Q9Z1B3 (PLCB1_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 116.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 EC=3.1.4.11 Alternative name(s): PLC-154 Phosphoinositide phospholipase C-beta-1 Phospholipase C-beta-1 Short name=PLC-beta-1 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 1216 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes By similarity. |
| Catalytic activity | 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + H2O = 1D-myo-inositol 1,4,5-trisphosphate + diacylglycerol. |
| Cofactor | Calcium By similarity. |
| Subunit structure | Interacts with DGKQ By similarity. |
| Subcellular location | Nucleus membrane. Cytoplasm By similarity. Note: Colocalizes with the adrenergic receptors, ADREN1A and ADREN1B, at the nuclear membrane of cardiac myocytes By similarity. Ref.9 |
| Miscellaneous | The receptor-mediated activation of PLC-beta-1 is mediated by two G-protein alpha subunits, alpha-Q and alpha-11. |
| Sequence similarities | Contains 1 C2 domain. Contains 1 PI-PLC X-box domain. Contains 1 PI-PLC Y-box domain. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform A (identifier: Q9Z1B3-1) Also known as: C-beta-1a; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform B (identifier: Q9Z1B3-2) Also known as: C-beta-1b; The sequence of this isoform differs from the canonical sequence as follows: 1142-1216: LQTELEQEYQ...NPGREFDTPL → GEGPSSVLSEGCHEDPSVPPNFTPPNPQALKW | ||||||
| Isoform C (identifier: Q9Z1B3-3) The sequence of this isoform differs from the canonical sequence as follows: 1199-1216: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1216 | 1216 | 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 | PRO_0000088487 | |||||
Regions | |||||||||
| Domain | 316 – 467 | 152 | PI-PLC X-box | ||||||
| Domain | 540 – 656 | 117 | PI-PLC Y-box | ||||||
| Domain | 663 – 761 | 99 | C2 | ||||||
| Compositional bias | 914 – 1088 | 175 | Lys-rich | ||||||
Sites | |||||||||
| Active site | 331 | 1 | By similarity | ||||||
| Active site | 378 | 1 | By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 333 | 1 | Phosphothreonine Ref.7 | ||||||
| Modified residue | 334 | 1 | Phosphotyrosine Ref.7 | ||||||
| Modified residue | 336 | 1 | Phosphothreonine Ref.7 | ||||||
| Modified residue | 887 | 1 | Phosphoserine; by PKC By similarity | ||||||
| Modified residue | 1197 | 1 | Phosphoserine Ref.8 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1142 – 1216 | 75 | LQTEL…FDTPL → GEGPSSVLSEGCHEDPSVPP NFTPPNPQALKW in isoform B. | VSP_008917 | |||||
| Alternative sequence | 1199 – 1216 | 18 | Missing in isoform C. | VSP_008918 | |||||
Experimental info | |||||||||
| Sequence conflict | 28 | 1 | F → L in AAD00571. Ref.1 | ||||||
| Sequence conflict | 28 | 1 | F → L in AAD00572. Ref.1 | ||||||
| Sequence conflict | 28 | 1 | F → L in AAD00573. Ref.1 | ||||||
| Sequence conflict | 41 | 1 | I → T in AAD00571. Ref.1 | ||||||
| Sequence conflict | 41 | 1 | I → T in AAD00572. Ref.1 | ||||||
| Sequence conflict | 41 | 1 | I → T in AAD00573. Ref.1 | ||||||
| Sequence conflict | 67 | 1 | S → T in AAD01749. Ref.5 | ||||||
| Sequence conflict | 79 | 1 | K → E in AAD00571. Ref.1 | ||||||
| Sequence conflict | 79 | 1 | K → E in AAD00572. Ref.1 | ||||||
| Sequence conflict | 79 | 1 | K → E in AAD00573. Ref.1 | ||||||
| Sequence conflict | 112 | 1 | V → A in AAD00571. Ref.1 | ||||||
| Sequence conflict | 112 | 1 | V → A in AAD00572. Ref.1 | ||||||
| Sequence conflict | 112 | 1 | V → A in AAD00573. Ref.1 | ||||||
| Sequence conflict | 561 | 1 | R → I in CAA64637. Ref.6 | ||||||
| Sequence conflict | 613 | 1 | L → I in CAA64637. Ref.6 | ||||||
| Sequence conflict | 622 | 1 | V → M in AAD00571. Ref.1 | ||||||
| Sequence conflict | 622 | 1 | V → M in AAD00572. Ref.1 | ||||||
| Sequence conflict | 622 | 1 | V → M in AAD00573. Ref.1 | ||||||
| Sequence conflict | 714 | 1 | K → T in AAD00571. Ref.1 | ||||||
| Sequence conflict | 714 | 1 | K → T in AAD00572. Ref.1 | ||||||
| Sequence conflict | 714 | 1 | K → T in AAD00573. Ref.1 | ||||||
| Sequence conflict | 795 | 1 | V → D in AAD00571. Ref.1 | ||||||
| Sequence conflict | 795 | 1 | V → D in AAD00572. Ref.1 | ||||||
| Sequence conflict | 795 | 1 | V → D in AAD00573. Ref.1 | ||||||
| Sequence conflict | 923 | 1 | Q → H in AAD00571. Ref.1 | ||||||
| Sequence conflict | 923 | 1 | Q → H in AAD00572. Ref.1 | ||||||
| Sequence conflict | 923 | 1 | Q → H in AAD00573. Ref.1 | ||||||
| Sequence conflict | 957 | 1 | N → I in AAD00571. Ref.1 | ||||||
| Sequence conflict | 957 | 1 | N → I in AAD00572. Ref.1 | ||||||
| Sequence conflict | 957 | 1 | N → I in AAD00573. Ref.1 | ||||||
| Sequence conflict | 1084 | 1 | K → T in AAD00571. Ref.1 | ||||||
| Sequence conflict | 1084 | 1 | K → T in AAD00572. Ref.1 | ||||||
| Sequence conflict | 1084 | 1 | K → T in AAD00573. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning of PI-specific phospholipase C's from 3T3 cells. Expression and membrane targeting of a novel phospholipase C-beta-1 isoform." Bai J., Wu K., Marks D.L., Machamer C., Pagano R.E. Submitted (JAN-1997) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A AND B). Strain: Swiss. |
| [2] | "High-throughput sequence identification of gene coding variants within alcohol-related QTLs." Ehringer M.A., Thompson J., Conroy O., Xu Y., Yang F., Canniff J., Beeson M., Gordon L., Bennett B., Johnson T.E., Sikela J.M. Mamm. Genome 12:657-663(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM C). Strain: ILS and ISS. |
| [3] | "Lineage-specific biology revealed by a finished genome assembly of the mouse." Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: C57BL/6J. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM A). Strain: C57BL/6. Tissue: Brain. |
| [5] | "Patterns of expression for the mRNA corresponding to the four isoforms of phospholipase Cbeta in mouse brain." Watanabe M., Nakamura M., Sato K., Kano M., Simon M.I., Inoue Y. Eur. J. Neurosci. 10:2016-2025(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 29-145. Strain: C57BL/6. |
| [6] | "Phospholipase C in mouse oocytes: characterization of beta and gamma isoforms and their possible involvement in sperm-induced Ca2+ spiking." Dupont G., McGuinness O.M., Johnson M.H., Berridge M.J., Borgese F. Biochem. J. 316:583-591(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 428-615. Tissue: Oocyte. |
| [7] | "Proteomic analysis of in vivo phosphorylated synaptic proteins." Collins M.O., Yu L., Coba M.P., Husi H., Campuzano I., Blackstock W.P., Choudhary J.S., Grant S.G. J. Biol. Chem. 280:5972-5982(2005) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-333; TYR-334 AND THR-336, MASS SPECTROMETRY. Tissue: Forebrain. |
| [8] | "Qualitative and quantitative analyses of protein phosphorylation in naive and stimulated mouse synaptosomal preparations." Munton R.P., Tweedie-Cullen R., Livingstone-Zatchej M., Weinandy F., Waidelich M., Longo D., Gehrig P., Potthast F., Rutishauser D., Gerrits B., Panse C., Schlapbach R., Mansuy I.M. Mol. Cell. Proteomics 6:283-293(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1197, MASS SPECTROMETRY. Tissue: Brain cortex. |
| [9] | "Nuclear alpha1-adrenergic receptors signal activated ERK localization to caveolae in adult cardiac myocytes." Wright C.D., Chen Q., Baye N.L., Huang Y., Healy C.L., Kasinathan S., O'Connell T.D. Circ. Res. 103:992-1000(2008) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U85712 mRNA. Translation: AAD00571.1. U85713 mRNA. Translation: AAD00572.1. U85714 mRNA. Translation: AAD00573.1. AF498249 mRNA. Translation: AAM22966.1. AF498250 mRNA. Translation: AAM22967.1. AL928635 AL935278 Genomic DNA. Translation: CAM23602.1.AL840635 AL935278 Genomic DNA. Translation: CAM23766.1.AL928956 AL935278 Genomic DNA. Translation: CAM26804.1.AL935278 AL928956 Genomic DNA. Translation: CAM27130.1.BC058710 mRNA. Translation: AAH58710.1. AF022801 mRNA. Translation: AAD01749.1. X95344 mRNA. Translation: CAA64637.1. |
| IPI | IPI00130045. IPI00323250. IPI00468121. |
| PIR | S68256. |
| RefSeq | NP_001139302.1. NM_001145830.1. NP_062651.2. NM_019677.2. |
| UniGene | Mm.330607. |
3D structure databases | |
| ProteinModelPortal | Q9Z1B3. |
| SMR | Q9Z1B3. Positions 12-833, 1001-1170. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9Z1B3. 3 interactions. |
PTM databases | |
| PhosphoSite | Q9Z1B3. |
Proteomic databases | |
| PaxDb | Q9Z1B3. |
| PRIDE | Q9Z1B3. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000070724; ENSMUSP00000064844; ENSMUSG00000051177. ENSMUST00000110116; ENSMUSP00000105743; ENSMUSG00000051177. |
| GeneID | 18795. |
| KEGG | mmu:18795. |
Organism-specific databases | |
| CTD | 23236. |
| MGI | MGI:97613. Plcb1. |
Phylogenomic databases | |
| eggNOG | NOG149692. |
| GeneTree | ENSGT00700000104415. |
| HOVERGEN | HBG053609. |
| InParanoid | Q6PDH1. |
| KO | K05858. |
| OMA | YRVFLNN. |
| OrthoDB | EOG40S0DW. |
Enzyme and pathway databases | |
| BRENDA | 3.1.4.11. 3474. |
| Reactome | REACT_112621. Metabolism. |
Gene expression databases | |
| ArrayExpress | Q9Z1B3. |
| Bgee | Q9Z1B3. |
| CleanEx | MM_PLCB1. |
| Genevestigator | Q9Z1B3. |
| GermOnline | ENSMUSG00000051177. Mus musculus. |
Family and domain databases | |
| Gene3D | 1.10.238.10. 1 hit. 3.20.20.190. 2 hits. |
| InterPro | IPR000008. C2_Ca-dep. IPR008973. C2_Ca/lipid-bd_dom_CaLB. IPR018029. C2_membr_targeting. IPR011992. EF-hand-like_dom. IPR001192. Pinositol_PLipase_C. IPR016280. PLC-beta. IPR014815. PLC-beta_C. IPR009535. PLC-beta_CS. IPR017946. PLC-like_Pdiesterase_TIM-brl. IPR015359. PLipase_C_EF-hand-like. IPR000909. PLipase_C_PInositol-sp_X_dom. IPR001711. PLipase_C_Pinositol-sp_Y. [Graphical view] |
| PANTHER | PTHR10336. PTHR10336. 1 hit. |
| Pfam | PF00168. C2. 1 hit. PF06631. DUF1154. 1 hit. PF09279. efhand_like. 1 hit. PF00388. PI-PLC-X. 1 hit. PF00387. PI-PLC-Y. 1 hit. PF08703. PLC-beta_C. 1 hit. [Graphical view] |
| PIRSF | PIRSF000956. PLC-beta. 1 hit. |
| PRINTS | PR00390. PHPHLIPASEC. |
| SMART | SM00239. C2. 1 hit. SM00148. PLCXc. 1 hit. SM00149. PLCYc. 1 hit. [Graphical view] |
| SUPFAM | SSF49562. C2_CaLB. 1 hit. SSF51695. PLC-like_Pdiesterase_TIM-brl. 1 hit. |
| PROSITE | PS50004. C2. 1 hit. PS50007. PIPLC_X_DOMAIN. 1 hit. PS50008. PIPLC_Y_DOMAIN. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | PLCB1. mouse. |
| NextBio | 295080. |
| SOURCE | Search... |
Entry information
| Entry name | PLCB1_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q9Z1B3 Secondary accession number(s): Q62075 Q9Z2T5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
