Hieshima K., Suzuki R., Nomiyama H., Yoshie O.
      FEBS Lett. 460:544-548(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    3. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    4. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Strain: C57BL/6J.
      Tissue: Placenta.
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Thymus.
    6. "ESkine, a novel beta-chemokine, is differentially spliced to produce secretable and nuclear targeted isoforms."
      Baird J.W., Nibbs R.J.B., Komai-Koma M., Connolly J.A., Ottersbach K., Clark-Lewis I., Liew F.Y., Graham G.J.
      J. Biol. Chem. 274:33496-33503(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBCELLULAR LOCATION, ALTERNATIVE SPLICING.
      Tissue: Placenta and Testis.
    7. "The chemokine ESkine/CCL27 displays novel modes of intracrine and paracrine function."
      Gortz A., Nibbs R.J.B., McLean P., Jarmin D., Lambie W., Baird J.W., Graham G.J.
      J. Immunol. 169:1387-1394(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBCELLULAR LOCATION.

    Entry informationi

    Entry nameiCCL27_MOUSE
    AccessioniPrimary (citable) accession number: Q9Z1X0
    Secondary accession number(s): Q3KNL1, Q9DAU6, Q9DAZ4
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 30, 2000
    Last sequence update: December 13, 2002
    Last modified: October 1, 2014
    This is version 123 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Caution

    It is uncertain whether Met-1 or Met-2 is the initiator.Curated

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3