Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1

Gene

Plcb1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes.By similarity

Catalytic activityi

1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + H2O = 1D-myo-inositol 1,4,5-trisphosphate + diacylglycerol.

Cofactori

Ca2+By similarity

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei331 – 3311PROSITE-ProRule annotation
Active sitei378 – 3781PROSITE-ProRule annotation

GO - Molecular functioni

GO - Biological processi

  • activation of meiosis involved in egg activation Source: BHF-UCL
  • brain development Source: BHF-UCL
  • cell adhesion Source: BHF-UCL
  • cerebral cortex development Source: BHF-UCL
  • erythrocyte differentiation Source: BHF-UCL
  • fat cell differentiation Source: BHF-UCL
  • G2/M transition of mitotic cell cycle Source: BHF-UCL
  • glutamate receptor signaling pathway Source: BHF-UCL
  • G-protein coupled acetylcholine receptor signaling pathway Source: BHF-UCL
  • insulin-like growth factor receptor signaling pathway Source: BHF-UCL
  • insulin receptor signaling pathway Source: BHF-UCL
  • interleukin-12-mediated signaling pathway Source: BHF-UCL
  • interleukin-15-mediated signaling pathway Source: BHF-UCL
  • interleukin-1-mediated signaling pathway Source: MGI
  • intracellular signal transduction Source: InterPro
  • lipid catabolic process Source: UniProtKB-KW
  • macrophage differentiation Source: BHF-UCL
  • memory Source: BHF-UCL
  • metabolic process Source: GOC
  • mRNA processing Source: BHF-UCL
  • negative regulation of monocyte extravasation Source: BHF-UCL
  • negative regulation of transcription, DNA-templated Source: BHF-UCL
  • oocyte maturation Source: BHF-UCL
  • phosphatidylinositol metabolic process Source: BHF-UCL
  • positive regulation of acrosome reaction Source: BHF-UCL
  • positive regulation of CD24 biosynthetic process Source: BHF-UCL
  • positive regulation of developmental growth Source: BHF-UCL
  • positive regulation of embryonic development Source: BHF-UCL
  • positive regulation of G1/S transition of mitotic cell cycle Source: BHF-UCL
  • positive regulation of GTPase activity Source: MGI
  • positive regulation of interleukin-12 production Source: BHF-UCL
  • positive regulation of JNK cascade Source: BHF-UCL
  • positive regulation of myoblast differentiation Source: BHF-UCL
  • positive regulation of sodium:proton antiporter activity Source: BHF-UCL
  • positive regulation of transcription, DNA-templated Source: BHF-UCL
  • regulation of fertilization Source: BHF-UCL
  • regulation of G-protein coupled receptor protein signaling pathway Source: BHF-UCL
  • signal transduction Source: BHF-UCL
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Transducer

Keywords - Biological processi

Lipid degradation, Lipid metabolism

Keywords - Ligandi

Calcium

Enzyme and pathway databases

BRENDAi3.1.4.11. 3474.
ReactomeiREACT_306601. Acetylcholine regulates insulin secretion.
REACT_319215. PLC beta mediated events.
REACT_321652. Synthesis of IP3 and IP4 in the cytosol.
REACT_326624. Presynaptic function of Kainate receptors.
REACT_331940. Ca2+ pathway.
REACT_334088. Fatty Acids bound to GPR40 (FFAR1) regulate insulin secretion.
REACT_347934. G alpha (q) signalling events.
REACT_351801. G beta:gamma signalling through PLC beta.

Names & Taxonomyi

Protein namesi
Recommended name:
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 (EC:3.1.4.11)
Alternative name(s):
PLC-154
Phosphoinositide phospholipase C-beta-1
Phospholipase C-beta-1
Short name:
PLC-beta-1
Gene namesi
Name:Plcb1
Synonyms:Plcb
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589 Componenti: Chromosome 2

Organism-specific databases

MGIiMGI:97613. Plcb1.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: BHF-UCL
  • extracellular exosome Source: MGI
  • myelin sheath Source: UniProtKB
  • nuclear chromatin Source: BHF-UCL
  • nuclear membrane Source: UniProtKB-SubCell
  • nuclear speck Source: BHF-UCL
  • nucleus Source: BHF-UCL
  • plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Membrane, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 121612161-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1PRO_0000088487Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei887 – 8871Phosphoserine; by PKCBy similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ9Z1B3.
PaxDbiQ9Z1B3.
PRIDEiQ9Z1B3.

PTM databases

PhosphoSiteiQ9Z1B3.

Expressioni

Gene expression databases

BgeeiQ9Z1B3.
CleanExiMM_PLCB1.
ExpressionAtlasiQ9Z1B3. baseline and differential.
GenevisibleiQ9Z1B3. MM.

Interactioni

Subunit structurei

Interacts with DGKQ.By similarity

Protein-protein interaction databases

BioGridi202232. 1 interaction.
IntActiQ9Z1B3. 4 interactions.
MINTiMINT-4107696.
STRINGi10090.ENSMUSP00000105743.

Structurei

3D structure databases

ProteinModelPortaliQ9Z1B3.
SMRiQ9Z1B3. Positions 11-833, 890-1170.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini316 – 467152PI-PLC X-boxPROSITE-ProRule annotationAdd
BLAST
Domaini540 – 656117PI-PLC Y-boxPROSITE-ProRule annotationAdd
BLAST
Domaini663 – 76199C2PROSITE-ProRule annotationAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi914 – 1088175Lys-richAdd
BLAST

Sequence similaritiesi

Contains 1 C2 domain.PROSITE-ProRule annotation
Contains 1 PI-PLC X-box domain.PROSITE-ProRule annotation
Contains 1 PI-PLC Y-box domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiNOG149692.
GeneTreeiENSGT00760000118936.
HOVERGENiHBG053609.
InParanoidiQ9Z1B3.
KOiK05858.
OMAiMMDFINL.
OrthoDBiEOG7WDN1N.
TreeFamiTF313216.

Family and domain databases

Gene3Di1.10.238.10. 1 hit.
2.60.40.150. 1 hit.
3.20.20.190. 2 hits.
InterProiIPR000008. C2_dom.
IPR011992. EF-hand-dom_pair.
IPR001192. PI-PLC_fam.
IPR016280. PLC-beta.
IPR028400. PLC-beta1.
IPR014815. PLC-beta_C.
IPR009535. PLC-beta_CS.
IPR017946. PLC-like_Pdiesterase_TIM-brl.
IPR015359. PLipase_C_EF-hand-like.
IPR000909. PLipase_C_PInositol-sp_X_dom.
IPR001711. PLipase_C_Pinositol-sp_Y.
[Graphical view]
PANTHERiPTHR10336. PTHR10336. 1 hit.
PTHR10336:SF12. PTHR10336:SF12. 1 hit.
PfamiPF00168. C2. 1 hit.
PF06631. DUF1154. 1 hit.
PF09279. EF-hand_like. 1 hit.
PF00388. PI-PLC-X. 1 hit.
PF00387. PI-PLC-Y. 1 hit.
PF08703. PLC-beta_C. 1 hit.
[Graphical view]
PIRSFiPIRSF000956. PLC-beta. 1 hit.
PRINTSiPR00390. PHPHLIPASEC.
SMARTiSM00239. C2. 1 hit.
SM00148. PLCXc. 1 hit.
SM00149. PLCYc. 1 hit.
[Graphical view]
SUPFAMiSSF49562. SSF49562. 1 hit.
SSF51695. SSF51695. 1 hit.
PROSITEiPS50004. C2. 1 hit.
PS50007. PIPLC_X_DOMAIN. 1 hit.
PS50008. PIPLC_Y_DOMAIN. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform A (identifier: Q9Z1B3-1) [UniParc]FASTAAdd to basket

Also known as: C-beta-1a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAGAQPGVHA LQLKPVCVSD SLKKGTKFVK WDDDSTIVTP IILRTDPQGF
60 70 80 90 100
FFYWTDQNKE TELLDLSLVK DARCGKHAKA PKDPKLRELL DVGNIGHLEQ
110 120 130 140 150
RMITVVYGPD LVNISHLNLV AFQEEVAKEW TNEVFSLATN LLAQNMSRDA
160 170 180 190 200
FLEKAYTKLK LQVTPEGRIP LKNIYRLFSA DRKRVETALE ACSLPSSRND
210 220 230 240 250
SIPQEDFTPD VYRVFLNNLC PRPEIDNIFS EFGAKSKPYL TVDQMMDFIN
260 270 280 290 300
LKQRDPRLNE ILYPPLKQEQ VQVLIEKYEP NSSLAKKGQM SVDGFMRYLS
310 320 330 340 350
GEENGVVSPE KLDLNEDMSQ PLSHYFINSS HNTYLTAGQL AGNSSVEMYR
360 370 380 390 400
QVLLSGCRCV ELDCWKGRTA EEEPVITHGF TMTTEISFKE VIEAIAECAF
410 420 430 440 450
KTSPFPILLS FENHVDSPKQ QAKMAEYCRL IFGDALLMEP LEKYPLESGV
460 470 480 490 500
PLPSPMDLMY KILVKNKKKS HKSSEGSGKK KLSEQASNTY SDSSSVFEPS
510 520 530 540 550
SPGAGEADTE SDDDDDDDDC KKSSMDEGTA GSEAMATEEM SNLVNYIQPV
560 570 580 590 600
KFESFEISKK RNKSFEMSSF VETKGLEQLT KSPVEFVEYN KMQLSRIYPK
610 620 630 640 650
GTRVDSSNYM PQLFWNAGCQ MVALNFQTVD LAMQINMGMY EYNGKSGYRL
660 670 680 690 700
KPEFMRRPDK HFDPFTEGIV DGIVANTLSV KIISGQFLSD KKVGTYVEVD
710 720 730 740 750
MFGLPVDTRR KAFKTKTSQG NAVNPVWEEE PIVFKKVVLP SLACLRIAAY
760 770 780 790 800
EEGGKFIGHR ILPVQAIRPG YHYICLRNER NQPLTLPAVF VYIEVKDYVP
810 820 830 840 850
DTYADVIEAL SNPIRYVNLM EQRAKQLAAL TLEDEEEVKK EADPGETSSE
860 870 880 890 900
APSETRTTPA ENGVNHTASL APKPPSQAPH SQPAPGSVKA PAKTEDLIQS
910 920 930 940 950
VLTEVEAQTI EELKQQKSFV KLQKKHYKEM KDLVKRHHKK TTELIKEHTT
960 970 980 990 1000
KYNEIQNDYL RRRAALEKSA KKDSKKKSEP SSPDHGSSAI EQDLAALDAE
1010 1020 1030 1040 1050
MTQKLIDLKD KQQQQLLNLR QEQYYSEKYQ KREHIKLLIQ KLTDVAEECQ
1060 1070 1080 1090 1100
NNQLKKLKEI CEKEKKELKK KMDKKRQEKI TEAKSKDKSQ MEEEKTEMIR
1110 1120 1130 1140 1150
SYIQEVVQYI KRLEEAQSKR QEKLVEKHNE IRQQILDEKP KLQTELEQEY
1160 1170 1180 1190 1200
QDKFKRLPLE ILEFVQEAMK GKISEDSNHG SAPPSLASDA AKVNLKSPSS
1210
EEIERENPGR EFDTPL
Length:1,216
Mass (Da):138,396
Last modified:July 27, 2011 - v2
Checksum:iCC751D49895A47D0
GO
Isoform B (identifier: Q9Z1B3-2) [UniParc]FASTAAdd to basket

Also known as: C-beta-1b

The sequence of this isoform differs from the canonical sequence as follows:
     1142-1216: LQTELEQEYQ...NPGREFDTPL → GEGPSSVLSEGCHEDPSVPPNFTPPNPQALKW

Show »
Length:1,173
Mass (Da):133,327
Checksum:i5AA8EEB1FCED1D93
GO
Isoform C (identifier: Q9Z1B3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1199-1216: Missing.

Note: No experimental confirmation available.
Show »
Length:1,198
Mass (Da):136,309
Checksum:iE95E5F34E58C48CA
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti28 – 281F → L in AAD00571 (Ref. 1) Curated
Sequence conflicti28 – 281F → L in AAD00572 (Ref. 1) Curated
Sequence conflicti28 – 281F → L in AAD00573 (Ref. 1) Curated
Sequence conflicti41 – 411I → T in AAD00571 (Ref. 1) Curated
Sequence conflicti41 – 411I → T in AAD00572 (Ref. 1) Curated
Sequence conflicti41 – 411I → T in AAD00573 (Ref. 1) Curated
Sequence conflicti67 – 671S → T in AAD01749 (PubMed:9753089).Curated
Sequence conflicti79 – 791K → E in AAD00571 (Ref. 1) Curated
Sequence conflicti79 – 791K → E in AAD00572 (Ref. 1) Curated
Sequence conflicti79 – 791K → E in AAD00573 (Ref. 1) Curated
Sequence conflicti112 – 1121V → A in AAD00571 (Ref. 1) Curated
Sequence conflicti112 – 1121V → A in AAD00572 (Ref. 1) Curated
Sequence conflicti112 – 1121V → A in AAD00573 (Ref. 1) Curated
Sequence conflicti561 – 5611R → I in CAA64637 (PubMed:8687404).Curated
Sequence conflicti613 – 6131L → I in CAA64637 (PubMed:8687404).Curated
Sequence conflicti622 – 6221V → M in AAD00571 (Ref. 1) Curated
Sequence conflicti622 – 6221V → M in AAD00572 (Ref. 1) Curated
Sequence conflicti622 – 6221V → M in AAD00573 (Ref. 1) Curated
Sequence conflicti714 – 7141K → T in AAD00571 (Ref. 1) Curated
Sequence conflicti714 – 7141K → T in AAD00572 (Ref. 1) Curated
Sequence conflicti714 – 7141K → T in AAD00573 (Ref. 1) Curated
Sequence conflicti795 – 7951V → D in AAD00571 (Ref. 1) Curated
Sequence conflicti795 – 7951V → D in AAD00572 (Ref. 1) Curated
Sequence conflicti795 – 7951V → D in AAD00573 (Ref. 1) Curated
Sequence conflicti923 – 9231Q → H in AAD00571 (Ref. 1) Curated
Sequence conflicti923 – 9231Q → H in AAD00572 (Ref. 1) Curated
Sequence conflicti923 – 9231Q → H in AAD00573 (Ref. 1) Curated
Sequence conflicti957 – 9571N → I in AAD00571 (Ref. 1) Curated
Sequence conflicti957 – 9571N → I in AAD00572 (Ref. 1) Curated
Sequence conflicti957 – 9571N → I in AAD00573 (Ref. 1) Curated
Sequence conflicti1084 – 10841K → T in AAD00571 (Ref. 1) Curated
Sequence conflicti1084 – 10841K → T in AAD00572 (Ref. 1) Curated
Sequence conflicti1084 – 10841K → T in AAD00573 (Ref. 1) Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1142 – 121675LQTEL…FDTPL → GEGPSSVLSEGCHEDPSVPP NFTPPNPQALKW in isoform B. 1 PublicationVSP_008917Add
BLAST
Alternative sequencei1199 – 121618Missing in isoform C. 1 PublicationVSP_008918Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U85712 mRNA. Translation: AAD00571.1.
U85713 mRNA. Translation: AAD00572.1.
U85714 mRNA. Translation: AAD00573.1.
AF498249 mRNA. Translation: AAM22966.1.
AF498250 mRNA. Translation: AAM22967.1.
AL928635
, AL840635, AL928956, AL935278 Genomic DNA. Translation: CAM23602.1.
AL840635
, AL928635, AL928956, AL935278 Genomic DNA. Translation: CAM23766.1.
AL928956
, AL840635, AL928635, AL935278 Genomic DNA. Translation: CAM26804.1.
AL935278
, AL840635, AL928635, AL928956 Genomic DNA. Translation: CAM27130.1.
BC058710 mRNA. Translation: AAH58710.1.
AF022801 mRNA. Translation: AAD01749.1.
X95344 mRNA. Translation: CAA64637.1.
CCDSiCCDS16787.1. [Q9Z1B3-2]
CCDS50729.1. [Q9Z1B3-1]
PIRiS68256.
RefSeqiNP_001139302.1. NM_001145830.1. [Q9Z1B3-1]
NP_062651.2. NM_019677.2. [Q9Z1B3-2]
UniGeneiMm.330607.

Genome annotation databases

EnsembliENSMUST00000070724; ENSMUSP00000064844; ENSMUSG00000051177. [Q9Z1B3-2]
ENSMUST00000110116; ENSMUSP00000105743; ENSMUSG00000051177. [Q9Z1B3-1]
GeneIDi18795.
KEGGimmu:18795.
UCSCiuc008mny.2. mouse. [Q9Z1B3-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U85712 mRNA. Translation: AAD00571.1.
U85713 mRNA. Translation: AAD00572.1.
U85714 mRNA. Translation: AAD00573.1.
AF498249 mRNA. Translation: AAM22966.1.
AF498250 mRNA. Translation: AAM22967.1.
AL928635
, AL840635, AL928956, AL935278 Genomic DNA. Translation: CAM23602.1.
AL840635
, AL928635, AL928956, AL935278 Genomic DNA. Translation: CAM23766.1.
AL928956
, AL840635, AL928635, AL935278 Genomic DNA. Translation: CAM26804.1.
AL935278
, AL840635, AL928635, AL928956 Genomic DNA. Translation: CAM27130.1.
BC058710 mRNA. Translation: AAH58710.1.
AF022801 mRNA. Translation: AAD01749.1.
X95344 mRNA. Translation: CAA64637.1.
CCDSiCCDS16787.1. [Q9Z1B3-2]
CCDS50729.1. [Q9Z1B3-1]
PIRiS68256.
RefSeqiNP_001139302.1. NM_001145830.1. [Q9Z1B3-1]
NP_062651.2. NM_019677.2. [Q9Z1B3-2]
UniGeneiMm.330607.

3D structure databases

ProteinModelPortaliQ9Z1B3.
SMRiQ9Z1B3. Positions 11-833, 890-1170.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi202232. 1 interaction.
IntActiQ9Z1B3. 4 interactions.
MINTiMINT-4107696.
STRINGi10090.ENSMUSP00000105743.

PTM databases

PhosphoSiteiQ9Z1B3.

Proteomic databases

MaxQBiQ9Z1B3.
PaxDbiQ9Z1B3.
PRIDEiQ9Z1B3.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000070724; ENSMUSP00000064844; ENSMUSG00000051177. [Q9Z1B3-2]
ENSMUST00000110116; ENSMUSP00000105743; ENSMUSG00000051177. [Q9Z1B3-1]
GeneIDi18795.
KEGGimmu:18795.
UCSCiuc008mny.2. mouse. [Q9Z1B3-1]

Organism-specific databases

CTDi23236.
MGIiMGI:97613. Plcb1.

Phylogenomic databases

eggNOGiNOG149692.
GeneTreeiENSGT00760000118936.
HOVERGENiHBG053609.
InParanoidiQ9Z1B3.
KOiK05858.
OMAiMMDFINL.
OrthoDBiEOG7WDN1N.
TreeFamiTF313216.

Enzyme and pathway databases

BRENDAi3.1.4.11. 3474.
ReactomeiREACT_306601. Acetylcholine regulates insulin secretion.
REACT_319215. PLC beta mediated events.
REACT_321652. Synthesis of IP3 and IP4 in the cytosol.
REACT_326624. Presynaptic function of Kainate receptors.
REACT_331940. Ca2+ pathway.
REACT_334088. Fatty Acids bound to GPR40 (FFAR1) regulate insulin secretion.
REACT_347934. G alpha (q) signalling events.
REACT_351801. G beta:gamma signalling through PLC beta.

Miscellaneous databases

ChiTaRSiPlcb1. mouse.
NextBioi295080.
PROiQ9Z1B3.
SOURCEiSearch...

Gene expression databases

BgeeiQ9Z1B3.
CleanExiMM_PLCB1.
ExpressionAtlasiQ9Z1B3. baseline and differential.
GenevisibleiQ9Z1B3. MM.

Family and domain databases

Gene3Di1.10.238.10. 1 hit.
2.60.40.150. 1 hit.
3.20.20.190. 2 hits.
InterProiIPR000008. C2_dom.
IPR011992. EF-hand-dom_pair.
IPR001192. PI-PLC_fam.
IPR016280. PLC-beta.
IPR028400. PLC-beta1.
IPR014815. PLC-beta_C.
IPR009535. PLC-beta_CS.
IPR017946. PLC-like_Pdiesterase_TIM-brl.
IPR015359. PLipase_C_EF-hand-like.
IPR000909. PLipase_C_PInositol-sp_X_dom.
IPR001711. PLipase_C_Pinositol-sp_Y.
[Graphical view]
PANTHERiPTHR10336. PTHR10336. 1 hit.
PTHR10336:SF12. PTHR10336:SF12. 1 hit.
PfamiPF00168. C2. 1 hit.
PF06631. DUF1154. 1 hit.
PF09279. EF-hand_like. 1 hit.
PF00388. PI-PLC-X. 1 hit.
PF00387. PI-PLC-Y. 1 hit.
PF08703. PLC-beta_C. 1 hit.
[Graphical view]
PIRSFiPIRSF000956. PLC-beta. 1 hit.
PRINTSiPR00390. PHPHLIPASEC.
SMARTiSM00239. C2. 1 hit.
SM00148. PLCXc. 1 hit.
SM00149. PLCYc. 1 hit.
[Graphical view]
SUPFAMiSSF49562. SSF49562. 1 hit.
SSF51695. SSF51695. 1 hit.
PROSITEiPS50004. C2. 1 hit.
PS50007. PIPLC_X_DOMAIN. 1 hit.
PS50008. PIPLC_Y_DOMAIN. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning of PI-specific phospholipase C's from 3T3 cells. Expression and membrane targeting of a novel phospholipase C-beta-1 isoform."
    Bai J., Wu K., Marks D.L., Machamer C., Pagano R.E.
    Submitted (JAN-1997) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A AND B).
    Strain: Swiss.
  2. "High-throughput sequence identification of gene coding variants within alcohol-related QTLs."
    Ehringer M.A., Thompson J., Conroy O., Xu Y., Yang F., Canniff J., Beeson M., Gordon L., Bennett B., Johnson T.E., Sikela J.M.
    Mamm. Genome 12:657-663(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM C).
    Strain: ILS and ISS.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM A).
    Strain: C57BL/6.
    Tissue: Brain.
  5. "Patterns of expression for the mRNA corresponding to the four isoforms of phospholipase Cbeta in mouse brain."
    Watanabe M., Nakamura M., Sato K., Kano M., Simon M.I., Inoue Y.
    Eur. J. Neurosci. 10:2016-2025(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 29-145.
    Strain: C57BL/6.
  6. "Phospholipase C in mouse oocytes: characterization of beta and gamma isoforms and their possible involvement in sperm-induced Ca2+ spiking."
    Dupont G., McGuinness O.M., Johnson M.H., Berridge M.J., Borgese F.
    Biochem. J. 316:583-591(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 428-615.
    Tissue: Oocyte.
  7. "Nuclear alpha1-adrenergic receptors signal activated ERK localization to caveolae in adult cardiac myocytes."
    Wright C.D., Chen Q., Baye N.L., Huang Y., Healy C.L., Kasinathan S., O'Connell T.D.
    Circ. Res. 103:992-1000(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION.

Entry informationi

Entry nameiPLCB1_MOUSE
AccessioniPrimary (citable) accession number: Q9Z1B3
Secondary accession number(s): Q62075
, Q6PDH1, Q8K5A5, Q8K5A6, Q9Z0E5, Q9Z2T5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 14, 2003
Last sequence update: July 27, 2011
Last modified: June 24, 2015
This is version 141 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Miscellaneous

The receptor-mediated activation of PLC-beta-1 is mediated by two G-protein alpha subunits, alpha-Q and alpha-11.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.