Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9Z1X0

- CCL27_MOUSE

UniProt

Q9Z1X0 - CCL27_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

C-C motif chemokine 27

Gene

Ccl27

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli

Functioni

Chemotactic factor that attracts skin-associated memory T-lymphocytes. May play a role in mediating homing of lymphocytes to cutaneous sites. May play a role in cell migration during embryogenesis. Nuclear forms may facilitate cellular migration by inducing cytoskeletal relaxation. Binds to CCR10.

GO - Biological processi

  1. cell chemotaxis Source: GOC
  2. immune response Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Cytokine

Names & Taxonomyi

Protein namesi
Recommended name:
C-C motif chemokine 27
Alternative name(s):
CC chemokine ILC
Cutaneous T-cell-attracting chemokine
Short name:
CTACK
ESkine
IL-11 R-alpha-locus chemokine
Short name:
ALP
Short name:
mILC
Skinkine
Small-inducible cytokine A27
Gene namesi
Name:Ccl27
Synonyms:Ilc, Scya27
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 4

Organism-specific databases

MGIiMGI:1343459. Ccl27.

Subcellular locationi

Isoform 1 : Secreted. Nucleus
Note: May also be nuclear when following receptor (CCR10)-mediated internalization.

GO - Cellular componenti

  1. extracellular space Source: UniProtKB-KW
  2. nucleus Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Nucleus, Secreted

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2525Sequence AnalysisAdd
BLAST
Chaini26 – 12095C-C motif chemokine 27PRO_0000005240Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi34 ↔ 63By similarity
Disulfide bondi35 ↔ 78By similarity

Keywords - PTMi

Disulfide bond

Proteomic databases

PRIDEiQ9Z1X0.

Expressioni

Tissue specificityi

Isoform 1 is predominantly expressed in placenta and weakly in skin. Isoform 2 is predominantly expressed in testes and brain, weakly in kidney and liver and even lower in heart and muscle. Low expression of both isoforms in other tissues.

Developmental stagei

Expressed during development.

Gene expression databases

BgeeiQ9Z1X0.
CleanExiMM_CCL27.
ExpressionAtlasiQ9Z1X0. baseline.
GenevestigatoriQ9Z1X0.

Interactioni

Subunit structurei

Monomer, dimer, and tetramer. Heparin avidly promotes oligomerization (By similarity).By similarity

Protein-protein interaction databases

DIPiDIP-5905N.
MINTiMINT-125205.
STRINGi10090.ENSMUSP00000103639.

Structurei

3D structure databases

ProteinModelPortaliQ9Z1X0.
SMRiQ9Z1X0. Positions 28-112.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiNOG47743.
GeneTreeiENSGT00530000063923.
HOGENOMiHOG000231671.
HOVERGENiHBG050833.
InParanoidiQ9Z1X0.
KOiK16598.
OMAiPLTGWHP.
OrthoDBiEOG70W3G4.
PhylomeDBiQ9Z1X0.
TreeFamiTF337014.

Family and domain databases

InterProiIPR001811. Chemokine_IL8-like_dom.
[Graphical view]
PfamiPF00048. IL8. 1 hit.
[Graphical view]
SMARTiSM00199. SCY. 1 hit.
[Graphical view]
SUPFAMiSSF54117. SSF54117. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9Z1X0-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MMEGLSPASS LPLLLLLLSP APEAALPLPS STSCCTQLYR QPLPSRLLRR
60 70 80 90 100
IVHMELQEAD GDCHLQAVVL HLARRSVCVH PQNRSLARWL ERQGKRLQGT
110 120
VPSLNLVLQK KMYSHPQQQN
Length:120
Mass (Da):13,464
Last modified:December 13, 2002 - v2
Checksum:iD1EEE1270AB580BF
GO
Isoform 2 (identifier: Q9Z1X0-2) [UniParc]FASTAAdd to Basket

Also known as: PESKY

The sequence of this isoform differs from the canonical sequence as follows:
     1-24: MMEGLSPASSLPLLLLLLSPAPEA → MWRRERSPMSPTSQRLSLEAPSLPLRSWHPWNKTKQKQE

Show »
Length:135
Mass (Da):15,774
Checksum:i956BBE8984B74389
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti115 – 1151H → N in AAD04163. (PubMed:10329455)Curated
Sequence conflicti115 – 1151H → N in BAA88474. (PubMed:10556532)Curated
Sequence conflicti115 – 1151H → N in AAD41237. (PubMed:10588729)Curated
Sequence conflicti115 – 1151H → N in BAB24001. (PubMed:16141072)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 2424MMEGL…PAPEA → MWRRERSPMSPTSQRLSLEA PSLPLRSWHPWNKTKQKQE in isoform 2. 1 PublicationVSP_001065Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF099931 mRNA. Translation: AAD04163.1.
AB013398 mRNA. Translation: BAA88474.1.
AF082392 mRNA. Translation: AAD41237.1.
AK005520 mRNA. Translation: BAB24095.1.
AK005398 mRNA. Translation: BAB24001.1.
BC028511 mRNA. Translation: AAH28511.1.
BC107226 mRNA. Translation: AAI07227.1.
CCDSiCCDS18072.1. [Q9Z1X0-1]
RefSeqiNP_001157518.1. NM_001164046.1. [Q9Z1X0-1]
NP_001186888.1. NM_001199959.1. [Q9Z1X0-1]
NP_001186890.1. NM_001199961.1. [Q9Z1X0-2]
NP_001186891.1. NM_001199962.1. [Q9Z1X0-2]
NP_001186894.1. NM_001199965.1. [Q9Z1X0-1]
NP_001254631.1. NM_001267702.1. [Q9Z1X0-2]
NP_001254633.1. NM_001267704.1. [Q9Z1X0-1]
NP_035466.1. NM_011336.1.
XP_006543909.1. XM_006543846.1. [Q9Z1X0-1]
UniGeneiMm.335946.
Mm.425176.
Mm.441242.
Mm.463309.
Mm.490604.
Mm.6660.

Genome annotation databases

EnsembliENSMUST00000074387; ENSMUSP00000073990; ENSMUSG00000073888.
ENSMUST00000098122; ENSMUSP00000095726; ENSMUSG00000073877. [Q9Z1X0-1]
ENSMUST00000108018; ENSMUSP00000103653; ENSMUSG00000073877. [Q9Z1X0-2]
ENSMUST00000177785; ENSMUSP00000137284; ENSMUSG00000096826. [Q9Z1X0-1]
ENSMUST00000177905; ENSMUSP00000136552; ENSMUSG00000093828. [Q9Z1X0-1]
ENSMUST00000179281; ENSMUSP00000136040; ENSMUSG00000095247. [Q9Z1X0-1]
ENSMUST00000179871; ENSMUSP00000137101; ENSMUSG00000095247. [Q9Z1X0-2]
GeneIDi100039863.
100039939.
100040048.
100861978.
102641963.
20301.
KEGGimmu:100039863.
mmu:100039939.
mmu:100040048.
mmu:100861978.
mmu:102641963.
mmu:20301.
UCSCiuc008sln.2. mouse. [Q9Z1X0-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Web resourcesi

Wikipedia

CCL27 entry

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF099931 mRNA. Translation: AAD04163.1 .
AB013398 mRNA. Translation: BAA88474.1 .
AF082392 mRNA. Translation: AAD41237.1 .
AK005520 mRNA. Translation: BAB24095.1 .
AK005398 mRNA. Translation: BAB24001.1 .
BC028511 mRNA. Translation: AAH28511.1 .
BC107226 mRNA. Translation: AAI07227.1 .
CCDSi CCDS18072.1. [Q9Z1X0-1 ]
RefSeqi NP_001157518.1. NM_001164046.1. [Q9Z1X0-1 ]
NP_001186888.1. NM_001199959.1. [Q9Z1X0-1 ]
NP_001186890.1. NM_001199961.1. [Q9Z1X0-2 ]
NP_001186891.1. NM_001199962.1. [Q9Z1X0-2 ]
NP_001186894.1. NM_001199965.1. [Q9Z1X0-1 ]
NP_001254631.1. NM_001267702.1. [Q9Z1X0-2 ]
NP_001254633.1. NM_001267704.1. [Q9Z1X0-1 ]
NP_035466.1. NM_011336.1.
XP_006543909.1. XM_006543846.1. [Q9Z1X0-1 ]
UniGenei Mm.335946.
Mm.425176.
Mm.441242.
Mm.463309.
Mm.490604.
Mm.6660.

3D structure databases

ProteinModelPortali Q9Z1X0.
SMRi Q9Z1X0. Positions 28-112.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

DIPi DIP-5905N.
MINTi MINT-125205.
STRINGi 10090.ENSMUSP00000103639.

Proteomic databases

PRIDEi Q9Z1X0.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000074387 ; ENSMUSP00000073990 ; ENSMUSG00000073888 .
ENSMUST00000098122 ; ENSMUSP00000095726 ; ENSMUSG00000073877 . [Q9Z1X0-1 ]
ENSMUST00000108018 ; ENSMUSP00000103653 ; ENSMUSG00000073877 . [Q9Z1X0-2 ]
ENSMUST00000177785 ; ENSMUSP00000137284 ; ENSMUSG00000096826 . [Q9Z1X0-1 ]
ENSMUST00000177905 ; ENSMUSP00000136552 ; ENSMUSG00000093828 . [Q9Z1X0-1 ]
ENSMUST00000179281 ; ENSMUSP00000136040 ; ENSMUSG00000095247 . [Q9Z1X0-1 ]
ENSMUST00000179871 ; ENSMUSP00000137101 ; ENSMUSG00000095247 . [Q9Z1X0-2 ]
GeneIDi 100039863.
100039939.
100040048.
100861978.
102641963.
20301.
KEGGi mmu:100039863.
mmu:100039939.
mmu:100040048.
mmu:100861978.
mmu:102641963.
mmu:20301.
UCSCi uc008sln.2. mouse. [Q9Z1X0-1 ]

Organism-specific databases

CTDi 100040048.
20301.
MGIi MGI:1343459. Ccl27.

Phylogenomic databases

eggNOGi NOG47743.
GeneTreei ENSGT00530000063923.
HOGENOMi HOG000231671.
HOVERGENi HBG050833.
InParanoidi Q9Z1X0.
KOi K16598.
OMAi PLTGWHP.
OrthoDBi EOG70W3G4.
PhylomeDBi Q9Z1X0.
TreeFami TF337014.

Miscellaneous databases

NextBioi 298041.
PROi Q9Z1X0.
SOURCEi Search...

Gene expression databases

Bgeei Q9Z1X0.
CleanExi MM_CCL27.
ExpressionAtlasi Q9Z1X0. baseline.
Genevestigatori Q9Z1X0.

Family and domain databases

InterProi IPR001811. Chemokine_IL8-like_dom.
[Graphical view ]
Pfami PF00048. IL8. 1 hit.
[Graphical view ]
SMARTi SM00199. SCY. 1 hit.
[Graphical view ]
SUPFAMi SSF54117. SSF54117. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Isolation of ALP, a novel divergent murine CC chemokine with a unique carboxy terminal extension."
    Hromas R., Broxmeyer H.E., Kim C., Christopherson K. II, Hou Y.-H.
    Biochem. Biophys. Res. Commun. 258:737-740(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "Molecular cloning of a novel CC chemokine, interleukin-11 receptor alpha-locus chemokine (ILC), which is located on chromosome 9p13 and a potential homologue of a CC chemokine encoded by molluscum contagiosum virus."
    Ishikawa-Mochizuki I., Kitaura M., Baba M., Nakayama T., Izawa D., Imai T., Yamada H., Hieshima K., Suzuki R., Nomiyama H., Yoshie O.
    FEBS Lett. 460:544-548(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  3. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  4. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Strain: C57BL/6J.
    Tissue: Placenta.
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Thymus.
  6. "ESkine, a novel beta-chemokine, is differentially spliced to produce secretable and nuclear targeted isoforms."
    Baird J.W., Nibbs R.J.B., Komai-Koma M., Connolly J.A., Ottersbach K., Clark-Lewis I., Liew F.Y., Graham G.J.
    J. Biol. Chem. 274:33496-33503(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION, ALTERNATIVE SPLICING.
    Tissue: Placenta and Testis.
  7. "The chemokine ESkine/CCL27 displays novel modes of intracrine and paracrine function."
    Gortz A., Nibbs R.J.B., McLean P., Jarmin D., Lambie W., Baird J.W., Graham G.J.
    J. Immunol. 169:1387-1394(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION.

Entry informationi

Entry nameiCCL27_MOUSE
AccessioniPrimary (citable) accession number: Q9Z1X0
Secondary accession number(s): Q3KNL1, Q9DAU6, Q9DAZ4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: December 13, 2002
Last modified: October 29, 2014
This is version 124 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Caution

It is uncertain whether Met-1 or Met-2 is the initiator.Curated

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3