SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9Z173

- LPHN3_RAT

UniProt

Q9Z173 - LPHN3_RAT

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Latrophilin-3

Gene
Lphn3, Cirl3, Cl3
Organism
Rattus norvegicus (Rat)
Status
Reviewed - Annotation score: 4 out of 5 - Experimental evidence at transcript leveli

Functioni

GO - Molecular functioni

  1. carbohydrate binding Source: InterPro
  2. G-protein coupled receptor activity Source: UniProtKB-KW

GO - Biological processi

  1. neuropeptide signaling pathway Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

G-protein coupled receptor, Receptor, Transducer

Keywords - Ligandi

Lectin

Protein family/group databases

MEROPSiS63.014.

Names & Taxonomyi

Protein namesi
Recommended name:
Latrophilin-3
Alternative name(s):
Calcium-independent alpha-latrotoxin receptor
Short name:
CIRL-3
Gene namesi
Name:Lphn3
Synonyms:Cirl3, Cl3
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
ProteomesiUP000002494: Unplaced

Organism-specific databases

RGDi620836. Lphn3.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini20 – 948929Extracellular Reviewed predictionAdd
BLAST
Transmembranei949 – 96921Helical; Name=1; Reviewed predictionAdd
BLAST
Topological domaini970 – 9778Cytoplasmic Reviewed prediction
Transmembranei978 – 99821Helical; Name=2; Reviewed predictionAdd
BLAST
Topological domaini999 – 10068Extracellular Reviewed prediction
Transmembranei1007 – 102721Helical; Name=3; Reviewed predictionAdd
BLAST
Topological domaini1028 – 104821Cytoplasmic Reviewed predictionAdd
BLAST
Transmembranei1049 – 106921Helical; Name=4; Reviewed predictionAdd
BLAST
Topological domaini1070 – 108718Extracellular Reviewed predictionAdd
BLAST
Transmembranei1088 – 110821Helical; Name=5; Reviewed predictionAdd
BLAST
Topological domaini1109 – 114133Cytoplasmic Reviewed predictionAdd
BLAST
Transmembranei1142 – 116221Helical; Name=6; Reviewed predictionAdd
BLAST
Topological domaini1163 – 11686Extracellular Reviewed prediction
Transmembranei1169 – 118921Helical; Name=7; Reviewed predictionAdd
BLAST
Topological domaini1190 – 1550361Cytoplasmic Reviewed predictionAdd
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
  2. plasma membrane Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 1919 Reviewed predictionAdd
BLAST
Chaini20 – 15501531Latrophilin-3PRO_0000270141Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi161 – 1611N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi203 ↔ 385 By similarity
Glycosylationi532 – 5321N-linked (GlcNAc...) Reviewed prediction
Glycosylationi616 – 6161N-linked (GlcNAc...) Reviewed prediction
Glycosylationi839 – 8391N-linked (GlcNAc...) Reviewed prediction
Glycosylationi884 – 8841N-linked (GlcNAc...) Reviewed prediction
Glycosylationi910 – 9101N-linked (GlcNAc...) Reviewed prediction
Glycosylationi999 – 9991N-linked (GlcNAc...) Reviewed prediction
Glycosylationi1165 – 11651N-linked (GlcNAc...) Reviewed prediction

Post-translational modificationi

Proteolytically cleaved into 2 subunits, an extracellular subunit and a seven-transmembrane subunit By similarity.

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ9Z173.
PRIDEiQ9Z173.

PTM databases

PhosphoSiteiQ9Z173.

Expressioni

Tissue specificityi

Predominantly expressed in brain, followed by heart, placenta, pancreas, kidney and testis.1 Publication

Gene expression databases

GenevestigatoriQ9Z173.

Interactioni

Subunit structurei

Forms a heterodimer, consisting of a large extracellular region (p120) non-covalently linked to a seven-transmembrane moiety (p85) By similarity.

Structurei

3D structure databases

ProteinModelPortaliQ9Z173.
SMRiQ9Z173. Positions 93-197.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini103 – 19290SUEL-type lectinAdd
BLAST
Domaini202 – 461260Olfactomedin-likeAdd
BLAST
Domaini882 – 93352GPSAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi1483 – 14864Poly-Ala

Sequence similaritiesi

Contains 1 GPS domain.

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG253931.
HOVERGENiHBG052337.
InParanoidiQ9Z173.
KOiK04594.
PhylomeDBiQ9Z173.

Family and domain databases

InterProiIPR022624. DUF3497.
IPR017981. GPCR_2-like.
IPR001879. GPCR_2_extracellular_dom.
IPR003924. GPCR_2_latrophilin.
IPR015630. GPCR_2_latrophilin3.
IPR003334. GPCR_2_latrophilin_rcpt_C.
IPR000832. GPCR_2_secretin-like.
IPR017983. GPCR_2_secretin-like_CS.
IPR000203. GPS.
IPR000922. Lectin_gal-bd_dom.
IPR003112. Olfac-like.
[Graphical view]
PANTHERiPTHR12011:SF60. PTHR12011:SF60. 1 hit.
PfamiPF00002. 7tm_2. 1 hit.
PF12003. DUF3497. 1 hit.
PF02140. Gal_Lectin. 1 hit.
PF01825. GPS. 1 hit.
PF02793. HRM. 1 hit.
PF02354. Latrophilin. 2 hits.
PF02191. OLF. 1 hit.
[Graphical view]
PRINTSiPR00249. GPCRSECRETIN.
PR01444. LATROPHILIN.
SMARTiSM00303. GPS. 1 hit.
SM00284. OLF. 1 hit.
[Graphical view]
PROSITEiPS00650. G_PROTEIN_RECEP_F2_2. 1 hit.
PS50227. G_PROTEIN_RECEP_F2_3. 1 hit.
PS50261. G_PROTEIN_RECEP_F2_4. 1 hit.
PS50221. GPS. 1 hit.
PS51132. OLF. 1 hit.
PS50228. SUEL_LECTIN. 1 hit.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 7 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9Z173-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MCPPQLFILM MLLAPVVHGG KHNERHPALA APLRHAEHSP GGPLPPRHLL     50
QQPAAERSTA HRGQGPRGTA RGVRGPGAPG AQIAAQAFSR APIPMAVVRR 100
ELSCESYPIE LRCPGTDVIM IESANYGRTD DKICDSDPAQ MENIRCYLPD 150
AYKIMSQRCN NRTQCAVVAG PDVFPDPCPG TYKYLEVQYE CVPYKVEQKV 200
FLCPGLLKGV YQSEHLFESD HQSGAWCKDP LQASDKIYYM PWTPYRTDTL 250
TEYSSKDDFI AGRPTTTYKL PHRVDGTGFV VYDGALFFNK ERTRNIVKFD 300
LRTRIKSGEA IIANANYHDT SPYRWGGKSD IDLAVDENGL WVIYATEQNN 350
GKIVISQLNP YTLRIEGTWD TAYDKRSASN AFMICGILYV VKSVYEDDDN 400
EATGNKIDYI YNTDQSKDSL VDVPFPNSYQ YIAAVDYNPR DNLLYVWNNY 450
HVVKYSLDFG PLDSRSGPVH HGQVSYISPP IHLDSDLERP PVRGISTTGP 500
LGMGSTTTST TLRTTTWNLG RSTTPSLPGR RNRSTSTPSP AIEVLDVTTH 550
LPSAASQIPA MEESCEAVEA REIMWFKTRQ GQVAKQSCPA GTIGVSTYLC 600
LAPDGIWDPQ GPDLSNCSSP WVNHITQKLK SGETAANIAR ELAEQTRNHL 650
NAGDITYSVR AMDQLVGLLD VQLRNLTPGG KDSAARSLNK LQKRERSCRA 700
YVQAMVETVN NLLQPQALNA WRDLTTSDQL RAATMLLDTV EESAFVLADN 750
LLKTDIVREN TDNIQLEVAR LSTEGNLEDL KFPENTGHGS TIQLSANTLK 800
QNGRNGEIRV AFVLYNNLGP YLSTENASMK LGTEAMSTNH SVIVNSPVIT 850
AAINKEFSNK VYLADPVVFT VKHIKQSEEN FNPNCSFWSY SKRTMTGYWS 900
TQGCRLLTTN KTHTTCSCNH LTNFAVLMAH VEVKHSDAVH DLLLDVITWV 950
GILLSLVCLL ICIFTFCFFR GLQSDRNTIH KNLCISLFVA ELLFLIGINR 1000
TDQPIACAVF AALLHFFFLA AFTWMFLEGV QLYIMLVEVF ESEHSRRKYF 1050
YLVGYGMPAL IVAVSAAVDY RSYGTDKVCW LRLDTYFIWS FIGPATLIIM 1100
LNVIFLGIAL YKMFHHTAIL KPESGCLDNI NYEDNRPFIK SWVIGAIALL 1150
CLLGLTWAFG LMYINESTVI MAYLFTIFNS LQGMFIFIFH CVLQKKVRKE 1200
YGKCLRTHCC SGKSTESSIG SGKTSGSRTP GRYSTGSQSR IRRMWNDTVR 1250
KQSESSFITG DINSSASLNR GSYLPCIQAC VTYLEGLLNN ARDTSVMDTL 1300
PLNGNHGNSY SIAGGEYLSN CVQIIDRGYN HNETALEKKI LKELTSNYIP 1350
SYLNNHERSS EQNRNMMNKL VDNLGSGSED DAIVLDDAAS FNHEESLGLE 1400
LIHEESDAPL LPPRVYSTDN HQPHHYSRRR LPQDHSESFF PLLTDEHTED 1450
PQSPHRDSLY TSMPALAGVP AADSVTTSTQ TEAAAAKGGD AEDVYYKSMP 1500
NLGSRNHVHP LHAYYQLGRG SSDGFIVPPN KDGASPEGTS KGPAHLVTSL 1550
Length:1,550
Mass (Da):172,442
Last modified:May 1, 1999 - v1
Checksum:iA2E8091B2B34DB36
GO
Isoform 2 (identifier: Q9Z173-2) [UniParc]FASTAAdd to Basket

Also known as: CL3AA

The sequence of this isoform differs from the canonical sequence as follows:
     19-86: Missing.
     1131-1139: Missing.
     1271-1284: Missing.

Note: No experimental confirmation available.

Show »
Length:1,459
Mass (Da):162,831
Checksum:iF083B7E81180E1A8
GO
Isoform 3 (identifier: Q9Z173-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1131-1139: Missing.
     1271-1284: Missing.

Note: No experimental confirmation available.

Show »
Length:1,527
Mass (Da):169,780
Checksum:iA0F1FFC2D9B50B9F
GO
Isoform 4 (identifier: Q9Z173-4) [UniParc]FASTAAdd to Basket

Also known as: CL3BB

The sequence of this isoform differs from the canonical sequence as follows:
     1131-1139: Missing.
     1271-1307: GSYLPCIQACVTYLEGLLNNARDTSVMDTLPLNGNHG → EPYRETSMGVKLNIAYQIGASEQCQGYKCHGYSTTEW
     1308-1550: Missing.

Note: No experimental confirmation available.

Show »
Length:1,298
Mass (Da):144,892
Checksum:i26C05A298C6B1A02
GO
Isoform 5 (identifier: Q9Z173-5) [UniParc]FASTAAdd to Basket

Also known as: CL3AB

The sequence of this isoform differs from the canonical sequence as follows:
     19-86: Missing.
     1131-1139: Missing.
     1271-1307: GSYLPCIQACVTYLEGLLNNARDTSVMDTLPLNGNHG → EPYRETSMGVKLNIAYQIGASEQCQGYKCHGYSTTEW
     1308-1550: Missing.

Note: No experimental confirmation available.

Show »
Length:1,230
Mass (Da):137,943
Checksum:i691DDCD1FE095C12
GO
Isoform 6 (identifier: Q9Z173-6) [UniParc]FASTAAdd to Basket

Also known as: CL3BC

The sequence of this isoform differs from the canonical sequence as follows:
     1131-1139: Missing.
     1272-1350: SYLPCIQACV...LKELTSNYIP → TMANHLMSNA...KCHGYSTTEW
     1351-1550: Missing.

Note: No experimental confirmation available.

Show »
Length:1,341
Mass (Da):149,502
Checksum:iF73C8CEB1B657008
GO
Isoform 7 (identifier: Q9Z173-7) [UniParc]FASTAAdd to Basket

Also known as: CL3AC

The sequence of this isoform differs from the canonical sequence as follows:
     19-86: Missing.
     1131-1139: Missing.
     1272-1350: SYLPCIQACV...LKELTSNYIP → TMANHLMSNA...KCHGYSTTEW
     1351-1550: Missing.

Note: No experimental confirmation available.

Show »
Length:1,273
Mass (Da):142,554
Checksum:iAE10D88D147CF078
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei19 – 8668Missing in isoform 2, isoform 5 and isoform 7. VSP_022127Add
BLAST
Alternative sequencei1131 – 11399Missing in isoform 2, isoform 3, isoform 4, isoform 5, isoform 6 and isoform 7. VSP_022128
Alternative sequencei1271 – 130737GSYLP…NGNHG → EPYRETSMGVKLNIAYQIGA SEQCQGYKCHGYSTTEW in isoform 4 and isoform 5. VSP_022129Add
BLAST
Alternative sequencei1271 – 128414Missing in isoform 2 and isoform 3. VSP_022130Add
BLAST
Alternative sequencei1272 – 135079SYLPC…SNYIP → TMANHLMSNALLRPHGTNNP YNTLLGEPAVCNNPSISMYN AQEPYRETSMGVKLNIAYQI GASEQCQGYKCHGYSTTEW in isoform 6 and isoform 7. VSP_022131Add
BLAST
Alternative sequencei1308 – 1550243Missing in isoform 4 and isoform 5. VSP_022132Add
BLAST
Alternative sequencei1351 – 1550200Missing in isoform 6 and isoform 7. VSP_022133Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF081154 mRNA. Translation: AAC62660.1.
AF081155 mRNA. Translation: AAC62661.1.
AF081156 mRNA. Translation: AAC62662.1.
AF081157 mRNA. Translation: AAC62663.1.
AF081158 mRNA. Translation: AAC62664.1.
AF081159 mRNA. Translation: AAC62665.1.
AF063103 mRNA. Translation: AAC77816.1.
PIRiT14327.
T17186.
T17187.
T17188.
T17198.
T17199.
T17200.
RefSeqiNP_570835.1. NM_130822.1. [Q9Z173-1]
UniGeneiRn.203386.

Genome annotation databases

GeneIDi170641.
KEGGirno:170641.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF081154 mRNA. Translation: AAC62660.1 .
AF081155 mRNA. Translation: AAC62661.1 .
AF081156 mRNA. Translation: AAC62662.1 .
AF081157 mRNA. Translation: AAC62663.1 .
AF081158 mRNA. Translation: AAC62664.1 .
AF081159 mRNA. Translation: AAC62665.1 .
AF063103 mRNA. Translation: AAC77816.1 .
PIRi T14327.
T17186.
T17187.
T17188.
T17198.
T17199.
T17200.
RefSeqi NP_570835.1. NM_130822.1. [Q9Z173-1 ]
UniGenei Rn.203386.

3D structure databases

ProteinModelPortali Q9Z173.
SMRi Q9Z173. Positions 93-197.
ModBasei Search...
MobiDBi Search...

Chemistry

GuidetoPHARMACOLOGYi 208.

Protein family/group databases

MEROPSi S63.014.
GPCRDBi Search...

PTM databases

PhosphoSitei Q9Z173.

Proteomic databases

PaxDbi Q9Z173.
PRIDEi Q9Z173.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

GeneIDi 170641.
KEGGi rno:170641.

Organism-specific databases

CTDi 23284.
RGDi 620836. Lphn3.

Phylogenomic databases

eggNOGi NOG253931.
HOVERGENi HBG052337.
InParanoidi Q9Z173.
KOi K04594.
PhylomeDBi Q9Z173.

Miscellaneous databases

NextBioi 621147.
PROi Q9Z173.

Gene expression databases

Genevestigatori Q9Z173.

Family and domain databases

InterProi IPR022624. DUF3497.
IPR017981. GPCR_2-like.
IPR001879. GPCR_2_extracellular_dom.
IPR003924. GPCR_2_latrophilin.
IPR015630. GPCR_2_latrophilin3.
IPR003334. GPCR_2_latrophilin_rcpt_C.
IPR000832. GPCR_2_secretin-like.
IPR017983. GPCR_2_secretin-like_CS.
IPR000203. GPS.
IPR000922. Lectin_gal-bd_dom.
IPR003112. Olfac-like.
[Graphical view ]
PANTHERi PTHR12011:SF60. PTHR12011:SF60. 1 hit.
Pfami PF00002. 7tm_2. 1 hit.
PF12003. DUF3497. 1 hit.
PF02140. Gal_Lectin. 1 hit.
PF01825. GPS. 1 hit.
PF02793. HRM. 1 hit.
PF02354. Latrophilin. 2 hits.
PF02191. OLF. 1 hit.
[Graphical view ]
PRINTSi PR00249. GPCRSECRETIN.
PR01444. LATROPHILIN.
SMARTi SM00303. GPS. 1 hit.
SM00284. OLF. 1 hit.
[Graphical view ]
PROSITEi PS00650. G_PROTEIN_RECEP_F2_2. 1 hit.
PS50227. G_PROTEIN_RECEP_F2_3. 1 hit.
PS50261. G_PROTEIN_RECEP_F2_4. 1 hit.
PS50221. GPS. 1 hit.
PS51132. OLF. 1 hit.
PS50228. SUEL_LECTIN. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Alpha-latrotoxin receptor CIRL/latrophilin 1 (CL1) defines an unusual family of ubiquitous G-protein-linked receptors. G-protein coupling not required for triggering exocytosis."
    Sugita S., Ichtchenko K., Khvotchev M., Suedhof T.C.
    J. Biol. Chem. 273:32715-32724(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2; 3; 4; 5; 6 AND 7).
  2. "A novel ubiquitously expressed alpha-latrotoxin receptor is a member of the CIRL family of G-protein-coupled receptors."
    Ichtchenko K., Bittner M.A., Krasnoperov V., Little A.R., Chepurny O., Holz R.W., Petrenko A.G.
    J. Biol. Chem. 274:5491-5498(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.

Entry informationi

Entry nameiLPHN3_RAT
AccessioniPrimary (citable) accession number: Q9Z173
Secondary accession number(s): O88924
, O88925, O88926, O88927, O88928, O88929, Q4LDM4, Q4LDM5, Q4LDM6, Q4LDM7, Q4LDM8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 9, 2007
Last sequence update: May 1, 1999
Last modified: May 14, 2014
This is version 88 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi