Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9Z1B3

- PLCB1_MOUSE

UniProt

Q9Z1B3 - PLCB1_MOUSE

Protein

1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1

Gene

Plcb1

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 132 (01 Oct 2014)
      Sequence version 2 (27 Jul 2011)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes.By similarity

    Catalytic activityi

    1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + H2O = 1D-myo-inositol 1,4,5-trisphosphate + diacylglycerol.

    Cofactori

    Calcium.By similarity

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Active sitei331 – 3311PROSITE-ProRule annotation
    Active sitei378 – 3781PROSITE-ProRule annotation

    GO - Molecular functioni

    1. calcium ion binding Source: InterPro
    2. calmodulin binding Source: BHF-UCL
    3. enzyme binding Source: BHF-UCL
    4. GTPase activator activity Source: Ensembl
    5. lamin binding Source: BHF-UCL
    6. phosphatidylinositol-4,5-bisphosphate binding Source: BHF-UCL
    7. phosphatidylinositol phospholipase C activity Source: BHF-UCL
    8. protein binding Source: BHF-UCL
    9. protein homodimerization activity Source: BHF-UCL
    10. signal transducer activity Source: UniProtKB-KW

    GO - Biological processi

    1. activation of meiosis involved in egg activation Source: BHF-UCL
    2. brain development Source: BHF-UCL
    3. cell adhesion Source: BHF-UCL
    4. cerebral cortex development Source: BHF-UCL
    5. erythrocyte differentiation Source: BHF-UCL
    6. fat cell differentiation Source: BHF-UCL
    7. G2/M transition of mitotic cell cycle Source: BHF-UCL
    8. glutamate receptor signaling pathway Source: BHF-UCL
    9. G-protein coupled acetylcholine receptor signaling pathway Source: BHF-UCL
    10. insulin-like growth factor receptor signaling pathway Source: BHF-UCL
    11. insulin receptor signaling pathway Source: BHF-UCL
    12. interleukin-12-mediated signaling pathway Source: BHF-UCL
    13. interleukin-15-mediated signaling pathway Source: BHF-UCL
    14. interleukin-1-mediated signaling pathway Source: Ensembl
    15. intracellular signal transduction Source: InterPro
    16. lipid catabolic process Source: UniProtKB-KW
    17. macrophage differentiation Source: BHF-UCL
    18. memory Source: BHF-UCL
    19. mRNA processing Source: BHF-UCL
    20. negative regulation of monocyte extravasation Source: BHF-UCL
    21. negative regulation of transcription, DNA-templated Source: BHF-UCL
    22. oocyte maturation Source: BHF-UCL
    23. phosphatidylinositol metabolic process Source: BHF-UCL
    24. positive regulation of acrosome reaction Source: BHF-UCL
    25. positive regulation of CD24 biosynthetic process Source: BHF-UCL
    26. positive regulation of developmental growth Source: BHF-UCL
    27. positive regulation of embryonic development Source: BHF-UCL
    28. positive regulation of G1/S transition of mitotic cell cycle Source: BHF-UCL
    29. positive regulation of interleukin-12 production Source: BHF-UCL
    30. positive regulation of JNK cascade Source: BHF-UCL
    31. positive regulation of myoblast differentiation Source: BHF-UCL
    32. positive regulation of sodium:proton antiporter activity Source: BHF-UCL
    33. positive regulation of transcription, DNA-templated Source: BHF-UCL
    34. regulation of fertilization Source: BHF-UCL
    35. regulation of G-protein coupled receptor protein signaling pathway Source: BHF-UCL
    36. signal transduction Source: BHF-UCL

    Keywords - Molecular functioni

    Hydrolase, Transducer

    Keywords - Biological processi

    Lipid degradation, Lipid metabolism

    Keywords - Ligandi

    Calcium

    Enzyme and pathway databases

    BRENDAi3.1.4.11. 3474.
    ReactomeiREACT_196473. Synthesis of IP3 and IP4 in the cytosol.
    REACT_198612. Presynaptic function of Kainate receptors.
    REACT_207651. G alpha (q) signalling events.
    REACT_221970. Ca2+ pathway.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 (EC:3.1.4.11)
    Alternative name(s):
    PLC-154
    Phosphoinositide phospholipase C-beta-1
    Phospholipase C-beta-1
    Short name:
    PLC-beta-1
    Gene namesi
    Name:Plcb1
    Synonyms:Plcb
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 2

    Organism-specific databases

    MGIiMGI:97613. Plcb1.

    Subcellular locationi

    Nucleus membrane 1 Publication. Cytoplasm By similarity
    Note: Colocalizes with the adrenergic receptors, ADREN1A and ADREN1B, at the nuclear membrane of cardiac myocytes.By similarity

    GO - Cellular componenti

    1. cytoplasm Source: BHF-UCL
    2. nuclear chromatin Source: BHF-UCL
    3. nuclear membrane Source: UniProtKB-SubCell
    4. nuclear speck Source: BHF-UCL
    5. nucleus Source: BHF-UCL
    6. plasma membrane Source: Reactome

    Keywords - Cellular componenti

    Cytoplasm, Membrane, Nucleus

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 121612161-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1PRO_0000088487Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei887 – 8871Phosphoserine; by PKCBy similarity

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ9Z1B3.
    PaxDbiQ9Z1B3.
    PRIDEiQ9Z1B3.

    PTM databases

    PhosphoSiteiQ9Z1B3.

    Expressioni

    Gene expression databases

    ArrayExpressiQ9Z1B3.
    BgeeiQ9Z1B3.
    CleanExiMM_PLCB1.
    GenevestigatoriQ9Z1B3.

    Interactioni

    Subunit structurei

    Interacts with DGKQ.By similarity

    Protein-protein interaction databases

    BioGridi202232. 1 interaction.
    IntActiQ9Z1B3. 4 interactions.
    MINTiMINT-4107696.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9Z1B3.
    SMRiQ9Z1B3. Positions 11-830, 890-1170.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini316 – 467152PI-PLC X-boxPROSITE-ProRule annotationAdd
    BLAST
    Domaini540 – 656117PI-PLC Y-boxPROSITE-ProRule annotationAdd
    BLAST
    Domaini663 – 76199C2PROSITE-ProRule annotationAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi914 – 1088175Lys-richAdd
    BLAST

    Sequence similaritiesi

    Contains 1 C2 domain.PROSITE-ProRule annotation
    Contains 1 PI-PLC X-box domain.PROSITE-ProRule annotation
    Contains 1 PI-PLC Y-box domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiNOG149692.
    GeneTreeiENSGT00730000110266.
    HOVERGENiHBG053609.
    InParanoidiQ6PDH1.
    KOiK05858.
    OMAiMMDFINL.
    OrthoDBiEOG7WDN1N.
    TreeFamiTF313216.

    Family and domain databases

    Gene3Di1.10.238.10. 1 hit.
    2.60.40.150. 1 hit.
    3.20.20.190. 2 hits.
    InterProiIPR000008. C2_dom.
    IPR011992. EF-hand-dom_pair.
    IPR001192. PI-PLC_fam.
    IPR016280. PLC-beta.
    IPR028400. PLC-beta1.
    IPR014815. PLC-beta_C.
    IPR009535. PLC-beta_CS.
    IPR017946. PLC-like_Pdiesterase_TIM-brl.
    IPR015359. PLipase_C_EF-hand-like.
    IPR000909. PLipase_C_PInositol-sp_X_dom.
    IPR001711. PLipase_C_Pinositol-sp_Y.
    [Graphical view]
    PANTHERiPTHR10336. PTHR10336. 1 hit.
    PTHR10336:SF12. PTHR10336:SF12. 1 hit.
    PfamiPF00168. C2. 1 hit.
    PF06631. DUF1154. 1 hit.
    PF09279. EF-hand_like. 1 hit.
    PF00388. PI-PLC-X. 1 hit.
    PF00387. PI-PLC-Y. 1 hit.
    PF08703. PLC-beta_C. 1 hit.
    [Graphical view]
    PIRSFiPIRSF000956. PLC-beta. 1 hit.
    PRINTSiPR00390. PHPHLIPASEC.
    SMARTiSM00239. C2. 1 hit.
    SM00148. PLCXc. 1 hit.
    SM00149. PLCYc. 1 hit.
    [Graphical view]
    SUPFAMiSSF49562. SSF49562. 1 hit.
    SSF51695. SSF51695. 1 hit.
    PROSITEiPS50004. C2. 1 hit.
    PS50007. PIPLC_X_DOMAIN. 1 hit.
    PS50008. PIPLC_Y_DOMAIN. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform A (identifier: Q9Z1B3-1) [UniParc]FASTAAdd to Basket

    Also known as: C-beta-1a

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAGAQPGVHA LQLKPVCVSD SLKKGTKFVK WDDDSTIVTP IILRTDPQGF     50
    FFYWTDQNKE TELLDLSLVK DARCGKHAKA PKDPKLRELL DVGNIGHLEQ 100
    RMITVVYGPD LVNISHLNLV AFQEEVAKEW TNEVFSLATN LLAQNMSRDA 150
    FLEKAYTKLK LQVTPEGRIP LKNIYRLFSA DRKRVETALE ACSLPSSRND 200
    SIPQEDFTPD VYRVFLNNLC PRPEIDNIFS EFGAKSKPYL TVDQMMDFIN 250
    LKQRDPRLNE ILYPPLKQEQ VQVLIEKYEP NSSLAKKGQM SVDGFMRYLS 300
    GEENGVVSPE KLDLNEDMSQ PLSHYFINSS HNTYLTAGQL AGNSSVEMYR 350
    QVLLSGCRCV ELDCWKGRTA EEEPVITHGF TMTTEISFKE VIEAIAECAF 400
    KTSPFPILLS FENHVDSPKQ QAKMAEYCRL IFGDALLMEP LEKYPLESGV 450
    PLPSPMDLMY KILVKNKKKS HKSSEGSGKK KLSEQASNTY SDSSSVFEPS 500
    SPGAGEADTE SDDDDDDDDC KKSSMDEGTA GSEAMATEEM SNLVNYIQPV 550
    KFESFEISKK RNKSFEMSSF VETKGLEQLT KSPVEFVEYN KMQLSRIYPK 600
    GTRVDSSNYM PQLFWNAGCQ MVALNFQTVD LAMQINMGMY EYNGKSGYRL 650
    KPEFMRRPDK HFDPFTEGIV DGIVANTLSV KIISGQFLSD KKVGTYVEVD 700
    MFGLPVDTRR KAFKTKTSQG NAVNPVWEEE PIVFKKVVLP SLACLRIAAY 750
    EEGGKFIGHR ILPVQAIRPG YHYICLRNER NQPLTLPAVF VYIEVKDYVP 800
    DTYADVIEAL SNPIRYVNLM EQRAKQLAAL TLEDEEEVKK EADPGETSSE 850
    APSETRTTPA ENGVNHTASL APKPPSQAPH SQPAPGSVKA PAKTEDLIQS 900
    VLTEVEAQTI EELKQQKSFV KLQKKHYKEM KDLVKRHHKK TTELIKEHTT 950
    KYNEIQNDYL RRRAALEKSA KKDSKKKSEP SSPDHGSSAI EQDLAALDAE 1000
    MTQKLIDLKD KQQQQLLNLR QEQYYSEKYQ KREHIKLLIQ KLTDVAEECQ 1050
    NNQLKKLKEI CEKEKKELKK KMDKKRQEKI TEAKSKDKSQ MEEEKTEMIR 1100
    SYIQEVVQYI KRLEEAQSKR QEKLVEKHNE IRQQILDEKP KLQTELEQEY 1150
    QDKFKRLPLE ILEFVQEAMK GKISEDSNHG SAPPSLASDA AKVNLKSPSS 1200
    EEIERENPGR EFDTPL 1216
    Length:1,216
    Mass (Da):138,396
    Last modified:July 27, 2011 - v2
    Checksum:iCC751D49895A47D0
    GO
    Isoform B (identifier: Q9Z1B3-2) [UniParc]FASTAAdd to Basket

    Also known as: C-beta-1b

    The sequence of this isoform differs from the canonical sequence as follows:
         1142-1216: LQTELEQEYQ...NPGREFDTPL → GEGPSSVLSEGCHEDPSVPPNFTPPNPQALKW

    Show »
    Length:1,173
    Mass (Da):133,327
    Checksum:i5AA8EEB1FCED1D93
    GO
    Isoform C (identifier: Q9Z1B3-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1199-1216: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:1,198
    Mass (Da):136,309
    Checksum:iE95E5F34E58C48CA
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti28 – 281F → L in AAD00571. 1 PublicationCurated
    Sequence conflicti28 – 281F → L in AAD00572. 1 PublicationCurated
    Sequence conflicti28 – 281F → L in AAD00573. 1 PublicationCurated
    Sequence conflicti41 – 411I → T in AAD00571. 1 PublicationCurated
    Sequence conflicti41 – 411I → T in AAD00572. 1 PublicationCurated
    Sequence conflicti41 – 411I → T in AAD00573. 1 PublicationCurated
    Sequence conflicti67 – 671S → T in AAD01749. (PubMed:9753089)Curated
    Sequence conflicti79 – 791K → E in AAD00571. 1 PublicationCurated
    Sequence conflicti79 – 791K → E in AAD00572. 1 PublicationCurated
    Sequence conflicti79 – 791K → E in AAD00573. 1 PublicationCurated
    Sequence conflicti112 – 1121V → A in AAD00571. 1 PublicationCurated
    Sequence conflicti112 – 1121V → A in AAD00572. 1 PublicationCurated
    Sequence conflicti112 – 1121V → A in AAD00573. 1 PublicationCurated
    Sequence conflicti561 – 5611R → I in CAA64637. (PubMed:8687404)Curated
    Sequence conflicti613 – 6131L → I in CAA64637. (PubMed:8687404)Curated
    Sequence conflicti622 – 6221V → M in AAD00571. 1 PublicationCurated
    Sequence conflicti622 – 6221V → M in AAD00572. 1 PublicationCurated
    Sequence conflicti622 – 6221V → M in AAD00573. 1 PublicationCurated
    Sequence conflicti714 – 7141K → T in AAD00571. 1 PublicationCurated
    Sequence conflicti714 – 7141K → T in AAD00572. 1 PublicationCurated
    Sequence conflicti714 – 7141K → T in AAD00573. 1 PublicationCurated
    Sequence conflicti795 – 7951V → D in AAD00571. 1 PublicationCurated
    Sequence conflicti795 – 7951V → D in AAD00572. 1 PublicationCurated
    Sequence conflicti795 – 7951V → D in AAD00573. 1 PublicationCurated
    Sequence conflicti923 – 9231Q → H in AAD00571. 1 PublicationCurated
    Sequence conflicti923 – 9231Q → H in AAD00572. 1 PublicationCurated
    Sequence conflicti923 – 9231Q → H in AAD00573. 1 PublicationCurated
    Sequence conflicti957 – 9571N → I in AAD00571. 1 PublicationCurated
    Sequence conflicti957 – 9571N → I in AAD00572. 1 PublicationCurated
    Sequence conflicti957 – 9571N → I in AAD00573. 1 PublicationCurated
    Sequence conflicti1084 – 10841K → T in AAD00571. 1 PublicationCurated
    Sequence conflicti1084 – 10841K → T in AAD00572. 1 PublicationCurated
    Sequence conflicti1084 – 10841K → T in AAD00573. 1 PublicationCurated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1142 – 121675LQTEL…FDTPL → GEGPSSVLSEGCHEDPSVPP NFTPPNPQALKW in isoform B. 1 PublicationVSP_008917Add
    BLAST
    Alternative sequencei1199 – 121618Missing in isoform C. 1 PublicationVSP_008918Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U85712 mRNA. Translation: AAD00571.1.
    U85713 mRNA. Translation: AAD00572.1.
    U85714 mRNA. Translation: AAD00573.1.
    AF498249 mRNA. Translation: AAM22966.1.
    AF498250 mRNA. Translation: AAM22967.1.
    AL928635
    , AL840635, AL928956, AL935278 Genomic DNA. Translation: CAM23602.1.
    AL840635
    , AL928635, AL928956, AL935278 Genomic DNA. Translation: CAM23766.1.
    AL928956
    , AL840635, AL928635, AL935278 Genomic DNA. Translation: CAM26804.1.
    AL935278
    , AL840635, AL928635, AL928956 Genomic DNA. Translation: CAM27130.1.
    BC058710 mRNA. Translation: AAH58710.1.
    AF022801 mRNA. Translation: AAD01749.1.
    X95344 mRNA. Translation: CAA64637.1.
    CCDSiCCDS16787.1. [Q9Z1B3-2]
    CCDS50729.1. [Q9Z1B3-1]
    PIRiS68256.
    RefSeqiNP_001139302.1. NM_001145830.1. [Q9Z1B3-1]
    NP_062651.2. NM_019677.2. [Q9Z1B3-2]
    UniGeneiMm.330607.

    Genome annotation databases

    EnsembliENSMUST00000070724; ENSMUSP00000064844; ENSMUSG00000051177. [Q9Z1B3-2]
    ENSMUST00000110116; ENSMUSP00000105743; ENSMUSG00000051177. [Q9Z1B3-1]
    GeneIDi18795.
    KEGGimmu:18795.
    UCSCiuc008mny.2. mouse. [Q9Z1B3-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U85712 mRNA. Translation: AAD00571.1 .
    U85713 mRNA. Translation: AAD00572.1 .
    U85714 mRNA. Translation: AAD00573.1 .
    AF498249 mRNA. Translation: AAM22966.1 .
    AF498250 mRNA. Translation: AAM22967.1 .
    AL928635
    , AL840635 , AL928956 , AL935278 Genomic DNA. Translation: CAM23602.1 .
    AL840635
    , AL928635 , AL928956 , AL935278 Genomic DNA. Translation: CAM23766.1 .
    AL928956
    , AL840635 , AL928635 , AL935278 Genomic DNA. Translation: CAM26804.1 .
    AL935278
    , AL840635 , AL928635 , AL928956 Genomic DNA. Translation: CAM27130.1 .
    BC058710 mRNA. Translation: AAH58710.1 .
    AF022801 mRNA. Translation: AAD01749.1 .
    X95344 mRNA. Translation: CAA64637.1 .
    CCDSi CCDS16787.1. [Q9Z1B3-2 ]
    CCDS50729.1. [Q9Z1B3-1 ]
    PIRi S68256.
    RefSeqi NP_001139302.1. NM_001145830.1. [Q9Z1B3-1 ]
    NP_062651.2. NM_019677.2. [Q9Z1B3-2 ]
    UniGenei Mm.330607.

    3D structure databases

    ProteinModelPortali Q9Z1B3.
    SMRi Q9Z1B3. Positions 11-830, 890-1170.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 202232. 1 interaction.
    IntActi Q9Z1B3. 4 interactions.
    MINTi MINT-4107696.

    PTM databases

    PhosphoSitei Q9Z1B3.

    Proteomic databases

    MaxQBi Q9Z1B3.
    PaxDbi Q9Z1B3.
    PRIDEi Q9Z1B3.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000070724 ; ENSMUSP00000064844 ; ENSMUSG00000051177 . [Q9Z1B3-2 ]
    ENSMUST00000110116 ; ENSMUSP00000105743 ; ENSMUSG00000051177 . [Q9Z1B3-1 ]
    GeneIDi 18795.
    KEGGi mmu:18795.
    UCSCi uc008mny.2. mouse. [Q9Z1B3-1 ]

    Organism-specific databases

    CTDi 23236.
    MGIi MGI:97613. Plcb1.

    Phylogenomic databases

    eggNOGi NOG149692.
    GeneTreei ENSGT00730000110266.
    HOVERGENi HBG053609.
    InParanoidi Q6PDH1.
    KOi K05858.
    OMAi MMDFINL.
    OrthoDBi EOG7WDN1N.
    TreeFami TF313216.

    Enzyme and pathway databases

    BRENDAi 3.1.4.11. 3474.
    Reactomei REACT_196473. Synthesis of IP3 and IP4 in the cytosol.
    REACT_198612. Presynaptic function of Kainate receptors.
    REACT_207651. G alpha (q) signalling events.
    REACT_221970. Ca2+ pathway.

    Miscellaneous databases

    ChiTaRSi PLCB1. mouse.
    NextBioi 295080.
    PROi Q9Z1B3.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9Z1B3.
    Bgeei Q9Z1B3.
    CleanExi MM_PLCB1.
    Genevestigatori Q9Z1B3.

    Family and domain databases

    Gene3Di 1.10.238.10. 1 hit.
    2.60.40.150. 1 hit.
    3.20.20.190. 2 hits.
    InterProi IPR000008. C2_dom.
    IPR011992. EF-hand-dom_pair.
    IPR001192. PI-PLC_fam.
    IPR016280. PLC-beta.
    IPR028400. PLC-beta1.
    IPR014815. PLC-beta_C.
    IPR009535. PLC-beta_CS.
    IPR017946. PLC-like_Pdiesterase_TIM-brl.
    IPR015359. PLipase_C_EF-hand-like.
    IPR000909. PLipase_C_PInositol-sp_X_dom.
    IPR001711. PLipase_C_Pinositol-sp_Y.
    [Graphical view ]
    PANTHERi PTHR10336. PTHR10336. 1 hit.
    PTHR10336:SF12. PTHR10336:SF12. 1 hit.
    Pfami PF00168. C2. 1 hit.
    PF06631. DUF1154. 1 hit.
    PF09279. EF-hand_like. 1 hit.
    PF00388. PI-PLC-X. 1 hit.
    PF00387. PI-PLC-Y. 1 hit.
    PF08703. PLC-beta_C. 1 hit.
    [Graphical view ]
    PIRSFi PIRSF000956. PLC-beta. 1 hit.
    PRINTSi PR00390. PHPHLIPASEC.
    SMARTi SM00239. C2. 1 hit.
    SM00148. PLCXc. 1 hit.
    SM00149. PLCYc. 1 hit.
    [Graphical view ]
    SUPFAMi SSF49562. SSF49562. 1 hit.
    SSF51695. SSF51695. 1 hit.
    PROSITEi PS50004. C2. 1 hit.
    PS50007. PIPLC_X_DOMAIN. 1 hit.
    PS50008. PIPLC_Y_DOMAIN. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning of PI-specific phospholipase C's from 3T3 cells. Expression and membrane targeting of a novel phospholipase C-beta-1 isoform."
      Bai J., Wu K., Marks D.L., Machamer C., Pagano R.E.
      Submitted (JAN-1997) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A AND B).
      Strain: Swiss.
    2. "High-throughput sequence identification of gene coding variants within alcohol-related QTLs."
      Ehringer M.A., Thompson J., Conroy O., Xu Y., Yang F., Canniff J., Beeson M., Gordon L., Bennett B., Johnson T.E., Sikela J.M.
      Mamm. Genome 12:657-663(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM C).
      Strain: ILS and ISS.
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: C57BL/6J.
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM A).
      Strain: C57BL/6.
      Tissue: Brain.
    5. "Patterns of expression for the mRNA corresponding to the four isoforms of phospholipase Cbeta in mouse brain."
      Watanabe M., Nakamura M., Sato K., Kano M., Simon M.I., Inoue Y.
      Eur. J. Neurosci. 10:2016-2025(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 29-145.
      Strain: C57BL/6.
    6. "Phospholipase C in mouse oocytes: characterization of beta and gamma isoforms and their possible involvement in sperm-induced Ca2+ spiking."
      Dupont G., McGuinness O.M., Johnson M.H., Berridge M.J., Borgese F.
      Biochem. J. 316:583-591(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 428-615.
      Tissue: Oocyte.
    7. "Nuclear alpha1-adrenergic receptors signal activated ERK localization to caveolae in adult cardiac myocytes."
      Wright C.D., Chen Q., Baye N.L., Huang Y., Healy C.L., Kasinathan S., O'Connell T.D.
      Circ. Res. 103:992-1000(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBCELLULAR LOCATION.

    Entry informationi

    Entry nameiPLCB1_MOUSE
    AccessioniPrimary (citable) accession number: Q9Z1B3
    Secondary accession number(s): Q62075
    , Q6PDH1, Q8K5A5, Q8K5A6, Q9Z0E5, Q9Z2T5
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 14, 2003
    Last sequence update: July 27, 2011
    Last modified: October 1, 2014
    This is version 132 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Miscellaneous

    The receptor-mediated activation of PLC-beta-1 is mediated by two G-protein alpha subunits, alpha-Q and alpha-11.

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3