SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9Z1B3

- PLCB1_MOUSE

UniProt

Q9Z1B3 - PLCB1_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1
Gene
Plcb1, Plcb
Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at transcript leveli

Functioni

The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes By similarity.

Catalytic activityi

1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + H2O = 1D-myo-inositol 1,4,5-trisphosphate + diacylglycerol.

Cofactori

Calcium By similarity.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei331 – 3311 By similarity
Active sitei378 – 3781 By similarity

GO - Molecular functioni

  1. GTPase activator activity Source: Ensembl
  2. calcium ion binding Source: InterPro
  3. calmodulin binding Source: BHF-UCL
  4. enzyme binding Source: BHF-UCL
  5. lamin binding Source: BHF-UCL
  6. phosphatidylinositol phospholipase C activity Source: BHF-UCL
  7. phosphatidylinositol-4,5-bisphosphate binding Source: BHF-UCL
  8. protein binding Source: BHF-UCL
  9. protein homodimerization activity Source: BHF-UCL
  10. signal transducer activity Source: UniProtKB-KW

GO - Biological processi

  1. G-protein coupled acetylcholine receptor signaling pathway Source: BHF-UCL
  2. G2/M transition of mitotic cell cycle Source: BHF-UCL
  3. activation of meiosis involved in egg activation Source: BHF-UCL
  4. brain development Source: BHF-UCL
  5. cell adhesion Source: BHF-UCL
  6. cerebral cortex development Source: BHF-UCL
  7. erythrocyte differentiation Source: BHF-UCL
  8. fat cell differentiation Source: BHF-UCL
  9. glutamate receptor signaling pathway Source: BHF-UCL
  10. insulin receptor signaling pathway Source: BHF-UCL
  11. insulin-like growth factor receptor signaling pathway Source: BHF-UCL
  12. interleukin-1-mediated signaling pathway Source: Ensembl
  13. interleukin-12-mediated signaling pathway Source: BHF-UCL
  14. interleukin-15-mediated signaling pathway Source: BHF-UCL
  15. intracellular signal transduction Source: InterPro
  16. lipid catabolic process Source: UniProtKB-KW
  17. mRNA processing Source: BHF-UCL
  18. macrophage differentiation Source: BHF-UCL
  19. memory Source: BHF-UCL
  20. negative regulation of monocyte extravasation Source: BHF-UCL
  21. negative regulation of transcription, DNA-templated Source: BHF-UCL
  22. oocyte maturation Source: BHF-UCL
  23. phosphatidylinositol metabolic process Source: BHF-UCL
  24. positive regulation of CD24 biosynthetic process Source: BHF-UCL
  25. positive regulation of G1/S transition of mitotic cell cycle Source: BHF-UCL
  26. positive regulation of JNK cascade Source: BHF-UCL
  27. positive regulation of acrosome reaction Source: BHF-UCL
  28. positive regulation of developmental growth Source: BHF-UCL
  29. positive regulation of embryonic development Source: BHF-UCL
  30. positive regulation of interleukin-12 production Source: BHF-UCL
  31. positive regulation of myoblast differentiation Source: BHF-UCL
  32. positive regulation of sodium:proton antiporter activity Source: BHF-UCL
  33. positive regulation of transcription, DNA-templated Source: BHF-UCL
  34. regulation of G-protein coupled receptor protein signaling pathway Source: BHF-UCL
  35. regulation of fertilization Source: BHF-UCL
  36. signal transduction Source: BHF-UCL
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Transducer

Keywords - Biological processi

Lipid degradation, Lipid metabolism

Keywords - Ligandi

Calcium

Enzyme and pathway databases

BRENDAi3.1.4.11. 3474.
ReactomeiREACT_196473. Synthesis of IP3 and IP4 in the cytosol.
REACT_198612. Presynaptic function of Kainate receptors.
REACT_207651. G alpha (q) signalling events.
REACT_221970. Ca2+ pathway.

Names & Taxonomyi

Protein namesi
Recommended name:
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 (EC:3.1.4.11)
Alternative name(s):
PLC-154
Phosphoinositide phospholipase C-beta-1
Phospholipase C-beta-1
Short name:
PLC-beta-1
Gene namesi
Name:Plcb1
Synonyms:Plcb
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 2

Organism-specific databases

MGIiMGI:97613. Plcb1.

Subcellular locationi

Nucleus membrane. Cytoplasm By similarity
Note: Colocalizes with the adrenergic receptors, ADREN1A and ADREN1B, at the nuclear membrane of cardiac myocytes By similarity.1 Publication

GO - Cellular componenti

  1. cytoplasm Source: BHF-UCL
  2. nuclear chromatin Source: BHF-UCL
  3. nuclear membrane Source: UniProtKB-SubCell
  4. nuclear speck Source: BHF-UCL
  5. nucleus Source: BHF-UCL
  6. plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Membrane, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 121612161-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1
PRO_0000088487Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei887 – 8871Phosphoserine; by PKC By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ9Z1B3.
PaxDbiQ9Z1B3.
PRIDEiQ9Z1B3.

PTM databases

PhosphoSiteiQ9Z1B3.

Expressioni

Gene expression databases

ArrayExpressiQ9Z1B3.
BgeeiQ9Z1B3.
CleanExiMM_PLCB1.
GenevestigatoriQ9Z1B3.

Interactioni

Subunit structurei

Interacts with DGKQ By similarity.

Protein-protein interaction databases

BioGridi202232. 1 interaction.
IntActiQ9Z1B3. 4 interactions.
MINTiMINT-4107696.

Structurei

3D structure databases

ProteinModelPortaliQ9Z1B3.
SMRiQ9Z1B3. Positions 11-830, 890-1170.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini316 – 467152PI-PLC X-box
Add
BLAST
Domaini540 – 656117PI-PLC Y-box
Add
BLAST
Domaini663 – 76199C2
Add
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi914 – 1088175Lys-rich
Add
BLAST

Sequence similaritiesi

Contains 1 C2 domain.

Phylogenomic databases

eggNOGiNOG149692.
GeneTreeiENSGT00730000110266.
HOVERGENiHBG053609.
InParanoidiQ6PDH1.
KOiK05858.
OMAiMMDFINL.
OrthoDBiEOG7WDN1N.
TreeFamiTF313216.

Family and domain databases

Gene3Di1.10.238.10. 1 hit.
2.60.40.150. 1 hit.
3.20.20.190. 2 hits.
InterProiIPR000008. C2_dom.
IPR011992. EF-hand-dom_pair.
IPR001192. PI-PLC_fam.
IPR016280. PLC-beta.
IPR028400. PLC-beta1.
IPR014815. PLC-beta_C.
IPR009535. PLC-beta_CS.
IPR017946. PLC-like_Pdiesterase_TIM-brl.
IPR015359. PLipase_C_EF-hand-like.
IPR000909. PLipase_C_PInositol-sp_X_dom.
IPR001711. PLipase_C_Pinositol-sp_Y.
[Graphical view]
PANTHERiPTHR10336. PTHR10336. 1 hit.
PTHR10336:SF12. PTHR10336:SF12. 1 hit.
PfamiPF00168. C2. 1 hit.
PF06631. DUF1154. 1 hit.
PF09279. EF-hand_like. 1 hit.
PF00388. PI-PLC-X. 1 hit.
PF00387. PI-PLC-Y. 1 hit.
PF08703. PLC-beta_C. 1 hit.
[Graphical view]
PIRSFiPIRSF000956. PLC-beta. 1 hit.
PRINTSiPR00390. PHPHLIPASEC.
SMARTiSM00239. C2. 1 hit.
SM00148. PLCXc. 1 hit.
SM00149. PLCYc. 1 hit.
[Graphical view]
SUPFAMiSSF49562. SSF49562. 1 hit.
SSF51695. SSF51695. 1 hit.
PROSITEiPS50004. C2. 1 hit.
PS50007. PIPLC_X_DOMAIN. 1 hit.
PS50008. PIPLC_Y_DOMAIN. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform A (identifier: Q9Z1B3-1) [UniParc]FASTAAdd to Basket

Also known as: C-beta-1a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MAGAQPGVHA LQLKPVCVSD SLKKGTKFVK WDDDSTIVTP IILRTDPQGF     50
FFYWTDQNKE TELLDLSLVK DARCGKHAKA PKDPKLRELL DVGNIGHLEQ 100
RMITVVYGPD LVNISHLNLV AFQEEVAKEW TNEVFSLATN LLAQNMSRDA 150
FLEKAYTKLK LQVTPEGRIP LKNIYRLFSA DRKRVETALE ACSLPSSRND 200
SIPQEDFTPD VYRVFLNNLC PRPEIDNIFS EFGAKSKPYL TVDQMMDFIN 250
LKQRDPRLNE ILYPPLKQEQ VQVLIEKYEP NSSLAKKGQM SVDGFMRYLS 300
GEENGVVSPE KLDLNEDMSQ PLSHYFINSS HNTYLTAGQL AGNSSVEMYR 350
QVLLSGCRCV ELDCWKGRTA EEEPVITHGF TMTTEISFKE VIEAIAECAF 400
KTSPFPILLS FENHVDSPKQ QAKMAEYCRL IFGDALLMEP LEKYPLESGV 450
PLPSPMDLMY KILVKNKKKS HKSSEGSGKK KLSEQASNTY SDSSSVFEPS 500
SPGAGEADTE SDDDDDDDDC KKSSMDEGTA GSEAMATEEM SNLVNYIQPV 550
KFESFEISKK RNKSFEMSSF VETKGLEQLT KSPVEFVEYN KMQLSRIYPK 600
GTRVDSSNYM PQLFWNAGCQ MVALNFQTVD LAMQINMGMY EYNGKSGYRL 650
KPEFMRRPDK HFDPFTEGIV DGIVANTLSV KIISGQFLSD KKVGTYVEVD 700
MFGLPVDTRR KAFKTKTSQG NAVNPVWEEE PIVFKKVVLP SLACLRIAAY 750
EEGGKFIGHR ILPVQAIRPG YHYICLRNER NQPLTLPAVF VYIEVKDYVP 800
DTYADVIEAL SNPIRYVNLM EQRAKQLAAL TLEDEEEVKK EADPGETSSE 850
APSETRTTPA ENGVNHTASL APKPPSQAPH SQPAPGSVKA PAKTEDLIQS 900
VLTEVEAQTI EELKQQKSFV KLQKKHYKEM KDLVKRHHKK TTELIKEHTT 950
KYNEIQNDYL RRRAALEKSA KKDSKKKSEP SSPDHGSSAI EQDLAALDAE 1000
MTQKLIDLKD KQQQQLLNLR QEQYYSEKYQ KREHIKLLIQ KLTDVAEECQ 1050
NNQLKKLKEI CEKEKKELKK KMDKKRQEKI TEAKSKDKSQ MEEEKTEMIR 1100
SYIQEVVQYI KRLEEAQSKR QEKLVEKHNE IRQQILDEKP KLQTELEQEY 1150
QDKFKRLPLE ILEFVQEAMK GKISEDSNHG SAPPSLASDA AKVNLKSPSS 1200
EEIERENPGR EFDTPL 1216
Length:1,216
Mass (Da):138,396
Last modified:July 27, 2011 - v2
Checksum:iCC751D49895A47D0
GO
Isoform B (identifier: Q9Z1B3-2) [UniParc]FASTAAdd to Basket

Also known as: C-beta-1b

The sequence of this isoform differs from the canonical sequence as follows:
     1142-1216: LQTELEQEYQ...NPGREFDTPL → GEGPSSVLSEGCHEDPSVPPNFTPPNPQALKW

Show »
Length:1,173
Mass (Da):133,327
Checksum:i5AA8EEB1FCED1D93
GO
Isoform C (identifier: Q9Z1B3-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1199-1216: Missing.

Note: No experimental confirmation available.

Show »
Length:1,198
Mass (Da):136,309
Checksum:iE95E5F34E58C48CA
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1142 – 121675LQTEL…FDTPL → GEGPSSVLSEGCHEDPSVPP NFTPPNPQALKW in isoform B.
VSP_008917Add
BLAST
Alternative sequencei1199 – 121618Missing in isoform C.
VSP_008918Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti28 – 281F → L in AAD00571. 1 Publication
Sequence conflicti28 – 281F → L in AAD00572. 1 Publication
Sequence conflicti28 – 281F → L in AAD00573. 1 Publication
Sequence conflicti41 – 411I → T in AAD00571. 1 Publication
Sequence conflicti41 – 411I → T in AAD00572. 1 Publication
Sequence conflicti41 – 411I → T in AAD00573. 1 Publication
Sequence conflicti67 – 671S → T in AAD01749. 1 Publication
Sequence conflicti79 – 791K → E in AAD00571. 1 Publication
Sequence conflicti79 – 791K → E in AAD00572. 1 Publication
Sequence conflicti79 – 791K → E in AAD00573. 1 Publication
Sequence conflicti112 – 1121V → A in AAD00571. 1 Publication
Sequence conflicti112 – 1121V → A in AAD00572. 1 Publication
Sequence conflicti112 – 1121V → A in AAD00573. 1 Publication
Sequence conflicti561 – 5611R → I in CAA64637. 1 Publication
Sequence conflicti613 – 6131L → I in CAA64637. 1 Publication
Sequence conflicti622 – 6221V → M in AAD00571. 1 Publication
Sequence conflicti622 – 6221V → M in AAD00572. 1 Publication
Sequence conflicti622 – 6221V → M in AAD00573. 1 Publication
Sequence conflicti714 – 7141K → T in AAD00571. 1 Publication
Sequence conflicti714 – 7141K → T in AAD00572. 1 Publication
Sequence conflicti714 – 7141K → T in AAD00573. 1 Publication
Sequence conflicti795 – 7951V → D in AAD00571. 1 Publication
Sequence conflicti795 – 7951V → D in AAD00572. 1 Publication
Sequence conflicti795 – 7951V → D in AAD00573. 1 Publication
Sequence conflicti923 – 9231Q → H in AAD00571. 1 Publication
Sequence conflicti923 – 9231Q → H in AAD00572. 1 Publication
Sequence conflicti923 – 9231Q → H in AAD00573. 1 Publication
Sequence conflicti957 – 9571N → I in AAD00571. 1 Publication
Sequence conflicti957 – 9571N → I in AAD00572. 1 Publication
Sequence conflicti957 – 9571N → I in AAD00573. 1 Publication
Sequence conflicti1084 – 10841K → T in AAD00571. 1 Publication
Sequence conflicti1084 – 10841K → T in AAD00572. 1 Publication
Sequence conflicti1084 – 10841K → T in AAD00573. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U85712 mRNA. Translation: AAD00571.1.
U85713 mRNA. Translation: AAD00572.1.
U85714 mRNA. Translation: AAD00573.1.
AF498249 mRNA. Translation: AAM22966.1.
AF498250 mRNA. Translation: AAM22967.1.
AL928635
, AL840635, AL928956, AL935278 Genomic DNA. Translation: CAM23602.1.
AL840635
, AL928635, AL928956, AL935278 Genomic DNA. Translation: CAM23766.1.
AL928956
, AL840635, AL928635, AL935278 Genomic DNA. Translation: CAM26804.1.
AL935278
, AL840635, AL928635, AL928956 Genomic DNA. Translation: CAM27130.1.
BC058710 mRNA. Translation: AAH58710.1.
AF022801 mRNA. Translation: AAD01749.1.
X95344 mRNA. Translation: CAA64637.1.
CCDSiCCDS16787.1. [Q9Z1B3-2]
CCDS50729.1. [Q9Z1B3-1]
PIRiS68256.
RefSeqiNP_001139302.1. NM_001145830.1. [Q9Z1B3-1]
NP_062651.2. NM_019677.2. [Q9Z1B3-2]
UniGeneiMm.330607.

Genome annotation databases

EnsembliENSMUST00000070724; ENSMUSP00000064844; ENSMUSG00000051177. [Q9Z1B3-2]
ENSMUST00000110116; ENSMUSP00000105743; ENSMUSG00000051177. [Q9Z1B3-1]
GeneIDi18795.
KEGGimmu:18795.
UCSCiuc008mny.2. mouse. [Q9Z1B3-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U85712 mRNA. Translation: AAD00571.1 .
U85713 mRNA. Translation: AAD00572.1 .
U85714 mRNA. Translation: AAD00573.1 .
AF498249 mRNA. Translation: AAM22966.1 .
AF498250 mRNA. Translation: AAM22967.1 .
AL928635
, AL840635 , AL928956 , AL935278 Genomic DNA. Translation: CAM23602.1 .
AL840635
, AL928635 , AL928956 , AL935278 Genomic DNA. Translation: CAM23766.1 .
AL928956
, AL840635 , AL928635 , AL935278 Genomic DNA. Translation: CAM26804.1 .
AL935278
, AL840635 , AL928635 , AL928956 Genomic DNA. Translation: CAM27130.1 .
BC058710 mRNA. Translation: AAH58710.1 .
AF022801 mRNA. Translation: AAD01749.1 .
X95344 mRNA. Translation: CAA64637.1 .
CCDSi CCDS16787.1. [Q9Z1B3-2 ]
CCDS50729.1. [Q9Z1B3-1 ]
PIRi S68256.
RefSeqi NP_001139302.1. NM_001145830.1. [Q9Z1B3-1 ]
NP_062651.2. NM_019677.2. [Q9Z1B3-2 ]
UniGenei Mm.330607.

3D structure databases

ProteinModelPortali Q9Z1B3.
SMRi Q9Z1B3. Positions 11-830, 890-1170.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 202232. 1 interaction.
IntActi Q9Z1B3. 4 interactions.
MINTi MINT-4107696.

PTM databases

PhosphoSitei Q9Z1B3.

Proteomic databases

MaxQBi Q9Z1B3.
PaxDbi Q9Z1B3.
PRIDEi Q9Z1B3.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000070724 ; ENSMUSP00000064844 ; ENSMUSG00000051177 . [Q9Z1B3-2 ]
ENSMUST00000110116 ; ENSMUSP00000105743 ; ENSMUSG00000051177 . [Q9Z1B3-1 ]
GeneIDi 18795.
KEGGi mmu:18795.
UCSCi uc008mny.2. mouse. [Q9Z1B3-1 ]

Organism-specific databases

CTDi 23236.
MGIi MGI:97613. Plcb1.

Phylogenomic databases

eggNOGi NOG149692.
GeneTreei ENSGT00730000110266.
HOVERGENi HBG053609.
InParanoidi Q6PDH1.
KOi K05858.
OMAi MMDFINL.
OrthoDBi EOG7WDN1N.
TreeFami TF313216.

Enzyme and pathway databases

BRENDAi 3.1.4.11. 3474.
Reactomei REACT_196473. Synthesis of IP3 and IP4 in the cytosol.
REACT_198612. Presynaptic function of Kainate receptors.
REACT_207651. G alpha (q) signalling events.
REACT_221970. Ca2+ pathway.

Miscellaneous databases

ChiTaRSi PLCB1. mouse.
NextBioi 295080.
PROi Q9Z1B3.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q9Z1B3.
Bgeei Q9Z1B3.
CleanExi MM_PLCB1.
Genevestigatori Q9Z1B3.

Family and domain databases

Gene3Di 1.10.238.10. 1 hit.
2.60.40.150. 1 hit.
3.20.20.190. 2 hits.
InterProi IPR000008. C2_dom.
IPR011992. EF-hand-dom_pair.
IPR001192. PI-PLC_fam.
IPR016280. PLC-beta.
IPR028400. PLC-beta1.
IPR014815. PLC-beta_C.
IPR009535. PLC-beta_CS.
IPR017946. PLC-like_Pdiesterase_TIM-brl.
IPR015359. PLipase_C_EF-hand-like.
IPR000909. PLipase_C_PInositol-sp_X_dom.
IPR001711. PLipase_C_Pinositol-sp_Y.
[Graphical view ]
PANTHERi PTHR10336. PTHR10336. 1 hit.
PTHR10336:SF12. PTHR10336:SF12. 1 hit.
Pfami PF00168. C2. 1 hit.
PF06631. DUF1154. 1 hit.
PF09279. EF-hand_like. 1 hit.
PF00388. PI-PLC-X. 1 hit.
PF00387. PI-PLC-Y. 1 hit.
PF08703. PLC-beta_C. 1 hit.
[Graphical view ]
PIRSFi PIRSF000956. PLC-beta. 1 hit.
PRINTSi PR00390. PHPHLIPASEC.
SMARTi SM00239. C2. 1 hit.
SM00148. PLCXc. 1 hit.
SM00149. PLCYc. 1 hit.
[Graphical view ]
SUPFAMi SSF49562. SSF49562. 1 hit.
SSF51695. SSF51695. 1 hit.
PROSITEi PS50004. C2. 1 hit.
PS50007. PIPLC_X_DOMAIN. 1 hit.
PS50008. PIPLC_Y_DOMAIN. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning of PI-specific phospholipase C's from 3T3 cells. Expression and membrane targeting of a novel phospholipase C-beta-1 isoform."
    Bai J., Wu K., Marks D.L., Machamer C., Pagano R.E.
    Submitted (JAN-1997) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A AND B).
    Strain: Swiss.
  2. "High-throughput sequence identification of gene coding variants within alcohol-related QTLs."
    Ehringer M.A., Thompson J., Conroy O., Xu Y., Yang F., Canniff J., Beeson M., Gordon L., Bennett B., Johnson T.E., Sikela J.M.
    Mamm. Genome 12:657-663(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM C).
    Strain: ILS and ISS.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM A).
    Strain: C57BL/6.
    Tissue: Brain.
  5. "Patterns of expression for the mRNA corresponding to the four isoforms of phospholipase Cbeta in mouse brain."
    Watanabe M., Nakamura M., Sato K., Kano M., Simon M.I., Inoue Y.
    Eur. J. Neurosci. 10:2016-2025(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 29-145.
    Strain: C57BL/6.
  6. "Phospholipase C in mouse oocytes: characterization of beta and gamma isoforms and their possible involvement in sperm-induced Ca2+ spiking."
    Dupont G., McGuinness O.M., Johnson M.H., Berridge M.J., Borgese F.
    Biochem. J. 316:583-591(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 428-615.
    Tissue: Oocyte.
  7. "Nuclear alpha1-adrenergic receptors signal activated ERK localization to caveolae in adult cardiac myocytes."
    Wright C.D., Chen Q., Baye N.L., Huang Y., Healy C.L., Kasinathan S., O'Connell T.D.
    Circ. Res. 103:992-1000(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION.

Entry informationi

Entry nameiPLCB1_MOUSE
AccessioniPrimary (citable) accession number: Q9Z1B3
Secondary accession number(s): Q62075
, Q6PDH1, Q8K5A5, Q8K5A6, Q9Z0E5, Q9Z2T5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 14, 2003
Last sequence update: July 27, 2011
Last modified: September 3, 2014
This is version 131 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Miscellaneous

The receptor-mediated activation of PLC-beta-1 is mediated by two G-protein alpha subunits, alpha-Q and alpha-11.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi