Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9Z1B3

- PLCB1_MOUSE

UniProt

Q9Z1B3 - PLCB1_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1

Gene

Plcb1

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli

Functioni

The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes.By similarity

Catalytic activityi

1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + H2O = 1D-myo-inositol 1,4,5-trisphosphate + diacylglycerol.

Cofactori

Calcium.By similarity

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei331 – 3311PROSITE-ProRule annotation
Active sitei378 – 3781PROSITE-ProRule annotation

GO - Molecular functioni

  1. calcium ion binding Source: InterPro
  2. calmodulin binding Source: BHF-UCL
  3. enzyme binding Source: BHF-UCL
  4. GTPase activator activity Source: Ensembl
  5. lamin binding Source: BHF-UCL
  6. phosphatidylinositol-4,5-bisphosphate binding Source: BHF-UCL
  7. phosphatidylinositol phospholipase C activity Source: BHF-UCL
  8. protein homodimerization activity Source: BHF-UCL
  9. signal transducer activity Source: UniProtKB-KW

GO - Biological processi

  1. activation of meiosis involved in egg activation Source: BHF-UCL
  2. brain development Source: BHF-UCL
  3. cell adhesion Source: BHF-UCL
  4. cerebral cortex development Source: BHF-UCL
  5. erythrocyte differentiation Source: BHF-UCL
  6. fat cell differentiation Source: BHF-UCL
  7. G2/M transition of mitotic cell cycle Source: BHF-UCL
  8. glutamate receptor signaling pathway Source: BHF-UCL
  9. G-protein coupled acetylcholine receptor signaling pathway Source: BHF-UCL
  10. insulin-like growth factor receptor signaling pathway Source: BHF-UCL
  11. insulin receptor signaling pathway Source: BHF-UCL
  12. interleukin-12-mediated signaling pathway Source: BHF-UCL
  13. interleukin-15-mediated signaling pathway Source: BHF-UCL
  14. interleukin-1-mediated signaling pathway Source: Ensembl
  15. intracellular signal transduction Source: InterPro
  16. lipid catabolic process Source: UniProtKB-KW
  17. macrophage differentiation Source: BHF-UCL
  18. memory Source: BHF-UCL
  19. mRNA processing Source: BHF-UCL
  20. negative regulation of monocyte extravasation Source: BHF-UCL
  21. negative regulation of transcription, DNA-templated Source: BHF-UCL
  22. oocyte maturation Source: BHF-UCL
  23. phosphatidylinositol metabolic process Source: BHF-UCL
  24. positive regulation of acrosome reaction Source: BHF-UCL
  25. positive regulation of CD24 biosynthetic process Source: BHF-UCL
  26. positive regulation of developmental growth Source: BHF-UCL
  27. positive regulation of embryonic development Source: BHF-UCL
  28. positive regulation of G1/S transition of mitotic cell cycle Source: BHF-UCL
  29. positive regulation of interleukin-12 production Source: BHF-UCL
  30. positive regulation of JNK cascade Source: BHF-UCL
  31. positive regulation of myoblast differentiation Source: BHF-UCL
  32. positive regulation of sodium:proton antiporter activity Source: BHF-UCL
  33. positive regulation of transcription, DNA-templated Source: BHF-UCL
  34. regulation of fertilization Source: BHF-UCL
  35. regulation of G-protein coupled receptor protein signaling pathway Source: BHF-UCL
  36. signal transduction Source: BHF-UCL
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Transducer

Keywords - Biological processi

Lipid degradation, Lipid metabolism

Keywords - Ligandi

Calcium

Enzyme and pathway databases

BRENDAi3.1.4.11. 3474.
ReactomeiREACT_196473. Synthesis of IP3 and IP4 in the cytosol.
REACT_198612. Presynaptic function of Kainate receptors.
REACT_207651. G alpha (q) signalling events.
REACT_221970. Ca2+ pathway.

Names & Taxonomyi

Protein namesi
Recommended name:
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 (EC:3.1.4.11)
Alternative name(s):
PLC-154
Phosphoinositide phospholipase C-beta-1
Phospholipase C-beta-1
Short name:
PLC-beta-1
Gene namesi
Name:Plcb1
Synonyms:Plcb
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 2

Organism-specific databases

MGIiMGI:97613. Plcb1.

Subcellular locationi

Nucleus membrane 1 Publication. Cytoplasm By similarity
Note: Colocalizes with the adrenergic receptors, ADREN1A and ADREN1B, at the nuclear membrane of cardiac myocytes.By similarity

GO - Cellular componenti

  1. cytoplasm Source: BHF-UCL
  2. extracellular vesicular exosome Source: Ensembl
  3. nuclear chromatin Source: BHF-UCL
  4. nuclear speck Source: BHF-UCL
  5. nucleus Source: BHF-UCL
  6. plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Membrane, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 121612161-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1PRO_0000088487Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei887 – 8871Phosphoserine; by PKCBy similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ9Z1B3.
PaxDbiQ9Z1B3.
PRIDEiQ9Z1B3.

PTM databases

PhosphoSiteiQ9Z1B3.

Expressioni

Gene expression databases

BgeeiQ9Z1B3.
CleanExiMM_PLCB1.
ExpressionAtlasiQ9Z1B3. baseline and differential.
GenevestigatoriQ9Z1B3.

Interactioni

Subunit structurei

Interacts with DGKQ.By similarity

Protein-protein interaction databases

BioGridi202232. 1 interaction.
IntActiQ9Z1B3. 4 interactions.
MINTiMINT-4107696.

Structurei

3D structure databases

ProteinModelPortaliQ9Z1B3.
SMRiQ9Z1B3. Positions 11-830, 890-1170.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini316 – 467152PI-PLC X-boxPROSITE-ProRule annotationAdd
BLAST
Domaini540 – 656117PI-PLC Y-boxPROSITE-ProRule annotationAdd
BLAST
Domaini663 – 76199C2PROSITE-ProRule annotationAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi914 – 1088175Lys-richAdd
BLAST

Sequence similaritiesi

Contains 1 C2 domain.PROSITE-ProRule annotation
Contains 1 PI-PLC X-box domain.PROSITE-ProRule annotation
Contains 1 PI-PLC Y-box domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiNOG149692.
GeneTreeiENSGT00760000118936.
HOVERGENiHBG053609.
InParanoidiQ9Z1B3.
KOiK05858.
OMAiMMDFINL.
OrthoDBiEOG7WDN1N.
TreeFamiTF313216.

Family and domain databases

Gene3Di1.10.238.10. 1 hit.
2.60.40.150. 1 hit.
3.20.20.190. 2 hits.
InterProiIPR000008. C2_dom.
IPR011992. EF-hand-dom_pair.
IPR001192. PI-PLC_fam.
IPR016280. PLC-beta.
IPR028400. PLC-beta1.
IPR014815. PLC-beta_C.
IPR009535. PLC-beta_CS.
IPR017946. PLC-like_Pdiesterase_TIM-brl.
IPR015359. PLipase_C_EF-hand-like.
IPR000909. PLipase_C_PInositol-sp_X_dom.
IPR001711. PLipase_C_Pinositol-sp_Y.
[Graphical view]
PANTHERiPTHR10336. PTHR10336. 1 hit.
PTHR10336:SF12. PTHR10336:SF12. 1 hit.
PfamiPF00168. C2. 1 hit.
PF06631. DUF1154. 1 hit.
PF09279. EF-hand_like. 1 hit.
PF00388. PI-PLC-X. 1 hit.
PF00387. PI-PLC-Y. 1 hit.
PF08703. PLC-beta_C. 1 hit.
[Graphical view]
PIRSFiPIRSF000956. PLC-beta. 1 hit.
PRINTSiPR00390. PHPHLIPASEC.
SMARTiSM00239. C2. 1 hit.
SM00148. PLCXc. 1 hit.
SM00149. PLCYc. 1 hit.
[Graphical view]
SUPFAMiSSF49562. SSF49562. 1 hit.
SSF51695. SSF51695. 1 hit.
PROSITEiPS50004. C2. 1 hit.
PS50007. PIPLC_X_DOMAIN. 1 hit.
PS50008. PIPLC_Y_DOMAIN. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform A (identifier: Q9Z1B3-1) [UniParc]FASTAAdd to Basket

Also known as: C-beta-1a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAGAQPGVHA LQLKPVCVSD SLKKGTKFVK WDDDSTIVTP IILRTDPQGF
60 70 80 90 100
FFYWTDQNKE TELLDLSLVK DARCGKHAKA PKDPKLRELL DVGNIGHLEQ
110 120 130 140 150
RMITVVYGPD LVNISHLNLV AFQEEVAKEW TNEVFSLATN LLAQNMSRDA
160 170 180 190 200
FLEKAYTKLK LQVTPEGRIP LKNIYRLFSA DRKRVETALE ACSLPSSRND
210 220 230 240 250
SIPQEDFTPD VYRVFLNNLC PRPEIDNIFS EFGAKSKPYL TVDQMMDFIN
260 270 280 290 300
LKQRDPRLNE ILYPPLKQEQ VQVLIEKYEP NSSLAKKGQM SVDGFMRYLS
310 320 330 340 350
GEENGVVSPE KLDLNEDMSQ PLSHYFINSS HNTYLTAGQL AGNSSVEMYR
360 370 380 390 400
QVLLSGCRCV ELDCWKGRTA EEEPVITHGF TMTTEISFKE VIEAIAECAF
410 420 430 440 450
KTSPFPILLS FENHVDSPKQ QAKMAEYCRL IFGDALLMEP LEKYPLESGV
460 470 480 490 500
PLPSPMDLMY KILVKNKKKS HKSSEGSGKK KLSEQASNTY SDSSSVFEPS
510 520 530 540 550
SPGAGEADTE SDDDDDDDDC KKSSMDEGTA GSEAMATEEM SNLVNYIQPV
560 570 580 590 600
KFESFEISKK RNKSFEMSSF VETKGLEQLT KSPVEFVEYN KMQLSRIYPK
610 620 630 640 650
GTRVDSSNYM PQLFWNAGCQ MVALNFQTVD LAMQINMGMY EYNGKSGYRL
660 670 680 690 700
KPEFMRRPDK HFDPFTEGIV DGIVANTLSV KIISGQFLSD KKVGTYVEVD
710 720 730 740 750
MFGLPVDTRR KAFKTKTSQG NAVNPVWEEE PIVFKKVVLP SLACLRIAAY
760 770 780 790 800
EEGGKFIGHR ILPVQAIRPG YHYICLRNER NQPLTLPAVF VYIEVKDYVP
810 820 830 840 850
DTYADVIEAL SNPIRYVNLM EQRAKQLAAL TLEDEEEVKK EADPGETSSE
860 870 880 890 900
APSETRTTPA ENGVNHTASL APKPPSQAPH SQPAPGSVKA PAKTEDLIQS
910 920 930 940 950
VLTEVEAQTI EELKQQKSFV KLQKKHYKEM KDLVKRHHKK TTELIKEHTT
960 970 980 990 1000
KYNEIQNDYL RRRAALEKSA KKDSKKKSEP SSPDHGSSAI EQDLAALDAE
1010 1020 1030 1040 1050
MTQKLIDLKD KQQQQLLNLR QEQYYSEKYQ KREHIKLLIQ KLTDVAEECQ
1060 1070 1080 1090 1100
NNQLKKLKEI CEKEKKELKK KMDKKRQEKI TEAKSKDKSQ MEEEKTEMIR
1110 1120 1130 1140 1150
SYIQEVVQYI KRLEEAQSKR QEKLVEKHNE IRQQILDEKP KLQTELEQEY
1160 1170 1180 1190 1200
QDKFKRLPLE ILEFVQEAMK GKISEDSNHG SAPPSLASDA AKVNLKSPSS
1210
EEIERENPGR EFDTPL
Length:1,216
Mass (Da):138,396
Last modified:July 27, 2011 - v2
Checksum:iCC751D49895A47D0
GO
Isoform B (identifier: Q9Z1B3-2) [UniParc]FASTAAdd to Basket

Also known as: C-beta-1b

The sequence of this isoform differs from the canonical sequence as follows:
     1142-1216: LQTELEQEYQ...NPGREFDTPL → GEGPSSVLSEGCHEDPSVPPNFTPPNPQALKW

Show »
Length:1,173
Mass (Da):133,327
Checksum:i5AA8EEB1FCED1D93
GO
Isoform C (identifier: Q9Z1B3-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1199-1216: Missing.

Note: No experimental confirmation available.

Show »
Length:1,198
Mass (Da):136,309
Checksum:iE95E5F34E58C48CA
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti28 – 281F → L in AAD00571. 1 PublicationCurated
Sequence conflicti28 – 281F → L in AAD00572. 1 PublicationCurated
Sequence conflicti28 – 281F → L in AAD00573. 1 PublicationCurated
Sequence conflicti41 – 411I → T in AAD00571. 1 PublicationCurated
Sequence conflicti41 – 411I → T in AAD00572. 1 PublicationCurated
Sequence conflicti41 – 411I → T in AAD00573. 1 PublicationCurated
Sequence conflicti67 – 671S → T in AAD01749. (PubMed:9753089)Curated
Sequence conflicti79 – 791K → E in AAD00571. 1 PublicationCurated
Sequence conflicti79 – 791K → E in AAD00572. 1 PublicationCurated
Sequence conflicti79 – 791K → E in AAD00573. 1 PublicationCurated
Sequence conflicti112 – 1121V → A in AAD00571. 1 PublicationCurated
Sequence conflicti112 – 1121V → A in AAD00572. 1 PublicationCurated
Sequence conflicti112 – 1121V → A in AAD00573. 1 PublicationCurated
Sequence conflicti561 – 5611R → I in CAA64637. (PubMed:8687404)Curated
Sequence conflicti613 – 6131L → I in CAA64637. (PubMed:8687404)Curated
Sequence conflicti622 – 6221V → M in AAD00571. 1 PublicationCurated
Sequence conflicti622 – 6221V → M in AAD00572. 1 PublicationCurated
Sequence conflicti622 – 6221V → M in AAD00573. 1 PublicationCurated
Sequence conflicti714 – 7141K → T in AAD00571. 1 PublicationCurated
Sequence conflicti714 – 7141K → T in AAD00572. 1 PublicationCurated
Sequence conflicti714 – 7141K → T in AAD00573. 1 PublicationCurated
Sequence conflicti795 – 7951V → D in AAD00571. 1 PublicationCurated
Sequence conflicti795 – 7951V → D in AAD00572. 1 PublicationCurated
Sequence conflicti795 – 7951V → D in AAD00573. 1 PublicationCurated
Sequence conflicti923 – 9231Q → H in AAD00571. 1 PublicationCurated
Sequence conflicti923 – 9231Q → H in AAD00572. 1 PublicationCurated
Sequence conflicti923 – 9231Q → H in AAD00573. 1 PublicationCurated
Sequence conflicti957 – 9571N → I in AAD00571. 1 PublicationCurated
Sequence conflicti957 – 9571N → I in AAD00572. 1 PublicationCurated
Sequence conflicti957 – 9571N → I in AAD00573. 1 PublicationCurated
Sequence conflicti1084 – 10841K → T in AAD00571. 1 PublicationCurated
Sequence conflicti1084 – 10841K → T in AAD00572. 1 PublicationCurated
Sequence conflicti1084 – 10841K → T in AAD00573. 1 PublicationCurated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1142 – 121675LQTEL…FDTPL → GEGPSSVLSEGCHEDPSVPP NFTPPNPQALKW in isoform B. 1 PublicationVSP_008917Add
BLAST
Alternative sequencei1199 – 121618Missing in isoform C. 1 PublicationVSP_008918Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U85712 mRNA. Translation: AAD00571.1.
U85713 mRNA. Translation: AAD00572.1.
U85714 mRNA. Translation: AAD00573.1.
AF498249 mRNA. Translation: AAM22966.1.
AF498250 mRNA. Translation: AAM22967.1.
AL928635
, AL840635, AL928956, AL935278 Genomic DNA. Translation: CAM23602.1.
AL840635
, AL928635, AL928956, AL935278 Genomic DNA. Translation: CAM23766.1.
AL928956
, AL840635, AL928635, AL935278 Genomic DNA. Translation: CAM26804.1.
AL935278
, AL840635, AL928635, AL928956 Genomic DNA. Translation: CAM27130.1.
BC058710 mRNA. Translation: AAH58710.1.
AF022801 mRNA. Translation: AAD01749.1.
X95344 mRNA. Translation: CAA64637.1.
CCDSiCCDS16787.1. [Q9Z1B3-2]
CCDS50729.1. [Q9Z1B3-1]
PIRiS68256.
RefSeqiNP_001139302.1. NM_001145830.1. [Q9Z1B3-1]
NP_062651.2. NM_019677.2. [Q9Z1B3-2]
UniGeneiMm.330607.

Genome annotation databases

EnsembliENSMUST00000070724; ENSMUSP00000064844; ENSMUSG00000051177. [Q9Z1B3-2]
ENSMUST00000110116; ENSMUSP00000105743; ENSMUSG00000051177. [Q9Z1B3-1]
GeneIDi18795.
KEGGimmu:18795.
UCSCiuc008mny.2. mouse. [Q9Z1B3-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U85712 mRNA. Translation: AAD00571.1 .
U85713 mRNA. Translation: AAD00572.1 .
U85714 mRNA. Translation: AAD00573.1 .
AF498249 mRNA. Translation: AAM22966.1 .
AF498250 mRNA. Translation: AAM22967.1 .
AL928635
, AL840635 , AL928956 , AL935278 Genomic DNA. Translation: CAM23602.1 .
AL840635
, AL928635 , AL928956 , AL935278 Genomic DNA. Translation: CAM23766.1 .
AL928956
, AL840635 , AL928635 , AL935278 Genomic DNA. Translation: CAM26804.1 .
AL935278
, AL840635 , AL928635 , AL928956 Genomic DNA. Translation: CAM27130.1 .
BC058710 mRNA. Translation: AAH58710.1 .
AF022801 mRNA. Translation: AAD01749.1 .
X95344 mRNA. Translation: CAA64637.1 .
CCDSi CCDS16787.1. [Q9Z1B3-2 ]
CCDS50729.1. [Q9Z1B3-1 ]
PIRi S68256.
RefSeqi NP_001139302.1. NM_001145830.1. [Q9Z1B3-1 ]
NP_062651.2. NM_019677.2. [Q9Z1B3-2 ]
UniGenei Mm.330607.

3D structure databases

ProteinModelPortali Q9Z1B3.
SMRi Q9Z1B3. Positions 11-830, 890-1170.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 202232. 1 interaction.
IntActi Q9Z1B3. 4 interactions.
MINTi MINT-4107696.

PTM databases

PhosphoSitei Q9Z1B3.

Proteomic databases

MaxQBi Q9Z1B3.
PaxDbi Q9Z1B3.
PRIDEi Q9Z1B3.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000070724 ; ENSMUSP00000064844 ; ENSMUSG00000051177 . [Q9Z1B3-2 ]
ENSMUST00000110116 ; ENSMUSP00000105743 ; ENSMUSG00000051177 . [Q9Z1B3-1 ]
GeneIDi 18795.
KEGGi mmu:18795.
UCSCi uc008mny.2. mouse. [Q9Z1B3-1 ]

Organism-specific databases

CTDi 23236.
MGIi MGI:97613. Plcb1.

Phylogenomic databases

eggNOGi NOG149692.
GeneTreei ENSGT00760000118936.
HOVERGENi HBG053609.
InParanoidi Q9Z1B3.
KOi K05858.
OMAi MMDFINL.
OrthoDBi EOG7WDN1N.
TreeFami TF313216.

Enzyme and pathway databases

BRENDAi 3.1.4.11. 3474.
Reactomei REACT_196473. Synthesis of IP3 and IP4 in the cytosol.
REACT_198612. Presynaptic function of Kainate receptors.
REACT_207651. G alpha (q) signalling events.
REACT_221970. Ca2+ pathway.

Miscellaneous databases

ChiTaRSi PLCB1. mouse.
NextBioi 295080.
PROi Q9Z1B3.
SOURCEi Search...

Gene expression databases

Bgeei Q9Z1B3.
CleanExi MM_PLCB1.
ExpressionAtlasi Q9Z1B3. baseline and differential.
Genevestigatori Q9Z1B3.

Family and domain databases

Gene3Di 1.10.238.10. 1 hit.
2.60.40.150. 1 hit.
3.20.20.190. 2 hits.
InterProi IPR000008. C2_dom.
IPR011992. EF-hand-dom_pair.
IPR001192. PI-PLC_fam.
IPR016280. PLC-beta.
IPR028400. PLC-beta1.
IPR014815. PLC-beta_C.
IPR009535. PLC-beta_CS.
IPR017946. PLC-like_Pdiesterase_TIM-brl.
IPR015359. PLipase_C_EF-hand-like.
IPR000909. PLipase_C_PInositol-sp_X_dom.
IPR001711. PLipase_C_Pinositol-sp_Y.
[Graphical view ]
PANTHERi PTHR10336. PTHR10336. 1 hit.
PTHR10336:SF12. PTHR10336:SF12. 1 hit.
Pfami PF00168. C2. 1 hit.
PF06631. DUF1154. 1 hit.
PF09279. EF-hand_like. 1 hit.
PF00388. PI-PLC-X. 1 hit.
PF00387. PI-PLC-Y. 1 hit.
PF08703. PLC-beta_C. 1 hit.
[Graphical view ]
PIRSFi PIRSF000956. PLC-beta. 1 hit.
PRINTSi PR00390. PHPHLIPASEC.
SMARTi SM00239. C2. 1 hit.
SM00148. PLCXc. 1 hit.
SM00149. PLCYc. 1 hit.
[Graphical view ]
SUPFAMi SSF49562. SSF49562. 1 hit.
SSF51695. SSF51695. 1 hit.
PROSITEi PS50004. C2. 1 hit.
PS50007. PIPLC_X_DOMAIN. 1 hit.
PS50008. PIPLC_Y_DOMAIN. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning of PI-specific phospholipase C's from 3T3 cells. Expression and membrane targeting of a novel phospholipase C-beta-1 isoform."
    Bai J., Wu K., Marks D.L., Machamer C., Pagano R.E.
    Submitted (JAN-1997) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A AND B).
    Strain: Swiss.
  2. "High-throughput sequence identification of gene coding variants within alcohol-related QTLs."
    Ehringer M.A., Thompson J., Conroy O., Xu Y., Yang F., Canniff J., Beeson M., Gordon L., Bennett B., Johnson T.E., Sikela J.M.
    Mamm. Genome 12:657-663(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM C).
    Strain: ILS and ISS.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM A).
    Strain: C57BL/6.
    Tissue: Brain.
  5. "Patterns of expression for the mRNA corresponding to the four isoforms of phospholipase Cbeta in mouse brain."
    Watanabe M., Nakamura M., Sato K., Kano M., Simon M.I., Inoue Y.
    Eur. J. Neurosci. 10:2016-2025(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 29-145.
    Strain: C57BL/6.
  6. "Phospholipase C in mouse oocytes: characterization of beta and gamma isoforms and their possible involvement in sperm-induced Ca2+ spiking."
    Dupont G., McGuinness O.M., Johnson M.H., Berridge M.J., Borgese F.
    Biochem. J. 316:583-591(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 428-615.
    Tissue: Oocyte.
  7. "Nuclear alpha1-adrenergic receptors signal activated ERK localization to caveolae in adult cardiac myocytes."
    Wright C.D., Chen Q., Baye N.L., Huang Y., Healy C.L., Kasinathan S., O'Connell T.D.
    Circ. Res. 103:992-1000(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION.

Entry informationi

Entry nameiPLCB1_MOUSE
AccessioniPrimary (citable) accession number: Q9Z1B3
Secondary accession number(s): Q62075
, Q6PDH1, Q8K5A5, Q8K5A6, Q9Z0E5, Q9Z2T5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 14, 2003
Last sequence update: July 27, 2011
Last modified: October 29, 2014
This is version 133 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Miscellaneous

The receptor-mediated activation of PLC-beta-1 is mediated by two G-protein alpha subunits, alpha-Q and alpha-11.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3