Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9Z1X0 (CCL27_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 122. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
C-C motif chemokine 27
Alternative name(s):
CC chemokine ILC
Cutaneous T-cell-attracting chemokine
Short name=CTACK
ESkine
IL-11 R-alpha-locus chemokine
Short name=ALP
Short name=mILC
Skinkine
Small-inducible cytokine A27
Gene names
Name:Ccl27
Synonyms:Ilc, Scya27
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length120 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Chemotactic factor that attracts skin-associated memory T-lymphocytes. May play a role in mediating homing of lymphocytes to cutaneous sites. May play a role in cell migration during embryogenesis. Nuclear forms may facilitate cellular migration by inducing cytoskeletal relaxation. Binds to CCR10.

Subunit structure

Monomer, dimer, and tetramer. Heparin avidly promotes oligomerization By similarity.

Subcellular location

Isoform 1: Secreted. Nucleus. Note: May also be nuclear when following receptor (CCR10)-mediated internalization. Ref.6 Ref.7

Isoform 2: Nucleus Ref.6 Ref.7.

Tissue specificity

Isoform 1 is predominantly expressed in placenta and weakly in skin. Isoform 2 is predominantly expressed in testes and brain, weakly in kidney and liver and even lower in heart and muscle. Low expression of both isoforms in other tissues.

Developmental stage

Expressed during development.

Sequence similarities

Belongs to the intercrine beta (chemokine CC) family.

Caution

It is uncertain whether Met-1 or Met-2 is the initiator.

Ontologies

Keywords
   Cellular componentNucleus
Secreted
   Coding sequence diversityAlternative splicing
   DomainSignal
   Molecular functionCytokine
   PTMDisulfide bond
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processcell chemotaxis

Inferred from electronic annotation. Source: GOC

immune response

Inferred from electronic annotation. Source: InterPro

   Cellular_componentextracellular space

Inferred from electronic annotation. Source: UniProtKB-KW

nucleus

Inferred from electronic annotation. Source: UniProtKB-SubCell

Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9Z1X0-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9Z1X0-2)

Also known as: PESKY;

The sequence of this isoform differs from the canonical sequence as follows:
     1-24: MMEGLSPASSLPLLLLLLSPAPEA → MWRRERSPMSPTSQRLSLEAPSLPLRSWHPWNKTKQKQE

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 2525 Potential
Chain26 – 12095C-C motif chemokine 27
PRO_0000005240

Amino acid modifications

Disulfide bond34 ↔ 63 By similarity
Disulfide bond35 ↔ 78 By similarity

Natural variations

Alternative sequence1 – 2424MMEGL…PAPEA → MWRRERSPMSPTSQRLSLEA PSLPLRSWHPWNKTKQKQE in isoform 2.
VSP_001065

Experimental info

Sequence conflict1151H → N in AAD04163. Ref.1
Sequence conflict1151H → N in BAA88474. Ref.2
Sequence conflict1151H → N in AAD41237. Ref.3
Sequence conflict1151H → N in BAB24001. Ref.4

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified December 13, 2002. Version 2.
Checksum: D1EEE1270AB580BF

FASTA12013,464
        10         20         30         40         50         60 
MMEGLSPASS LPLLLLLLSP APEAALPLPS STSCCTQLYR QPLPSRLLRR IVHMELQEAD 

        70         80         90        100        110        120 
GDCHLQAVVL HLARRSVCVH PQNRSLARWL ERQGKRLQGT VPSLNLVLQK KMYSHPQQQN 

« Hide

Isoform 2 (PESKY) [UniParc].

Checksum: 956BBE8984B74389
Show »

FASTA13515,774

References

« Hide 'large scale' references
[1]"Isolation of ALP, a novel divergent murine CC chemokine with a unique carboxy terminal extension."
Hromas R., Broxmeyer H.E., Kim C., Christopherson K. II, Hou Y.-H.
Biochem. Biophys. Res. Commun. 258:737-740(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
[2]"Molecular cloning of a novel CC chemokine, interleukin-11 receptor alpha-locus chemokine (ILC), which is located on chromosome 9p13 and a potential homologue of a CC chemokine encoded by molluscum contagiosum virus."
Ishikawa-Mochizuki I., Kitaura M., Baba M., Nakayama T., Izawa D., Imai T., Yamada H., Hieshima K., Suzuki R., Nomiyama H., Yoshie O.
FEBS Lett. 460:544-548(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
[3]"CTACK, a skin-associated chemokine that preferentially attracts skin-homing memory T cells."
Morales J., Homey B., Vicari A.P., Hudak S., Oldham E., Hedrick J., Orozco R., Copeland N.G., Jenkins N.A., McEvoy L.M., Zlotnik A.
Proc. Natl. Acad. Sci. U.S.A. 96:14470-14475(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
[4]"The transcriptional landscape of the mammalian genome."
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. expand/collapse author list , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
Strain: C57BL/6J.
Tissue: Placenta.
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Thymus.
[6]"ESkine, a novel beta-chemokine, is differentially spliced to produce secretable and nuclear targeted isoforms."
Baird J.W., Nibbs R.J.B., Komai-Koma M., Connolly J.A., Ottersbach K., Clark-Lewis I., Liew F.Y., Graham G.J.
J. Biol. Chem. 274:33496-33503(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: SUBCELLULAR LOCATION, ALTERNATIVE SPLICING.
Tissue: Placenta and Testis.
[7]"The chemokine ESkine/CCL27 displays novel modes of intracrine and paracrine function."
Gortz A., Nibbs R.J.B., McLean P., Jarmin D., Lambie W., Baird J.W., Graham G.J.
J. Immunol. 169:1387-1394(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: SUBCELLULAR LOCATION.
+Additional computationally mapped references.

Web resources

Wikipedia

CCL27 entry

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF099931 mRNA. Translation: AAD04163.1.
AB013398 mRNA. Translation: BAA88474.1.
AF082392 mRNA. Translation: AAD41237.1.
AK005520 mRNA. Translation: BAB24095.1.
AK005398 mRNA. Translation: BAB24001.1.
BC028511 mRNA. Translation: AAH28511.1.
BC107226 mRNA. Translation: AAI07227.1.
CCDSCCDS18072.1. [Q9Z1X0-1]
RefSeqNP_001157518.1. NM_001164046.1. [Q9Z1X0-1]
NP_001186888.1. NM_001199959.1. [Q9Z1X0-1]
NP_001186890.1. NM_001199961.1. [Q9Z1X0-2]
NP_001186891.1. NM_001199962.1. [Q9Z1X0-2]
NP_001186894.1. NM_001199965.1. [Q9Z1X0-1]
NP_001254631.1. NM_001267702.1. [Q9Z1X0-2]
NP_001254633.1. NM_001267704.1. [Q9Z1X0-1]
NP_035466.1. NM_011336.1.
XP_006543909.1. XM_006543846.1. [Q9Z1X0-1]
UniGeneMm.335946.
Mm.425176.
Mm.441242.
Mm.463309.
Mm.490604.
Mm.6660.

3D structure databases

ProteinModelPortalQ9Z1X0.
SMRQ9Z1X0. Positions 28-112.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

DIPDIP-5905N.
MINTMINT-125205.
STRING10090.ENSMUSP00000103639.

Proteomic databases

PRIDEQ9Z1X0.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000074387; ENSMUSP00000073990; ENSMUSG00000073888.
ENSMUST00000098122; ENSMUSP00000095726; ENSMUSG00000073877. [Q9Z1X0-1]
ENSMUST00000108018; ENSMUSP00000103653; ENSMUSG00000073877. [Q9Z1X0-2]
ENSMUST00000177785; ENSMUSP00000137284; ENSMUSG00000096826. [Q9Z1X0-1]
ENSMUST00000177905; ENSMUSP00000136552; ENSMUSG00000093828. [Q9Z1X0-1]
ENSMUST00000179281; ENSMUSP00000136040; ENSMUSG00000095247. [Q9Z1X0-1]
ENSMUST00000179871; ENSMUSP00000137101; ENSMUSG00000095247. [Q9Z1X0-2]
GeneID100039863.
100039939.
100040048.
100861978.
102641963.
20301.
KEGGmmu:100039863.
mmu:100039939.
mmu:100040048.
mmu:100861978.
mmu:102641963.
mmu:20301.
UCSCuc008sln.2. mouse. [Q9Z1X0-1]

Organism-specific databases

CTD100040048.
20301.
MGIMGI:1343459. Ccl27.

Phylogenomic databases

eggNOGNOG47743.
GeneTreeENSGT00530000063923.
HOGENOMHOG000231671.
HOVERGENHBG050833.
KOK16598.
OMAPLTGWHP.
OrthoDBEOG70W3G4.
PhylomeDBQ9Z1X0.
TreeFamTF337014.

Gene expression databases

ArrayExpressQ9Z1X0.
BgeeQ9Z1X0.
CleanExMM_CCL27.
GenevestigatorQ9Z1X0.

Family and domain databases

InterProIPR001811. Chemokine_IL8-like_dom.
[Graphical view]
PfamPF00048. IL8. 1 hit.
[Graphical view]
SMARTSM00199. SCY. 1 hit.
[Graphical view]
SUPFAMSSF54117. SSF54117. 1 hit.
ProtoNetSearch...

Other

NextBio298041.
PROQ9Z1X0.
SOURCESearch...

Entry information

Entry nameCCL27_MOUSE
AccessionPrimary (citable) accession number: Q9Z1X0
Secondary accession number(s): Q3KNL1, Q9DAU6, Q9DAZ4
Entry history
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: December 13, 2002
Last modified: July 9, 2014
This is version 122 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot