Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9Z173

- LPHN3_RAT

UniProt

Q9Z173 - LPHN3_RAT

Protein

Latrophilin-3

Gene

Lphn3

Organism
Rattus norvegicus (Rat)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 89 (01 Oct 2014)
      Sequence version 1 (01 May 1999)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May be involved in the development of glutamatergic synapses in the cortex. Important in determining the connectivity rates between the principal neurons in the cortex By similarity.By similarity

    GO - Molecular functioni

    1. carbohydrate binding Source: InterPro
    2. G-protein coupled receptor activity Source: RGD

    GO - Biological processi

    1. brain development Source: RGD
    2. neuropeptide signaling pathway Source: InterPro

    Keywords - Molecular functioni

    G-protein coupled receptor, Receptor, Transducer

    Keywords - Ligandi

    Lectin

    Protein family/group databases

    MEROPSiS63.014.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Latrophilin-3
    Alternative name(s):
    Calcium-independent alpha-latrotoxin receptor
    Short name:
    CIRL-3
    Gene namesi
    Name:Lphn3
    Synonyms:Cirl3, Cl3
    OrganismiRattus norvegicus (Rat)
    Taxonomic identifieri10116 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
    ProteomesiUP000002494: Unplaced

    Organism-specific databases

    RGDi620836. Lphn3.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW
    2. plasma membrane Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cell membrane, Membrane

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 1919Sequence AnalysisAdd
    BLAST
    Chaini20 – 15501531Latrophilin-3PRO_0000270141Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi161 – 1611N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi203 ↔ 385PROSITE-ProRule annotation
    Glycosylationi532 – 5321N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi616 – 6161N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi839 – 8391N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi884 – 8841N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi910 – 9101N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi999 – 9991N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi1165 – 11651N-linked (GlcNAc...)Sequence Analysis

    Post-translational modificationi

    Proteolytically cleaved into 2 subunits, an extracellular subunit and a seven-transmembrane subunit.By similarity
    O-glycosylated (major) and N-glycosylated.By similarity

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    PaxDbiQ9Z173.
    PRIDEiQ9Z173.

    PTM databases

    PhosphoSiteiQ9Z173.

    Expressioni

    Tissue specificityi

    Predominantly expressed in brain, followed by heart, placenta, pancreas, kidney and testis.1 Publication

    Gene expression databases

    GenevestigatoriQ9Z173.

    Interactioni

    Subunit structurei

    Interacts with FLRT3 and TEN1.By similarity

    Structurei

    3D structure databases

    ProteinModelPortaliQ9Z173.
    SMRiQ9Z173. Positions 93-197.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini20 – 948929ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini970 – 9778CytoplasmicSequence Analysis
    Topological domaini999 – 10068ExtracellularSequence Analysis
    Topological domaini1028 – 104821CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini1070 – 108718ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini1109 – 114133CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini1163 – 11686ExtracellularSequence Analysis
    Topological domaini1190 – 1550361CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei949 – 96921Helical; Name=1Sequence AnalysisAdd
    BLAST
    Transmembranei978 – 99821Helical; Name=2Sequence AnalysisAdd
    BLAST
    Transmembranei1007 – 102721Helical; Name=3Sequence AnalysisAdd
    BLAST
    Transmembranei1049 – 106921Helical; Name=4Sequence AnalysisAdd
    BLAST
    Transmembranei1088 – 110821Helical; Name=5Sequence AnalysisAdd
    BLAST
    Transmembranei1142 – 116221Helical; Name=6Sequence AnalysisAdd
    BLAST
    Transmembranei1169 – 118921Helical; Name=7Sequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini103 – 19290SUEL-type lectinPROSITE-ProRule annotationAdd
    BLAST
    Domaini202 – 461260Olfactomedin-likePROSITE-ProRule annotationAdd
    BLAST
    Domaini882 – 93352GPSPROSITE-ProRule annotationAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi1483 – 14864Poly-Ala

    Domaini

    The Olfactomedin-like domain is required for the synapse-promoting function and the interaction with FLRT3. The Olfactomedin-like and the SUEL-type lectin domains are required for the interaction with TEN1 By similarity.By similarity

    Sequence similaritiesi

    Contains 1 GPS domain.PROSITE-ProRule annotation
    Contains 1 olfactomedin-like domain.PROSITE-ProRule annotation
    Contains 1 SUEL-type lectin domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG253931.
    HOVERGENiHBG052337.
    InParanoidiQ9Z173.
    KOiK04594.
    PhylomeDBiQ9Z173.

    Family and domain databases

    InterProiIPR022624. DUF3497.
    IPR017981. GPCR_2-like.
    IPR001879. GPCR_2_extracellular_dom.
    IPR003924. GPCR_2_latrophilin.
    IPR015630. GPCR_2_latrophilin3.
    IPR003334. GPCR_2_latrophilin_rcpt_C.
    IPR000832. GPCR_2_secretin-like.
    IPR017983. GPCR_2_secretin-like_CS.
    IPR000203. GPS.
    IPR000922. Lectin_gal-bd_dom.
    IPR003112. Olfac-like.
    [Graphical view]
    PANTHERiPTHR12011:SF60. PTHR12011:SF60. 1 hit.
    PfamiPF00002. 7tm_2. 1 hit.
    PF12003. DUF3497. 1 hit.
    PF02140. Gal_Lectin. 1 hit.
    PF01825. GPS. 1 hit.
    PF02793. HRM. 1 hit.
    PF02354. Latrophilin. 2 hits.
    PF02191. OLF. 1 hit.
    [Graphical view]
    PRINTSiPR00249. GPCRSECRETIN.
    PR01444. LATROPHILIN.
    SMARTiSM00303. GPS. 1 hit.
    SM00284. OLF. 1 hit.
    [Graphical view]
    PROSITEiPS00650. G_PROTEIN_RECEP_F2_2. 1 hit.
    PS50227. G_PROTEIN_RECEP_F2_3. 1 hit.
    PS50261. G_PROTEIN_RECEP_F2_4. 1 hit.
    PS50221. GPS. 1 hit.
    PS51132. OLF. 1 hit.
    PS50228. SUEL_LECTIN. 1 hit.
    [Graphical view]

    Sequences (7)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 7 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9Z173-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MCPPQLFILM MLLAPVVHGG KHNERHPALA APLRHAEHSP GGPLPPRHLL     50
    QQPAAERSTA HRGQGPRGTA RGVRGPGAPG AQIAAQAFSR APIPMAVVRR 100
    ELSCESYPIE LRCPGTDVIM IESANYGRTD DKICDSDPAQ MENIRCYLPD 150
    AYKIMSQRCN NRTQCAVVAG PDVFPDPCPG TYKYLEVQYE CVPYKVEQKV 200
    FLCPGLLKGV YQSEHLFESD HQSGAWCKDP LQASDKIYYM PWTPYRTDTL 250
    TEYSSKDDFI AGRPTTTYKL PHRVDGTGFV VYDGALFFNK ERTRNIVKFD 300
    LRTRIKSGEA IIANANYHDT SPYRWGGKSD IDLAVDENGL WVIYATEQNN 350
    GKIVISQLNP YTLRIEGTWD TAYDKRSASN AFMICGILYV VKSVYEDDDN 400
    EATGNKIDYI YNTDQSKDSL VDVPFPNSYQ YIAAVDYNPR DNLLYVWNNY 450
    HVVKYSLDFG PLDSRSGPVH HGQVSYISPP IHLDSDLERP PVRGISTTGP 500
    LGMGSTTTST TLRTTTWNLG RSTTPSLPGR RNRSTSTPSP AIEVLDVTTH 550
    LPSAASQIPA MEESCEAVEA REIMWFKTRQ GQVAKQSCPA GTIGVSTYLC 600
    LAPDGIWDPQ GPDLSNCSSP WVNHITQKLK SGETAANIAR ELAEQTRNHL 650
    NAGDITYSVR AMDQLVGLLD VQLRNLTPGG KDSAARSLNK LQKRERSCRA 700
    YVQAMVETVN NLLQPQALNA WRDLTTSDQL RAATMLLDTV EESAFVLADN 750
    LLKTDIVREN TDNIQLEVAR LSTEGNLEDL KFPENTGHGS TIQLSANTLK 800
    QNGRNGEIRV AFVLYNNLGP YLSTENASMK LGTEAMSTNH SVIVNSPVIT 850
    AAINKEFSNK VYLADPVVFT VKHIKQSEEN FNPNCSFWSY SKRTMTGYWS 900
    TQGCRLLTTN KTHTTCSCNH LTNFAVLMAH VEVKHSDAVH DLLLDVITWV 950
    GILLSLVCLL ICIFTFCFFR GLQSDRNTIH KNLCISLFVA ELLFLIGINR 1000
    TDQPIACAVF AALLHFFFLA AFTWMFLEGV QLYIMLVEVF ESEHSRRKYF 1050
    YLVGYGMPAL IVAVSAAVDY RSYGTDKVCW LRLDTYFIWS FIGPATLIIM 1100
    LNVIFLGIAL YKMFHHTAIL KPESGCLDNI NYEDNRPFIK SWVIGAIALL 1150
    CLLGLTWAFG LMYINESTVI MAYLFTIFNS LQGMFIFIFH CVLQKKVRKE 1200
    YGKCLRTHCC SGKSTESSIG SGKTSGSRTP GRYSTGSQSR IRRMWNDTVR 1250
    KQSESSFITG DINSSASLNR GSYLPCIQAC VTYLEGLLNN ARDTSVMDTL 1300
    PLNGNHGNSY SIAGGEYLSN CVQIIDRGYN HNETALEKKI LKELTSNYIP 1350
    SYLNNHERSS EQNRNMMNKL VDNLGSGSED DAIVLDDAAS FNHEESLGLE 1400
    LIHEESDAPL LPPRVYSTDN HQPHHYSRRR LPQDHSESFF PLLTDEHTED 1450
    PQSPHRDSLY TSMPALAGVP AADSVTTSTQ TEAAAAKGGD AEDVYYKSMP 1500
    NLGSRNHVHP LHAYYQLGRG SSDGFIVPPN KDGASPEGTS KGPAHLVTSL 1550
    Length:1,550
    Mass (Da):172,442
    Last modified:May 1, 1999 - v1
    Checksum:iA2E8091B2B34DB36
    GO
    Isoform 2 (identifier: Q9Z173-2) [UniParc]FASTAAdd to Basket

    Also known as: CL3AA

    The sequence of this isoform differs from the canonical sequence as follows:
         19-86: Missing.
         1131-1139: Missing.
         1271-1284: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:1,459
    Mass (Da):162,831
    Checksum:iF083B7E81180E1A8
    GO
    Isoform 3 (identifier: Q9Z173-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1131-1139: Missing.
         1271-1284: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:1,527
    Mass (Da):169,780
    Checksum:iA0F1FFC2D9B50B9F
    GO
    Isoform 4 (identifier: Q9Z173-4) [UniParc]FASTAAdd to Basket

    Also known as: CL3BB

    The sequence of this isoform differs from the canonical sequence as follows:
         1131-1139: Missing.
         1271-1307: GSYLPCIQACVTYLEGLLNNARDTSVMDTLPLNGNHG → EPYRETSMGVKLNIAYQIGASEQCQGYKCHGYSTTEW
         1308-1550: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:1,298
    Mass (Da):144,892
    Checksum:i26C05A298C6B1A02
    GO
    Isoform 5 (identifier: Q9Z173-5) [UniParc]FASTAAdd to Basket

    Also known as: CL3AB

    The sequence of this isoform differs from the canonical sequence as follows:
         19-86: Missing.
         1131-1139: Missing.
         1271-1307: GSYLPCIQACVTYLEGLLNNARDTSVMDTLPLNGNHG → EPYRETSMGVKLNIAYQIGASEQCQGYKCHGYSTTEW
         1308-1550: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:1,230
    Mass (Da):137,943
    Checksum:i691DDCD1FE095C12
    GO
    Isoform 6 (identifier: Q9Z173-6) [UniParc]FASTAAdd to Basket

    Also known as: CL3BC

    The sequence of this isoform differs from the canonical sequence as follows:
         1131-1139: Missing.
         1272-1350: SYLPCIQACV...LKELTSNYIP → TMANHLMSNA...KCHGYSTTEW
         1351-1550: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:1,341
    Mass (Da):149,502
    Checksum:iF73C8CEB1B657008
    GO
    Isoform 7 (identifier: Q9Z173-7) [UniParc]FASTAAdd to Basket

    Also known as: CL3AC

    The sequence of this isoform differs from the canonical sequence as follows:
         19-86: Missing.
         1131-1139: Missing.
         1272-1350: SYLPCIQACV...LKELTSNYIP → TMANHLMSNA...KCHGYSTTEW
         1351-1550: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:1,273
    Mass (Da):142,554
    Checksum:iAE10D88D147CF078
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei19 – 8668Missing in isoform 2, isoform 5 and isoform 7. 1 PublicationVSP_022127Add
    BLAST
    Alternative sequencei1131 – 11399Missing in isoform 2, isoform 3, isoform 4, isoform 5, isoform 6 and isoform 7. 1 PublicationVSP_022128
    Alternative sequencei1271 – 130737GSYLP…NGNHG → EPYRETSMGVKLNIAYQIGA SEQCQGYKCHGYSTTEW in isoform 4 and isoform 5. 1 PublicationVSP_022129Add
    BLAST
    Alternative sequencei1271 – 128414Missing in isoform 2 and isoform 3. 1 PublicationVSP_022130Add
    BLAST
    Alternative sequencei1272 – 135079SYLPC…SNYIP → TMANHLMSNALLRPHGTNNP YNTLLGEPAVCNNPSISMYN AQEPYRETSMGVKLNIAYQI GASEQCQGYKCHGYSTTEW in isoform 6 and isoform 7. 1 PublicationVSP_022131Add
    BLAST
    Alternative sequencei1308 – 1550243Missing in isoform 4 and isoform 5. 1 PublicationVSP_022132Add
    BLAST
    Alternative sequencei1351 – 1550200Missing in isoform 6 and isoform 7. 1 PublicationVSP_022133Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF081154 mRNA. Translation: AAC62660.1.
    AF081155 mRNA. Translation: AAC62661.1.
    AF081156 mRNA. Translation: AAC62662.1.
    AF081157 mRNA. Translation: AAC62663.1.
    AF081158 mRNA. Translation: AAC62664.1.
    AF081159 mRNA. Translation: AAC62665.1.
    AF063103 mRNA. Translation: AAC77816.1.
    PIRiT14327.
    T17186.
    T17187.
    T17188.
    T17198.
    T17199.
    T17200.
    RefSeqiNP_570835.1. NM_130822.1. [Q9Z173-1]
    UniGeneiRn.203386.

    Genome annotation databases

    GeneIDi170641.
    KEGGirno:170641.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF081154 mRNA. Translation: AAC62660.1 .
    AF081155 mRNA. Translation: AAC62661.1 .
    AF081156 mRNA. Translation: AAC62662.1 .
    AF081157 mRNA. Translation: AAC62663.1 .
    AF081158 mRNA. Translation: AAC62664.1 .
    AF081159 mRNA. Translation: AAC62665.1 .
    AF063103 mRNA. Translation: AAC77816.1 .
    PIRi T14327.
    T17186.
    T17187.
    T17188.
    T17198.
    T17199.
    T17200.
    RefSeqi NP_570835.1. NM_130822.1. [Q9Z173-1 ]
    UniGenei Rn.203386.

    3D structure databases

    ProteinModelPortali Q9Z173.
    SMRi Q9Z173. Positions 93-197.
    ModBasei Search...
    MobiDBi Search...

    Chemistry

    GuidetoPHARMACOLOGYi 208.

    Protein family/group databases

    MEROPSi S63.014.
    GPCRDBi Search...

    PTM databases

    PhosphoSitei Q9Z173.

    Proteomic databases

    PaxDbi Q9Z173.
    PRIDEi Q9Z173.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    GeneIDi 170641.
    KEGGi rno:170641.

    Organism-specific databases

    CTDi 23284.
    RGDi 620836. Lphn3.

    Phylogenomic databases

    eggNOGi NOG253931.
    HOVERGENi HBG052337.
    InParanoidi Q9Z173.
    KOi K04594.
    PhylomeDBi Q9Z173.

    Miscellaneous databases

    NextBioi 621147.
    PROi Q9Z173.

    Gene expression databases

    Genevestigatori Q9Z173.

    Family and domain databases

    InterProi IPR022624. DUF3497.
    IPR017981. GPCR_2-like.
    IPR001879. GPCR_2_extracellular_dom.
    IPR003924. GPCR_2_latrophilin.
    IPR015630. GPCR_2_latrophilin3.
    IPR003334. GPCR_2_latrophilin_rcpt_C.
    IPR000832. GPCR_2_secretin-like.
    IPR017983. GPCR_2_secretin-like_CS.
    IPR000203. GPS.
    IPR000922. Lectin_gal-bd_dom.
    IPR003112. Olfac-like.
    [Graphical view ]
    PANTHERi PTHR12011:SF60. PTHR12011:SF60. 1 hit.
    Pfami PF00002. 7tm_2. 1 hit.
    PF12003. DUF3497. 1 hit.
    PF02140. Gal_Lectin. 1 hit.
    PF01825. GPS. 1 hit.
    PF02793. HRM. 1 hit.
    PF02354. Latrophilin. 2 hits.
    PF02191. OLF. 1 hit.
    [Graphical view ]
    PRINTSi PR00249. GPCRSECRETIN.
    PR01444. LATROPHILIN.
    SMARTi SM00303. GPS. 1 hit.
    SM00284. OLF. 1 hit.
    [Graphical view ]
    PROSITEi PS00650. G_PROTEIN_RECEP_F2_2. 1 hit.
    PS50227. G_PROTEIN_RECEP_F2_3. 1 hit.
    PS50261. G_PROTEIN_RECEP_F2_4. 1 hit.
    PS50221. GPS. 1 hit.
    PS51132. OLF. 1 hit.
    PS50228. SUEL_LECTIN. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Alpha-latrotoxin receptor CIRL/latrophilin 1 (CL1) defines an unusual family of ubiquitous G-protein-linked receptors. G-protein coupling not required for triggering exocytosis."
      Sugita S., Ichtchenko K., Khvotchev M., Suedhof T.C.
      J. Biol. Chem. 273:32715-32724(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2; 3; 4; 5; 6 AND 7).
    2. "A novel ubiquitously expressed alpha-latrotoxin receptor is a member of the CIRL family of G-protein-coupled receptors."
      Ichtchenko K., Bittner M.A., Krasnoperov V., Little A.R., Chepurny O., Holz R.W., Petrenko A.G.
      J. Biol. Chem. 274:5491-5498(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.

    Entry informationi

    Entry nameiLPHN3_RAT
    AccessioniPrimary (citable) accession number: Q9Z173
    Secondary accession number(s): O88924
    , O88925, O88926, O88927, O88928, O88929, Q4LDM4, Q4LDM5, Q4LDM6, Q4LDM7, Q4LDM8
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: January 9, 2007
    Last sequence update: May 1, 1999
    Last modified: October 1, 2014
    This is version 89 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. 7-transmembrane G-linked receptors
      List of 7-transmembrane G-linked receptor entries
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3