Reviewed,
UniProtKB/Swiss-Prot Q9Z1B3 (PLCB1_MOUSE)
Last modified
February 9, 2010.
Version 82.
History...
Clusters with 100%,
90%,
50% identity |
 Documents (2) |
 Third-party data |
 Customize display | text xml rdf/xml gff fasta |
Names and origin · Protein attributes · General annotation (Comments) · Ontologies · Alternative products · Sequence annotation (Features) · Sequences · References · Cross-references · Entry information · Relevant documents
Names and origin
| Protein names | Recommended name: 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-1 EC=3.1.4.11 Alternative name(s): Phosphoinositide phospholipase C-beta-1 Phospholipase C-beta-1 Short name=PLC-beta-1 PLC-154 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus |
Protein attributes
| Sequence length | 1216 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes By similarity. |
| Catalytic activity | 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + H2O = 1D-myo-inositol 1,4,5-trisphosphate + diacylglycerol. |
| Cofactor | Calcium By similarity. |
| Subunit structure | Interacts with DGKQ By similarity. |
| Miscellaneous | The receptor-mediated activation of PLC-beta-1 is mediated by two G-protein alpha subunits, alpha-Q and alpha-11. |
| Sequence similarities | Contains 1 C2 domain. Contains 1 PI-PLC X-box domain. Contains 1 PI-PLC Y-box domain. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Lipid degradation |
| Coding sequence diversity | Alternative splicing |
| Ligand | Calcium |
| Molecular function | Hydrolase Transducer |
| PTM | Acetylation Phosphoprotein |
| Gene Ontology (GO) | |
| Biological process | intracellular signaling cascade Inferred from electronic annotation. Source: InterPro lipid catabolic processInferred from electronic annotation. Source: UniProtKB-KW |
| Molecular function | calcium ion binding Inferred from electronic annotation. Source: UniProtKB-KW phosphoinositide phospholipase C activityInferred from electronic annotation. Source: EC signal transducer activityInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform A (identifier: Q9Z1B3-1) Also known as: C-beta-1a; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform B (identifier: Q9Z1B3-2) Also known as: C-beta-1b; The sequence of this isoform differs from the canonical sequence as follows: 1142-1216: LQTELEQEYQ...NPGREFDTPL → GEGPSSVLSEGCHEDPSVPPNFTPPNPQALKW | ||||||
| Isoform C (identifier: Q9Z1B3-3) The sequence of this isoform differs from the canonical sequence as follows: 1199-1216: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1216 | 1216 | 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-1 | PRO_0000088487 | |||||
Regions | |||||||||
| Domain | 316 – 467 | 152 | PI-PLC X-box | ||||||
| Domain | 540 – 656 | 117 | PI-PLC Y-box | ||||||
| Domain | 663 – 761 | 99 | C2 | ||||||
| Compositional bias | 914 – 1088 | 175 | Lys-rich | ||||||
Sites | |||||||||
| Active site | 331 | 1 | By similarity | ||||||
| Active site | 378 | 1 | By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 333 | 1 | Phosphothreonine Ref.5 | ||||||
| Modified residue | 334 | 1 | Phosphotyrosine Ref.5 | ||||||
| Modified residue | 336 | 1 | Phosphothreonine Ref.5 | ||||||
| Modified residue | 569 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 573 | 1 | Phosphothreonine By similarity | ||||||
| Modified residue | 887 | 1 | Phosphoserine; by PKC By similarity | ||||||
| Modified residue | 972 | 1 | N6-acetyllysine By similarity | ||||||
| Modified residue | 976 | 1 | N6-acetyllysine By similarity | ||||||
| Modified residue | 1197 | 1 | Phosphoserine Ref.6 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1142 – 1216 | 75 | LQTEL…FDTPL → GEGPSSVLSEGCHEDPSVPP NFTPPNPQALKW in isoform B. | VSP_008917 | |||||
| Alternative sequence | 1199 – 1216 | 18 | Missing in isoform C. | VSP_008918 | |||||
| Natural variant | 28 | 1 | L → F in strain: ILS and ISS. | ||||||
| Natural variant | 41 | 1 | T → I in strain: C57BL/6, ILS and ISS. | ||||||
| Natural variant | 67 | 1 | S → T in strain: C57BL/6. | ||||||
| Natural variant | 79 | 1 | E → K in strain: C57BL/6, ILS and ISS. | ||||||
| Natural variant | 112 | 1 | A → V in strain: C57BL/6, ILS and ISS. | ||||||
| Natural variant | 622 | 1 | M → V in strain: ILS and ISS. | ||||||
| Natural variant | 714 | 1 | T → K in strain: ILS and ISS. | ||||||
| Natural variant | 795 | 1 | D → V in strain: ILS and ISS. | ||||||
| Natural variant | 923 | 1 | H → Q in strain: ILS and ISS. | ||||||
| Natural variant | 957 | 1 | I → N in strain: ILS and ISS. | ||||||
| Natural variant | 1084 | 1 | T → K in strain: ILS and ISS. | ||||||
| Natural variant | 1197 | 1 | S → G in strain: ILS. | ||||||
| Natural variant | 1197 | 1 | S → W in strain: ISS. | ||||||
| Natural variant | 1198 | 1 | P → S in strain: ILS and ISS. | ||||||
Experimental info | |||||||||
| Sequence conflict | 561 | 1 | R → I in CAA64637. Ref.4 | ||||||
| Sequence conflict | 613 | 1 | L → I Ref.4 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning of PI-specific phospholipase C's from 3T3 cells. Expression and membrane targeting of a novel phospholipase C-beta-1 isoform." Bai J., Wu K., Marks D.L., Machamer C., Pagano R.E. Submitted (JAN-1997) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A AND B). Strain: Swiss. |
| [2] | "High-throughput sequence identification of gene coding variants within alcohol-related QTLs." Ehringer M.A., Thompson J., Conroy O., Xu Y., Yang F., Canniff J., Beeson M., Gordon L., Bennett B., Johnson T.E., Sikela J.M. Mamm. Genome 12:657-663(2001) [PubMed: 11471062] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM C). Strain: ILS and ISS. |
| [3] | "Patterns of expression for the mRNA corresponding to the four isoforms of phospholipase Cbeta in mouse brain." Watanabe M., Nakamura M., Sato K., Kano M., Simon M.I., Inoue Y. Eur. J. Neurosci. 10:2016-2025(1998) [PubMed: 9753089] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 29-145. Strain: C57BL/6. |
| [4] | "Phospholipase C in mouse oocytes: characterization of beta and gamma isoforms and their possible involvement in sperm-induced Ca2+ spiking." Dupont G., McGuinness O.M., Johnson M.H., Berridge M.J., Borgese F. Biochem. J. 316:583-591(1996) [PubMed: 8687404] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 428-615. Tissue: Oocyte. |
| [5] | "Proteomic analysis of in vivo phosphorylated synaptic proteins." Collins M.O., Yu L., Coba M.P., Husi H., Campuzano I., Blackstock W.P., Choudhary J.S., Grant S.G. J. Biol. Chem. 280:5972-5982(2005) [PubMed: 15572359] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-333; TYR-334 AND THR-336, MASS SPECTROMETRY. Tissue: Brain. |
| [6] | "Qualitative and quantitative analyses of protein phosphorylation in naive and stimulated mouse synaptosomal preparations." Munton R.P., Tweedie-Cullen R., Livingstone-Zatchej M., Weinandy F., Waidelich M., Longo D., Gehrig P., Potthast F., Rutishauser D., Gerrits B., Panse C., Schlapbach R., Mansuy I.M. Mol. Cell. Proteomics 6:283-293(2007) [PubMed: 17114649] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1197, MASS SPECTROMETRY. Tissue: Brain cortex. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U85712 mRNA. Translation: AAD00571.1. U85713 mRNA. Translation: AAD00572.1. U85714 mRNA. Translation: AAD00573.1. AF498249 mRNA. Translation: AAM22966.1. AF498250 mRNA. Translation: AAM22967.1. AF022801 mRNA. Translation: AAD01749.1. X95344 mRNA. Translation: CAA64637.1. |
| IPI | IPI00130045. IPI00323250. IPI00468121. |
| PIR | S68256. |
| UniGene | Mm.330607 |
3D structure databases | |
| SMR | Q9Z1B3. Positions 18-797, 900-1171. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q9Z1B3. |
PTM databases | |
| PhosphoSite | Q9Z1B3. |
Proteomic databases | |
| PRIDE | Q9Z1B3. |
Genome annotation databases | |
| Ensembl | ENSMUST00000110116; ENSMUSP00000105743; ENSMUSG00000051177; Mus musculus. [Genome view] |
| UCSC | uc008mnz.1. mouse. |
Organism-specific databases | |
| MGI | MGI:97613. Plcb1. |
Phylogenomic databases | |
| HOGENOM | HBG315986. |
| HOVERGEN | Q9Z1B3. |
| InParanoid | Q9Z1B3. |
| PhylomeDB | Q9Z1B3. |
Enzyme and pathway databases | |
| BRENDA | 3.1.4.11. 244. |
Gene expression databases | |
| ArrayExpress | Q9Z1B3. |
| Bgee | Q9Z1B3. |
| CleanEx | MM_PLCB1. |
| Genevestigator | Q9Z1B3. |
| GermOnline | ENSMUSG00000051177. Mus musculus. |
Family and domain databases | |
| InterPro | IPR000008. C2_Ca-dep. IPR008973. C2_Ca/lipid-bd_dom_CaLB. IPR018029. C2_membr_targeting. IPR011992. EF-hand-like_dom. IPR015359. Phospholipase_C_EF-hand-like. IPR001192. Phospholipase_C_Pinositol-sp_C. IPR001711. Phospholipase_C_Pinositol-sp_Y. IPR016280. PLC-beta. IPR017946. PLC-like_Pdiesterase_TIM-brl. IPR000909. PLipase_C_PInositol-sp_X_dom. [Graphical view] |
| Gene3D | G3DSA:1.10.238.10. EF-Hand_type. 1 hit. G3DSA:3.20.20.190. PLC-like_Pdiesterase_TIM-brl. 1 hit. |
| Pfam | PF00168. C2. 1 hit. PF09279. efhand_like. 1 hit. PF00388. PI-PLC-X. 1 hit. PF00387. PI-PLC-Y. 1 hit. [Graphical view] |
| PIRSF | PIRSF000956. PLC-beta. 1 hit. |
| PRINTS | PR00390. PHPHLIPASEC. |
| SMART | SM00239. C2. 1 hit. SM00148. PLCXc. 1 hit. SM00149. PLCYc. 1 hit. [Graphical view] |
| PROSITE | PS50004. C2. 1 hit. PS50007. PIPLC_X_DOMAIN. 1 hit. PS50008. PIPLC_Y_DOMAIN. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 295080. |
| SOURCE | Search... |
Entry information
| Entry name | PLCB1_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q9Z1B3 Secondary accession number(s): Q62075  Q9Z2T5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |
