Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Adhesion G protein-coupled receptor L3

Gene

Adgrl3

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Plays a role in cell-cell adhesion and neuron guidance via its interactions with FLRT2 and FLRT3 that are expressed at the surface of adjacent cells. Plays a role in the development of glutamatergic synapses in the cortex. Important in determining the connectivity rates between the principal neurons in the cortex.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi332CalciumBy similarity1
Metal bindingi380CalciumBy similarity1
Metal bindingi381Calcium; via carbonyl oxygenBy similarity1
Metal bindingi435Calcium; via carbonyl oxygen1

GO - Molecular functioni

  • calcium ion binding Source: UniProtKB
  • carbohydrate binding Source: UniProtKB-KW
  • G-protein coupled receptor activity Source: RGD

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

G-protein coupled receptor, Receptor, Transducer

Keywords - Ligandi

Lectin, Metal-binding

Protein family/group databases

MEROPSiP02.011.

Names & Taxonomyi

Protein namesi
Recommended name:
Adhesion G protein-coupled receptor L3Imported
Alternative name(s):
Calcium-independent alpha-latrotoxin receptor 31 Publication
Short name:
CIRL-31 Publication
Latrophilin-3Imported
Gene namesi
Name:Adgrl3Imported
Synonyms:Cirl31 Publication, Cl31 Publication, Lphn3Imported
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Unplaced

Organism-specific databases

RGDi620836. Adgrl3.

Subcellular locationi

  • Cell membrane By similarity; Multi-pass membrane protein By similarity
  • Cell projectionaxon By similarity
  • Cell junction By similarity

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini20 – 948ExtracellularSequence analysisAdd BLAST929
Transmembranei949 – 969Helical; Name=1Sequence analysisAdd BLAST21
Topological domaini970 – 977CytoplasmicSequence analysis8
Transmembranei978 – 998Helical; Name=2Sequence analysisAdd BLAST21
Topological domaini999 – 1006ExtracellularSequence analysis8
Transmembranei1007 – 1027Helical; Name=3Sequence analysisAdd BLAST21
Topological domaini1028 – 1048CytoplasmicSequence analysisAdd BLAST21
Transmembranei1049 – 1069Helical; Name=4Sequence analysisAdd BLAST21
Topological domaini1070 – 1087ExtracellularSequence analysisAdd BLAST18
Transmembranei1088 – 1108Helical; Name=5Sequence analysisAdd BLAST21
Topological domaini1109 – 1141CytoplasmicSequence analysisAdd BLAST33
Transmembranei1142 – 1162Helical; Name=6Sequence analysisAdd BLAST21
Topological domaini1163 – 1168ExtracellularSequence analysis6
Transmembranei1169 – 1189Helical; Name=7Sequence analysisAdd BLAST21
Topological domaini1190 – 1550CytoplasmicSequence analysisAdd BLAST361

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Membrane

Pathology & Biotechi

Chemistry databases

GuidetoPHARMACOLOGYi208.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 19Sequence analysisAdd BLAST19
ChainiPRO_000027014120 – 1550Adhesion G protein-coupled receptor L3Add BLAST1531

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi104 ↔ 134By similarity
Disulfide bondi113 ↔ 191By similarity
Disulfide bondi146 ↔ 178By similarity
Disulfide bondi159 ↔ 165By similarity
Glycosylationi161N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi203 ↔ 385PROSITE-ProRule annotation
Glycosylationi532N-linked (GlcNAc...)Sequence analysis1
Glycosylationi616N-linked (GlcNAc...)Sequence analysis1
Glycosylationi839N-linked (GlcNAc...)Sequence analysis1
Glycosylationi884N-linked (GlcNAc...)Sequence analysis1
Glycosylationi910N-linked (GlcNAc...)Sequence analysis1
Glycosylationi999N-linked (GlcNAc...)Sequence analysis1
Glycosylationi1165N-linked (GlcNAc...)Sequence analysis1
Modified residuei1253PhosphoserineBy similarity1
Modified residuei1535PhosphoserineBy similarity1

Post-translational modificationi

Proteolytically cleaved into 2 subunits, an extracellular subunit and a seven-transmembrane subunit.By similarity
O-glycosylated (major) and N-glycosylated.By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiQ9Z173.
PRIDEiQ9Z173.

PTM databases

iPTMnetiQ9Z173.
PhosphoSitePlusiQ9Z173.

Expressioni

Tissue specificityi

Predominantly expressed in brain, followed by heart, placenta, pancreas, kidney and testis.1 Publication

Interactioni

Subunit structurei

Interacts (via olfactomedin-like domain) with FLRT3 (via extracellular domain); the interaction is direct (PubMed:22405201). Identified in a complex with FLRT3 and UNC5B; does not interact with UNC5B by itself. Identified in a complex with FLRT3 and UNC5D; does not interact with UNC5D by itself (By similarity). Interacts (via olfactomedin-like domain) with FLRT1 (via extracellular domain). Interacts (via olfactomedin-like domain) with FLRT2 (via extracellular domain). Interacts (via extracellular domain) with TENM1. Interacts (via extracellular domain) with TENM3 (By similarity).By similarity1 Publication

Protein-protein interaction databases

BioGridi250970. 1 interactor.
STRINGi10116.ENSRNOP00000056687.

Structurei

3D structure databases

ProteinModelPortaliQ9Z173.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini103 – 192SUEL-type lectinPROSITE-ProRule annotationAdd BLAST90
Domaini202 – 461Olfactomedin-likePROSITE-ProRule annotationAdd BLAST260
Domaini882 – 933GPSPROSITE-ProRule annotationAdd BLAST52

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni317 – 347Interaction with FLRT3By similarityAdd BLAST31

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi1483 – 1486Poly-Ala4

Domaini

The Olfactomedin-like domain is required for the synapse-promoting function and the interaction with FLRT3. The Olfactomedin-like and the SUEL-type lectin domains are required for the interaction with TENM1 (By similarity).By similarity

Sequence similaritiesi

Contains 1 GPS domain.PROSITE-ProRule annotation
Contains 1 olfactomedin-like domain.PROSITE-ProRule annotation
Contains 1 SUEL-type lectin domain.PROSITE-ProRule annotation

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3545. Eukaryota.
KOG4193. Eukaryota.
KOG4729. Eukaryota.
ENOG410XSD2. LUCA.
HOVERGENiHBG052337.
InParanoidiQ9Z173.
KOiK04594.
PhylomeDBiQ9Z173.

Family and domain databases

InterProiIPR032471. GAIN_dom_N.
IPR017981. GPCR_2-like.
IPR001879. GPCR_2_extracellular_dom.
IPR003924. GPCR_2_latrophilin.
IPR003334. GPCR_2_latrophilin_rcpt_C.
IPR000832. GPCR_2_secretin-like.
IPR017983. GPCR_2_secretin-like_CS.
IPR000203. GPS.
IPR000922. Lectin_gal-bd_dom.
IPR003112. Olfac-like_dom.
[Graphical view]
PfamiPF00002. 7tm_2. 1 hit.
PF16489. GAIN. 1 hit.
PF02140. Gal_Lectin. 1 hit.
PF01825. GPS. 1 hit.
PF02793. HRM. 1 hit.
PF02354. Latrophilin. 2 hits.
PF02191. OLF. 1 hit.
[Graphical view]
PRINTSiPR00249. GPCRSECRETIN.
PR01444. LATROPHILIN.
SMARTiSM00303. GPS. 1 hit.
SM00008. HormR. 1 hit.
SM00284. OLF. 1 hit.
[Graphical view]
PROSITEiPS00650. G_PROTEIN_RECEP_F2_2. 1 hit.
PS50227. G_PROTEIN_RECEP_F2_3. 1 hit.
PS50261. G_PROTEIN_RECEP_F2_4. 1 hit.
PS50221. GPS. 1 hit.
PS51132. OLF. 1 hit.
PS50228. SUEL_LECTIN. 1 hit.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9Z173-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MCPPQLFILM MLLAPVVHGG KHNERHPALA APLRHAEHSP GGPLPPRHLL
60 70 80 90 100
QQPAAERSTA HRGQGPRGTA RGVRGPGAPG AQIAAQAFSR APIPMAVVRR
110 120 130 140 150
ELSCESYPIE LRCPGTDVIM IESANYGRTD DKICDSDPAQ MENIRCYLPD
160 170 180 190 200
AYKIMSQRCN NRTQCAVVAG PDVFPDPCPG TYKYLEVQYE CVPYKVEQKV
210 220 230 240 250
FLCPGLLKGV YQSEHLFESD HQSGAWCKDP LQASDKIYYM PWTPYRTDTL
260 270 280 290 300
TEYSSKDDFI AGRPTTTYKL PHRVDGTGFV VYDGALFFNK ERTRNIVKFD
310 320 330 340 350
LRTRIKSGEA IIANANYHDT SPYRWGGKSD IDLAVDENGL WVIYATEQNN
360 370 380 390 400
GKIVISQLNP YTLRIEGTWD TAYDKRSASN AFMICGILYV VKSVYEDDDN
410 420 430 440 450
EATGNKIDYI YNTDQSKDSL VDVPFPNSYQ YIAAVDYNPR DNLLYVWNNY
460 470 480 490 500
HVVKYSLDFG PLDSRSGPVH HGQVSYISPP IHLDSDLERP PVRGISTTGP
510 520 530 540 550
LGMGSTTTST TLRTTTWNLG RSTTPSLPGR RNRSTSTPSP AIEVLDVTTH
560 570 580 590 600
LPSAASQIPA MEESCEAVEA REIMWFKTRQ GQVAKQSCPA GTIGVSTYLC
610 620 630 640 650
LAPDGIWDPQ GPDLSNCSSP WVNHITQKLK SGETAANIAR ELAEQTRNHL
660 670 680 690 700
NAGDITYSVR AMDQLVGLLD VQLRNLTPGG KDSAARSLNK LQKRERSCRA
710 720 730 740 750
YVQAMVETVN NLLQPQALNA WRDLTTSDQL RAATMLLDTV EESAFVLADN
760 770 780 790 800
LLKTDIVREN TDNIQLEVAR LSTEGNLEDL KFPENTGHGS TIQLSANTLK
810 820 830 840 850
QNGRNGEIRV AFVLYNNLGP YLSTENASMK LGTEAMSTNH SVIVNSPVIT
860 870 880 890 900
AAINKEFSNK VYLADPVVFT VKHIKQSEEN FNPNCSFWSY SKRTMTGYWS
910 920 930 940 950
TQGCRLLTTN KTHTTCSCNH LTNFAVLMAH VEVKHSDAVH DLLLDVITWV
960 970 980 990 1000
GILLSLVCLL ICIFTFCFFR GLQSDRNTIH KNLCISLFVA ELLFLIGINR
1010 1020 1030 1040 1050
TDQPIACAVF AALLHFFFLA AFTWMFLEGV QLYIMLVEVF ESEHSRRKYF
1060 1070 1080 1090 1100
YLVGYGMPAL IVAVSAAVDY RSYGTDKVCW LRLDTYFIWS FIGPATLIIM
1110 1120 1130 1140 1150
LNVIFLGIAL YKMFHHTAIL KPESGCLDNI NYEDNRPFIK SWVIGAIALL
1160 1170 1180 1190 1200
CLLGLTWAFG LMYINESTVI MAYLFTIFNS LQGMFIFIFH CVLQKKVRKE
1210 1220 1230 1240 1250
YGKCLRTHCC SGKSTESSIG SGKTSGSRTP GRYSTGSQSR IRRMWNDTVR
1260 1270 1280 1290 1300
KQSESSFITG DINSSASLNR GSYLPCIQAC VTYLEGLLNN ARDTSVMDTL
1310 1320 1330 1340 1350
PLNGNHGNSY SIAGGEYLSN CVQIIDRGYN HNETALEKKI LKELTSNYIP
1360 1370 1380 1390 1400
SYLNNHERSS EQNRNMMNKL VDNLGSGSED DAIVLDDAAS FNHEESLGLE
1410 1420 1430 1440 1450
LIHEESDAPL LPPRVYSTDN HQPHHYSRRR LPQDHSESFF PLLTDEHTED
1460 1470 1480 1490 1500
PQSPHRDSLY TSMPALAGVP AADSVTTSTQ TEAAAAKGGD AEDVYYKSMP
1510 1520 1530 1540 1550
NLGSRNHVHP LHAYYQLGRG SSDGFIVPPN KDGASPEGTS KGPAHLVTSL
Length:1,550
Mass (Da):172,442
Last modified:May 1, 1999 - v1
Checksum:iA2E8091B2B34DB36
GO
Isoform 2 (identifier: Q9Z173-2) [UniParc]FASTAAdd to basket
Also known as: CL3AA

The sequence of this isoform differs from the canonical sequence as follows:
     19-86: Missing.
     1131-1139: Missing.
     1271-1284: Missing.

Note: No experimental confirmation available.
Show »
Length:1,459
Mass (Da):162,831
Checksum:iF083B7E81180E1A8
GO
Isoform 3 (identifier: Q9Z173-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1131-1139: Missing.
     1271-1284: Missing.

Note: No experimental confirmation available.
Show »
Length:1,527
Mass (Da):169,780
Checksum:iA0F1FFC2D9B50B9F
GO
Isoform 4 (identifier: Q9Z173-4) [UniParc]FASTAAdd to basket
Also known as: CL3BB

The sequence of this isoform differs from the canonical sequence as follows:
     1131-1139: Missing.
     1271-1307: GSYLPCIQACVTYLEGLLNNARDTSVMDTLPLNGNHG → EPYRETSMGVKLNIAYQIGASEQCQGYKCHGYSTTEW
     1308-1550: Missing.

Note: No experimental confirmation available.
Show »
Length:1,298
Mass (Da):144,892
Checksum:i26C05A298C6B1A02
GO
Isoform 5 (identifier: Q9Z173-5) [UniParc]FASTAAdd to basket
Also known as: CL3AB

The sequence of this isoform differs from the canonical sequence as follows:
     19-86: Missing.
     1131-1139: Missing.
     1271-1307: GSYLPCIQACVTYLEGLLNNARDTSVMDTLPLNGNHG → EPYRETSMGVKLNIAYQIGASEQCQGYKCHGYSTTEW
     1308-1550: Missing.

Note: No experimental confirmation available.
Show »
Length:1,230
Mass (Da):137,943
Checksum:i691DDCD1FE095C12
GO
Isoform 6 (identifier: Q9Z173-6) [UniParc]FASTAAdd to basket
Also known as: CL3BC

The sequence of this isoform differs from the canonical sequence as follows:
     1131-1139: Missing.
     1272-1350: SYLPCIQACV...LKELTSNYIP → TMANHLMSNA...KCHGYSTTEW
     1351-1550: Missing.

Note: No experimental confirmation available.
Show »
Length:1,341
Mass (Da):149,502
Checksum:iF73C8CEB1B657008
GO
Isoform 7 (identifier: Q9Z173-7) [UniParc]FASTAAdd to basket
Also known as: CL3AC

The sequence of this isoform differs from the canonical sequence as follows:
     19-86: Missing.
     1131-1139: Missing.
     1272-1350: SYLPCIQACV...LKELTSNYIP → TMANHLMSNA...KCHGYSTTEW
     1351-1550: Missing.

Note: No experimental confirmation available.
Show »
Length:1,273
Mass (Da):142,554
Checksum:iAE10D88D147CF078
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_02212719 – 86Missing in isoform 2, isoform 5 and isoform 7. 1 PublicationAdd BLAST68
Alternative sequenceiVSP_0221281131 – 1139Missing in isoform 2, isoform 3, isoform 4, isoform 5, isoform 6 and isoform 7. 1 Publication9
Alternative sequenceiVSP_0221291271 – 1307GSYLP…NGNHG → EPYRETSMGVKLNIAYQIGA SEQCQGYKCHGYSTTEW in isoform 4 and isoform 5. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_0221301271 – 1284Missing in isoform 2 and isoform 3. 1 PublicationAdd BLAST14
Alternative sequenceiVSP_0221311272 – 1350SYLPC…SNYIP → TMANHLMSNALLRPHGTNNP YNTLLGEPAVCNNPSISMYN AQEPYRETSMGVKLNIAYQI GASEQCQGYKCHGYSTTEW in isoform 6 and isoform 7. 1 PublicationAdd BLAST79
Alternative sequenceiVSP_0221321308 – 1550Missing in isoform 4 and isoform 5. 1 PublicationAdd BLAST243
Alternative sequenceiVSP_0221331351 – 1550Missing in isoform 6 and isoform 7. 1 PublicationAdd BLAST200

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF081154 mRNA. Translation: AAC62660.1.
AF081155 mRNA. Translation: AAC62661.1.
AF081156 mRNA. Translation: AAC62662.1.
AF081157 mRNA. Translation: AAC62663.1.
AF081158 mRNA. Translation: AAC62664.1.
AF081159 mRNA. Translation: AAC62665.1.
AF063103 mRNA. Translation: AAC77816.1.
PIRiT14327.
T17186.
T17187.
T17188.
T17198.
T17199.
T17200.
RefSeqiNP_570835.1. NM_130822.1. [Q9Z173-1]
UniGeneiRn.203386.

Genome annotation databases

GeneIDi170641.
KEGGirno:170641.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF081154 mRNA. Translation: AAC62660.1.
AF081155 mRNA. Translation: AAC62661.1.
AF081156 mRNA. Translation: AAC62662.1.
AF081157 mRNA. Translation: AAC62663.1.
AF081158 mRNA. Translation: AAC62664.1.
AF081159 mRNA. Translation: AAC62665.1.
AF063103 mRNA. Translation: AAC77816.1.
PIRiT14327.
T17186.
T17187.
T17188.
T17198.
T17199.
T17200.
RefSeqiNP_570835.1. NM_130822.1. [Q9Z173-1]
UniGeneiRn.203386.

3D structure databases

ProteinModelPortaliQ9Z173.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi250970. 1 interactor.
STRINGi10116.ENSRNOP00000056687.

Chemistry databases

GuidetoPHARMACOLOGYi208.

Protein family/group databases

MEROPSiP02.011.
GPCRDBiSearch...

PTM databases

iPTMnetiQ9Z173.
PhosphoSitePlusiQ9Z173.

Proteomic databases

PaxDbiQ9Z173.
PRIDEiQ9Z173.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi170641.
KEGGirno:170641.

Organism-specific databases

CTDi23284.
RGDi620836. Adgrl3.

Phylogenomic databases

eggNOGiKOG3545. Eukaryota.
KOG4193. Eukaryota.
KOG4729. Eukaryota.
ENOG410XSD2. LUCA.
HOVERGENiHBG052337.
InParanoidiQ9Z173.
KOiK04594.
PhylomeDBiQ9Z173.

Miscellaneous databases

PROiQ9Z173.

Family and domain databases

InterProiIPR032471. GAIN_dom_N.
IPR017981. GPCR_2-like.
IPR001879. GPCR_2_extracellular_dom.
IPR003924. GPCR_2_latrophilin.
IPR003334. GPCR_2_latrophilin_rcpt_C.
IPR000832. GPCR_2_secretin-like.
IPR017983. GPCR_2_secretin-like_CS.
IPR000203. GPS.
IPR000922. Lectin_gal-bd_dom.
IPR003112. Olfac-like_dom.
[Graphical view]
PfamiPF00002. 7tm_2. 1 hit.
PF16489. GAIN. 1 hit.
PF02140. Gal_Lectin. 1 hit.
PF01825. GPS. 1 hit.
PF02793. HRM. 1 hit.
PF02354. Latrophilin. 2 hits.
PF02191. OLF. 1 hit.
[Graphical view]
PRINTSiPR00249. GPCRSECRETIN.
PR01444. LATROPHILIN.
SMARTiSM00303. GPS. 1 hit.
SM00008. HormR. 1 hit.
SM00284. OLF. 1 hit.
[Graphical view]
PROSITEiPS00650. G_PROTEIN_RECEP_F2_2. 1 hit.
PS50227. G_PROTEIN_RECEP_F2_3. 1 hit.
PS50261. G_PROTEIN_RECEP_F2_4. 1 hit.
PS50221. GPS. 1 hit.
PS51132. OLF. 1 hit.
PS50228. SUEL_LECTIN. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiAGRL3_RAT
AccessioniPrimary (citable) accession number: Q9Z173
Secondary accession number(s): O88924
, O88925, O88926, O88927, O88928, O88929, Q4LDM4, Q4LDM5, Q4LDM6, Q4LDM7, Q4LDM8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 9, 2007
Last sequence update: May 1, 1999
Last modified: November 2, 2016
This is version 103 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.