Q9Z173 (LPHN3_RAT) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 80.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Latrophilin-3 Alternative name(s): Calcium-independent alpha-latrotoxin receptor Short name=CIRL-3 | ||||
| Gene names |
| ||||
| Organism | Rattus norvegicus (Rat) [Reference proteome] | ||||
| Taxonomic identifier | 10116 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Rattus![]() |
Protein attributes
| Sequence length | 1550 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Subunit structure | Forms a heterodimer, consisting of a large extracellular region (p120) non-covalently linked to a seven-transmembrane moiety (p85) By similarity. |
| Subcellular location | Cell membrane; Multi-pass membrane protein Potential. |
| Tissue specificity | Predominantly expressed in brain, followed by heart, placenta, pancreas, kidney and testis. Ref.2 |
| Post-translational modification | Proteolytically cleaved into 2 subunits, an extracellular subunit and a seven-transmembrane subunit By similarity. |
| Sequence similarities | Belongs to the G-protein coupled receptor 2 family. LN-TM7 subfamily. Contains 1 GPS domain. Contains 1 olfactomedin-like domain. Contains 1 SUEL-type lectin domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell membrane Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Signal Transmembrane Transmembrane helix |
| Ligand | Lectin |
| Molecular function | G-protein coupled receptor Receptor Transducer |
| PTM | Disulfide bond Glycoprotein Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | neuropeptide signaling pathway Inferred from electronic annotation. Source: InterPro |
| Cellular_component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW plasma membraneInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | G-protein coupled receptor activity Inferred from electronic annotation. Source: UniProtKB-KW carbohydrate bindingInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 7 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9Z173-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9Z173-2) Also known as: CL3AA; The sequence of this isoform differs from the canonical sequence as follows: 19-86: Missing. 1131-1139: Missing. 1271-1284: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q9Z173-3) The sequence of this isoform differs from the canonical sequence as follows: 1131-1139: Missing. 1271-1284: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q9Z173-4) Also known as: CL3BB; The sequence of this isoform differs from the canonical sequence as follows: 1131-1139: Missing. 1271-1307: GSYLPCIQACVTYLEGLLNNARDTSVMDTLPLNGNHG → EPYRETSMGVKLNIAYQIGASEQCQGYKCHGYSTTEW 1308-1550: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 5 (identifier: Q9Z173-5) Also known as: CL3AB; The sequence of this isoform differs from the canonical sequence as follows: 19-86: Missing. 1131-1139: Missing. 1271-1307: GSYLPCIQACVTYLEGLLNNARDTSVMDTLPLNGNHG → EPYRETSMGVKLNIAYQIGASEQCQGYKCHGYSTTEW 1308-1550: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 6 (identifier: Q9Z173-6) Also known as: CL3BC; The sequence of this isoform differs from the canonical sequence as follows: 1131-1139: Missing. 1272-1350: SYLPCIQACV...LKELTSNYIP → TMANHLMSNA...KCHGYSTTEW 1351-1550: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 7 (identifier: Q9Z173-7) Also known as: CL3AC; The sequence of this isoform differs from the canonical sequence as follows: 19-86: Missing. 1131-1139: Missing. 1272-1350: SYLPCIQACV...LKELTSNYIP → TMANHLMSNA...KCHGYSTTEW 1351-1550: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 19 | 19 | Potential | ||||||||
| Chain | 20 – 1550 | 1531 | Latrophilin-3 | PRO_0000270141 | |||||||
Regions | |||||||||||
| Topological domain | 20 – 948 | 929 | Extracellular Potential | ||||||||
| Transmembrane | 949 – 969 | 21 | Helical; Name=1; Potential | ||||||||
| Topological domain | 970 – 977 | 8 | Cytoplasmic Potential | ||||||||
| Transmembrane | 978 – 998 | 21 | Helical; Name=2; Potential | ||||||||
| Topological domain | 999 – 1006 | 8 | Extracellular Potential | ||||||||
| Transmembrane | 1007 – 1027 | 21 | Helical; Name=3; Potential | ||||||||
| Topological domain | 1028 – 1048 | 21 | Cytoplasmic Potential | ||||||||
| Transmembrane | 1049 – 1069 | 21 | Helical; Name=4; Potential | ||||||||
| Topological domain | 1070 – 1087 | 18 | Extracellular Potential | ||||||||
| Transmembrane | 1088 – 1108 | 21 | Helical; Name=5; Potential | ||||||||
| Topological domain | 1109 – 1141 | 33 | Cytoplasmic Potential | ||||||||
| Transmembrane | 1142 – 1162 | 21 | Helical; Name=6; Potential | ||||||||
| Topological domain | 1163 – 1168 | 6 | Extracellular Potential | ||||||||
| Transmembrane | 1169 – 1189 | 21 | Helical; Name=7; Potential | ||||||||
| Topological domain | 1190 – 1550 | 361 | Cytoplasmic Potential | ||||||||
| Domain | 103 – 192 | 90 | SUEL-type lectin | ||||||||
| Domain | 202 – 461 | 260 | Olfactomedin-like | ||||||||
| Domain | 882 – 933 | 52 | GPS | ||||||||
| Compositional bias | 1483 – 1486 | 4 | Poly-Ala | ||||||||
Amino acid modifications | |||||||||||
| Modified residue | 1548 | 1 | Phosphothreonine By similarity | ||||||||
| Glycosylation | 161 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 532 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 616 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 839 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 884 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 910 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 999 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 1165 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 203 ↔ 385 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 19 – 86 | 68 | Missing in isoform 2, isoform 5 and isoform 7. | VSP_022127 | |||||||
| Alternative sequence | 1131 – 1139 | 9 | Missing in isoform 2, isoform 3, isoform 4, isoform 5, isoform 6 and isoform 7. | VSP_022128 | |||||||
| Alternative sequence | 1271 – 1307 | 37 | GSYLP…NGNHG → EPYRETSMGVKLNIAYQIGA SEQCQGYKCHGYSTTEW in isoform 4 and isoform 5. | VSP_022129 | |||||||
| Alternative sequence | 1271 – 1284 | 14 | Missing in isoform 2 and isoform 3. | VSP_022130 | |||||||
| Alternative sequence | 1272 – 1350 | 79 | SYLPC…SNYIP → TMANHLMSNALLRPHGTNNP YNTLLGEPAVCNNPSISMYN AQEPYRETSMGVKLNIAYQI GASEQCQGYKCHGYSTTEW in isoform 6 and isoform 7. | VSP_022131 | |||||||
| Alternative sequence | 1308 – 1550 | 243 | Missing in isoform 4 and isoform 5. | VSP_022132 | |||||||
| Alternative sequence | 1351 – 1550 | 200 | Missing in isoform 6 and isoform 7. | VSP_022133 | |||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| [1] | "Alpha-latrotoxin receptor CIRL/latrophilin 1 (CL1) defines an unusual family of ubiquitous G-protein-linked receptors. G-protein coupling not required for triggering exocytosis." Sugita S., Ichtchenko K., Khvotchev M., Suedhof T.C. J. Biol. Chem. 273:32715-32724(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2; 3; 4; 5; 6 AND 7). |
| [2] | "A novel ubiquitously expressed alpha-latrotoxin receptor is a member of the CIRL family of G-protein-coupled receptors." Ichtchenko K., Bittner M.A., Krasnoperov V., Little A.R., Chepurny O., Holz R.W., Petrenko A.G. J. Biol. Chem. 274:5491-5498(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF081154 mRNA. Translation: AAC62660.1. AF081155 mRNA. Translation: AAC62661.1. AF081156 mRNA. Translation: AAC62662.1. AF081157 mRNA. Translation: AAC62663.1. AF081158 mRNA. Translation: AAC62664.1. AF081159 mRNA. Translation: AAC62665.1. AF063103 mRNA. Translation: AAC77816.1. |
| IPI | IPI00208264. IPI00214226. IPI00561212. IPI00562968. IPI00817056. IPI00817103. IPI00817119. |
| PIR | T14327. T17186. T17187. T17188. T17198. T17199. T17200. |
| RefSeq | NP_570835.1. NM_130822.1. |
| UniGene | Rn.203386. |
3D structure databases | |
| ProteinModelPortal | Q9Z173. |
| SMR | Q9Z173. Positions 93-197. |
| ModBase | Search... |
Protein family/group databases | |
| MEROPS | S63.014. |
| GPCRDB | Search... |
PTM databases | |
| PhosphoSite | Q9Z173. |
Proteomic databases | |
| PaxDb | Q9Z173. |
| PRIDE | Q9Z173. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| GeneID | 170641. |
| KEGG | rno:170641. |
Organism-specific databases | |
| CTD | 23284. |
| RGD | 620836. Lphn3. |
Phylogenomic databases | |
| eggNOG | NOG253931. |
| HOVERGEN | HBG052337. |
| InParanoid | Q9Z173. |
| KO | K04594. |
Gene expression databases | |
| ArrayExpress | Q9Z173. |
| Genevestigator | Q9Z173. |
Family and domain databases | |
| InterPro | IPR022624. DUF3497. IPR017981. GPCR_2-like. IPR001879. GPCR_2_extracellular_dom. IPR003924. GPCR_2_latrophilin. IPR015630. GPCR_2_latrophilin3. IPR003334. GPCR_2_latrophilin_rcpt_C. IPR000832. GPCR_2_secretin-like. IPR017983. GPCR_2_secretin-like_CS. IPR000203. GPS_dom. IPR000922. Lectin_gal-bd_dom. IPR003112. Olfac-like. [Graphical view] |
| PANTHER | PTHR12011:SF60. PTHR12011:SF60. 1 hit. |
| Pfam | PF00002. 7tm_2. 1 hit. PF12003. DUF3497. 1 hit. PF02140. Gal_Lectin. 1 hit. PF01825. GPS. 1 hit. PF02793. HRM. 1 hit. PF02354. Latrophilin. 2 hits. PF02191. OLF. 1 hit. [Graphical view] |
| PRINTS | PR00249. GPCRSECRETIN. PR01444. LATROPHILIN. |
| SMART | SM00303. GPS. 1 hit. SM00284. OLF. 1 hit. [Graphical view] |
| PROSITE | PS00649. G_PROTEIN_RECEP_F2_1. False negative. PS00650. G_PROTEIN_RECEP_F2_2. 1 hit. PS50227. G_PROTEIN_RECEP_F2_3. 1 hit. PS50261. G_PROTEIN_RECEP_F2_4. 1 hit. PS50221. GPS. 1 hit. PS51132. OLF. 1 hit. PS50228. SUEL_LECTIN. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 621147. |
Entry information
| Entry name | LPHN3_RAT | ||||||||
| Accession | Primary (citable) accession number: Q9Z173 Secondary accession number(s): O88924 Q4LDM8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| 7-transmembrane G-linked receptors List of 7-transmembrane G-linked receptor entries |
| SIMILARITY comments Index of protein domains and families |

Clusters with
