Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9Z173

- LPHN3_RAT

UniProt

Q9Z173 - LPHN3_RAT

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Latrophilin-3

Gene

Lphn3

Organism
Rattus norvegicus (Rat)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli

Functioni

May be involved in the development of glutamatergic synapses in the cortex. Important in determining the connectivity rates between the principal neurons in the cortex (By similarity).By similarity

GO - Molecular functioni

  1. carbohydrate binding Source: UniProtKB-KW
  2. G-protein coupled receptor activity Source: RGD

GO - Biological processi

  1. brain development Source: RGD
  2. neuropeptide signaling pathway Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

G-protein coupled receptor, Receptor, Transducer

Keywords - Ligandi

Lectin

Protein family/group databases

MEROPSiS63.014.

Names & Taxonomyi

Protein namesi
Recommended name:
Latrophilin-3
Alternative name(s):
Calcium-independent alpha-latrotoxin receptor
Short name:
CIRL-3
Gene namesi
Name:Lphn3
Synonyms:Cirl3, Cl3
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
ProteomesiUP000002494: Unplaced

Organism-specific databases

RGDi620836. Lphn3.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini20 – 948929ExtracellularSequence AnalysisAdd
BLAST
Transmembranei949 – 96921Helical; Name=1Sequence AnalysisAdd
BLAST
Topological domaini970 – 9778CytoplasmicSequence Analysis
Transmembranei978 – 99821Helical; Name=2Sequence AnalysisAdd
BLAST
Topological domaini999 – 10068ExtracellularSequence Analysis
Transmembranei1007 – 102721Helical; Name=3Sequence AnalysisAdd
BLAST
Topological domaini1028 – 104821CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei1049 – 106921Helical; Name=4Sequence AnalysisAdd
BLAST
Topological domaini1070 – 108718ExtracellularSequence AnalysisAdd
BLAST
Transmembranei1088 – 110821Helical; Name=5Sequence AnalysisAdd
BLAST
Topological domaini1109 – 114133CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei1142 – 116221Helical; Name=6Sequence AnalysisAdd
BLAST
Topological domaini1163 – 11686ExtracellularSequence Analysis
Transmembranei1169 – 118921Helical; Name=7Sequence AnalysisAdd
BLAST
Topological domaini1190 – 1550361CytoplasmicSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
  2. plasma membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 1919Sequence AnalysisAdd
BLAST
Chaini20 – 15501531Latrophilin-3PRO_0000270141Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi161 – 1611N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi203 ↔ 385PROSITE-ProRule annotation
Glycosylationi532 – 5321N-linked (GlcNAc...)Sequence Analysis
Glycosylationi616 – 6161N-linked (GlcNAc...)Sequence Analysis
Glycosylationi839 – 8391N-linked (GlcNAc...)Sequence Analysis
Glycosylationi884 – 8841N-linked (GlcNAc...)Sequence Analysis
Glycosylationi910 – 9101N-linked (GlcNAc...)Sequence Analysis
Glycosylationi999 – 9991N-linked (GlcNAc...)Sequence Analysis
Glycosylationi1165 – 11651N-linked (GlcNAc...)Sequence Analysis

Post-translational modificationi

Proteolytically cleaved into 2 subunits, an extracellular subunit and a seven-transmembrane subunit.By similarity
O-glycosylated (major) and N-glycosylated.By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ9Z173.
PRIDEiQ9Z173.

PTM databases

PhosphoSiteiQ9Z173.

Expressioni

Tissue specificityi

Predominantly expressed in brain, followed by heart, placenta, pancreas, kidney and testis.1 Publication

Gene expression databases

GenevestigatoriQ9Z173.

Interactioni

Subunit structurei

Interacts with FLRT3 and TEN1.By similarity

Structurei

3D structure databases

ProteinModelPortaliQ9Z173.
SMRiQ9Z173. Positions 93-197.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini103 – 19290SUEL-type lectinPROSITE-ProRule annotationAdd
BLAST
Domaini202 – 461260Olfactomedin-likePROSITE-ProRule annotationAdd
BLAST
Domaini882 – 93352GPSPROSITE-ProRule annotationAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi1483 – 14864Poly-Ala

Domaini

The Olfactomedin-like domain is required for the synapse-promoting function and the interaction with FLRT3. The Olfactomedin-like and the SUEL-type lectin domains are required for the interaction with TEN1 (By similarity).By similarity

Sequence similaritiesi

Contains 1 GPS domain.PROSITE-ProRule annotation
Contains 1 olfactomedin-like domain.PROSITE-ProRule annotation
Contains 1 SUEL-type lectin domain.PROSITE-ProRule annotation

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG253931.
HOVERGENiHBG052337.
InParanoidiQ9Z173.
KOiK04594.
PhylomeDBiQ9Z173.

Family and domain databases

InterProiIPR022624. DUF3497.
IPR017981. GPCR_2-like.
IPR001879. GPCR_2_extracellular_dom.
IPR003924. GPCR_2_latrophilin.
IPR015630. GPCR_2_latrophilin3.
IPR003334. GPCR_2_latrophilin_rcpt_C.
IPR000832. GPCR_2_secretin-like.
IPR017983. GPCR_2_secretin-like_CS.
IPR000203. GPS.
IPR000922. Lectin_gal-bd_dom.
IPR003112. Olfac-like.
[Graphical view]
PANTHERiPTHR12011:SF60. PTHR12011:SF60. 1 hit.
PfamiPF00002. 7tm_2. 1 hit.
PF12003. DUF3497. 1 hit.
PF02140. Gal_Lectin. 1 hit.
PF01825. GPS. 1 hit.
PF02793. HRM. 1 hit.
PF02354. Latrophilin. 2 hits.
PF02191. OLF. 1 hit.
[Graphical view]
PRINTSiPR00249. GPCRSECRETIN.
PR01444. LATROPHILIN.
SMARTiSM00303. GPS. 1 hit.
SM00284. OLF. 1 hit.
[Graphical view]
PROSITEiPS00650. G_PROTEIN_RECEP_F2_2. 1 hit.
PS50227. G_PROTEIN_RECEP_F2_3. 1 hit.
PS50261. G_PROTEIN_RECEP_F2_4. 1 hit.
PS50221. GPS. 1 hit.
PS51132. OLF. 1 hit.
PS50228. SUEL_LECTIN. 1 hit.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 7 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9Z173-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MCPPQLFILM MLLAPVVHGG KHNERHPALA APLRHAEHSP GGPLPPRHLL
60 70 80 90 100
QQPAAERSTA HRGQGPRGTA RGVRGPGAPG AQIAAQAFSR APIPMAVVRR
110 120 130 140 150
ELSCESYPIE LRCPGTDVIM IESANYGRTD DKICDSDPAQ MENIRCYLPD
160 170 180 190 200
AYKIMSQRCN NRTQCAVVAG PDVFPDPCPG TYKYLEVQYE CVPYKVEQKV
210 220 230 240 250
FLCPGLLKGV YQSEHLFESD HQSGAWCKDP LQASDKIYYM PWTPYRTDTL
260 270 280 290 300
TEYSSKDDFI AGRPTTTYKL PHRVDGTGFV VYDGALFFNK ERTRNIVKFD
310 320 330 340 350
LRTRIKSGEA IIANANYHDT SPYRWGGKSD IDLAVDENGL WVIYATEQNN
360 370 380 390 400
GKIVISQLNP YTLRIEGTWD TAYDKRSASN AFMICGILYV VKSVYEDDDN
410 420 430 440 450
EATGNKIDYI YNTDQSKDSL VDVPFPNSYQ YIAAVDYNPR DNLLYVWNNY
460 470 480 490 500
HVVKYSLDFG PLDSRSGPVH HGQVSYISPP IHLDSDLERP PVRGISTTGP
510 520 530 540 550
LGMGSTTTST TLRTTTWNLG RSTTPSLPGR RNRSTSTPSP AIEVLDVTTH
560 570 580 590 600
LPSAASQIPA MEESCEAVEA REIMWFKTRQ GQVAKQSCPA GTIGVSTYLC
610 620 630 640 650
LAPDGIWDPQ GPDLSNCSSP WVNHITQKLK SGETAANIAR ELAEQTRNHL
660 670 680 690 700
NAGDITYSVR AMDQLVGLLD VQLRNLTPGG KDSAARSLNK LQKRERSCRA
710 720 730 740 750
YVQAMVETVN NLLQPQALNA WRDLTTSDQL RAATMLLDTV EESAFVLADN
760 770 780 790 800
LLKTDIVREN TDNIQLEVAR LSTEGNLEDL KFPENTGHGS TIQLSANTLK
810 820 830 840 850
QNGRNGEIRV AFVLYNNLGP YLSTENASMK LGTEAMSTNH SVIVNSPVIT
860 870 880 890 900
AAINKEFSNK VYLADPVVFT VKHIKQSEEN FNPNCSFWSY SKRTMTGYWS
910 920 930 940 950
TQGCRLLTTN KTHTTCSCNH LTNFAVLMAH VEVKHSDAVH DLLLDVITWV
960 970 980 990 1000
GILLSLVCLL ICIFTFCFFR GLQSDRNTIH KNLCISLFVA ELLFLIGINR
1010 1020 1030 1040 1050
TDQPIACAVF AALLHFFFLA AFTWMFLEGV QLYIMLVEVF ESEHSRRKYF
1060 1070 1080 1090 1100
YLVGYGMPAL IVAVSAAVDY RSYGTDKVCW LRLDTYFIWS FIGPATLIIM
1110 1120 1130 1140 1150
LNVIFLGIAL YKMFHHTAIL KPESGCLDNI NYEDNRPFIK SWVIGAIALL
1160 1170 1180 1190 1200
CLLGLTWAFG LMYINESTVI MAYLFTIFNS LQGMFIFIFH CVLQKKVRKE
1210 1220 1230 1240 1250
YGKCLRTHCC SGKSTESSIG SGKTSGSRTP GRYSTGSQSR IRRMWNDTVR
1260 1270 1280 1290 1300
KQSESSFITG DINSSASLNR GSYLPCIQAC VTYLEGLLNN ARDTSVMDTL
1310 1320 1330 1340 1350
PLNGNHGNSY SIAGGEYLSN CVQIIDRGYN HNETALEKKI LKELTSNYIP
1360 1370 1380 1390 1400
SYLNNHERSS EQNRNMMNKL VDNLGSGSED DAIVLDDAAS FNHEESLGLE
1410 1420 1430 1440 1450
LIHEESDAPL LPPRVYSTDN HQPHHYSRRR LPQDHSESFF PLLTDEHTED
1460 1470 1480 1490 1500
PQSPHRDSLY TSMPALAGVP AADSVTTSTQ TEAAAAKGGD AEDVYYKSMP
1510 1520 1530 1540 1550
NLGSRNHVHP LHAYYQLGRG SSDGFIVPPN KDGASPEGTS KGPAHLVTSL
Length:1,550
Mass (Da):172,442
Last modified:May 1, 1999 - v1
Checksum:iA2E8091B2B34DB36
GO
Isoform 2 (identifier: Q9Z173-2) [UniParc]FASTAAdd to Basket

Also known as: CL3AA

The sequence of this isoform differs from the canonical sequence as follows:
     19-86: Missing.
     1131-1139: Missing.
     1271-1284: Missing.

Note: No experimental confirmation available.

Show »
Length:1,459
Mass (Da):162,831
Checksum:iF083B7E81180E1A8
GO
Isoform 3 (identifier: Q9Z173-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1131-1139: Missing.
     1271-1284: Missing.

Note: No experimental confirmation available.

Show »
Length:1,527
Mass (Da):169,780
Checksum:iA0F1FFC2D9B50B9F
GO
Isoform 4 (identifier: Q9Z173-4) [UniParc]FASTAAdd to Basket

Also known as: CL3BB

The sequence of this isoform differs from the canonical sequence as follows:
     1131-1139: Missing.
     1271-1307: GSYLPCIQACVTYLEGLLNNARDTSVMDTLPLNGNHG → EPYRETSMGVKLNIAYQIGASEQCQGYKCHGYSTTEW
     1308-1550: Missing.

Note: No experimental confirmation available.

Show »
Length:1,298
Mass (Da):144,892
Checksum:i26C05A298C6B1A02
GO
Isoform 5 (identifier: Q9Z173-5) [UniParc]FASTAAdd to Basket

Also known as: CL3AB

The sequence of this isoform differs from the canonical sequence as follows:
     19-86: Missing.
     1131-1139: Missing.
     1271-1307: GSYLPCIQACVTYLEGLLNNARDTSVMDTLPLNGNHG → EPYRETSMGVKLNIAYQIGASEQCQGYKCHGYSTTEW
     1308-1550: Missing.

Note: No experimental confirmation available.

Show »
Length:1,230
Mass (Da):137,943
Checksum:i691DDCD1FE095C12
GO
Isoform 6 (identifier: Q9Z173-6) [UniParc]FASTAAdd to Basket

Also known as: CL3BC

The sequence of this isoform differs from the canonical sequence as follows:
     1131-1139: Missing.
     1272-1350: SYLPCIQACV...LKELTSNYIP → TMANHLMSNA...KCHGYSTTEW
     1351-1550: Missing.

Note: No experimental confirmation available.

Show »
Length:1,341
Mass (Da):149,502
Checksum:iF73C8CEB1B657008
GO
Isoform 7 (identifier: Q9Z173-7) [UniParc]FASTAAdd to Basket

Also known as: CL3AC

The sequence of this isoform differs from the canonical sequence as follows:
     19-86: Missing.
     1131-1139: Missing.
     1272-1350: SYLPCIQACV...LKELTSNYIP → TMANHLMSNA...KCHGYSTTEW
     1351-1550: Missing.

Note: No experimental confirmation available.

Show »
Length:1,273
Mass (Da):142,554
Checksum:iAE10D88D147CF078
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei19 – 8668Missing in isoform 2, isoform 5 and isoform 7. 1 PublicationVSP_022127Add
BLAST
Alternative sequencei1131 – 11399Missing in isoform 2, isoform 3, isoform 4, isoform 5, isoform 6 and isoform 7. 1 PublicationVSP_022128
Alternative sequencei1271 – 130737GSYLP…NGNHG → EPYRETSMGVKLNIAYQIGA SEQCQGYKCHGYSTTEW in isoform 4 and isoform 5. 1 PublicationVSP_022129Add
BLAST
Alternative sequencei1271 – 128414Missing in isoform 2 and isoform 3. 1 PublicationVSP_022130Add
BLAST
Alternative sequencei1272 – 135079SYLPC…SNYIP → TMANHLMSNALLRPHGTNNP YNTLLGEPAVCNNPSISMYN AQEPYRETSMGVKLNIAYQI GASEQCQGYKCHGYSTTEW in isoform 6 and isoform 7. 1 PublicationVSP_022131Add
BLAST
Alternative sequencei1308 – 1550243Missing in isoform 4 and isoform 5. 1 PublicationVSP_022132Add
BLAST
Alternative sequencei1351 – 1550200Missing in isoform 6 and isoform 7. 1 PublicationVSP_022133Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF081154 mRNA. Translation: AAC62660.1.
AF081155 mRNA. Translation: AAC62661.1.
AF081156 mRNA. Translation: AAC62662.1.
AF081157 mRNA. Translation: AAC62663.1.
AF081158 mRNA. Translation: AAC62664.1.
AF081159 mRNA. Translation: AAC62665.1.
AF063103 mRNA. Translation: AAC77816.1.
PIRiT14327.
T17186.
T17187.
T17188.
T17198.
T17199.
T17200.
RefSeqiNP_570835.1. NM_130822.1. [Q9Z173-1]
UniGeneiRn.203386.

Genome annotation databases

GeneIDi170641.
KEGGirno:170641.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF081154 mRNA. Translation: AAC62660.1 .
AF081155 mRNA. Translation: AAC62661.1 .
AF081156 mRNA. Translation: AAC62662.1 .
AF081157 mRNA. Translation: AAC62663.1 .
AF081158 mRNA. Translation: AAC62664.1 .
AF081159 mRNA. Translation: AAC62665.1 .
AF063103 mRNA. Translation: AAC77816.1 .
PIRi T14327.
T17186.
T17187.
T17188.
T17198.
T17199.
T17200.
RefSeqi NP_570835.1. NM_130822.1. [Q9Z173-1 ]
UniGenei Rn.203386.

3D structure databases

ProteinModelPortali Q9Z173.
SMRi Q9Z173. Positions 93-197.
ModBasei Search...
MobiDBi Search...

Chemistry

GuidetoPHARMACOLOGYi 208.

Protein family/group databases

MEROPSi S63.014.
GPCRDBi Search...

PTM databases

PhosphoSitei Q9Z173.

Proteomic databases

PaxDbi Q9Z173.
PRIDEi Q9Z173.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

GeneIDi 170641.
KEGGi rno:170641.

Organism-specific databases

CTDi 23284.
RGDi 620836. Lphn3.

Phylogenomic databases

eggNOGi NOG253931.
HOVERGENi HBG052337.
InParanoidi Q9Z173.
KOi K04594.
PhylomeDBi Q9Z173.

Miscellaneous databases

NextBioi 621147.
PROi Q9Z173.

Gene expression databases

Genevestigatori Q9Z173.

Family and domain databases

InterProi IPR022624. DUF3497.
IPR017981. GPCR_2-like.
IPR001879. GPCR_2_extracellular_dom.
IPR003924. GPCR_2_latrophilin.
IPR015630. GPCR_2_latrophilin3.
IPR003334. GPCR_2_latrophilin_rcpt_C.
IPR000832. GPCR_2_secretin-like.
IPR017983. GPCR_2_secretin-like_CS.
IPR000203. GPS.
IPR000922. Lectin_gal-bd_dom.
IPR003112. Olfac-like.
[Graphical view ]
PANTHERi PTHR12011:SF60. PTHR12011:SF60. 1 hit.
Pfami PF00002. 7tm_2. 1 hit.
PF12003. DUF3497. 1 hit.
PF02140. Gal_Lectin. 1 hit.
PF01825. GPS. 1 hit.
PF02793. HRM. 1 hit.
PF02354. Latrophilin. 2 hits.
PF02191. OLF. 1 hit.
[Graphical view ]
PRINTSi PR00249. GPCRSECRETIN.
PR01444. LATROPHILIN.
SMARTi SM00303. GPS. 1 hit.
SM00284. OLF. 1 hit.
[Graphical view ]
PROSITEi PS00650. G_PROTEIN_RECEP_F2_2. 1 hit.
PS50227. G_PROTEIN_RECEP_F2_3. 1 hit.
PS50261. G_PROTEIN_RECEP_F2_4. 1 hit.
PS50221. GPS. 1 hit.
PS51132. OLF. 1 hit.
PS50228. SUEL_LECTIN. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Alpha-latrotoxin receptor CIRL/latrophilin 1 (CL1) defines an unusual family of ubiquitous G-protein-linked receptors. G-protein coupling not required for triggering exocytosis."
    Sugita S., Ichtchenko K., Khvotchev M., Suedhof T.C.
    J. Biol. Chem. 273:32715-32724(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2; 3; 4; 5; 6 AND 7).
  2. "A novel ubiquitously expressed alpha-latrotoxin receptor is a member of the CIRL family of G-protein-coupled receptors."
    Ichtchenko K., Bittner M.A., Krasnoperov V., Little A.R., Chepurny O., Holz R.W., Petrenko A.G.
    J. Biol. Chem. 274:5491-5498(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.

Entry informationi

Entry nameiLPHN3_RAT
AccessioniPrimary (citable) accession number: Q9Z173
Secondary accession number(s): O88924
, O88925, O88926, O88927, O88928, O88929, Q4LDM4, Q4LDM5, Q4LDM6, Q4LDM7, Q4LDM8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 9, 2007
Last sequence update: May 1, 1999
Last modified: October 29, 2014
This is version 90 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3