Q9Z0J5 (TRXR2_RAT) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 111.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Thioredoxin reductase 2, mitochondrial EC=1.8.1.9 Alternative name(s): Thioredoxin reductase TR3 | ||||
| Gene names |
| ||||
| Organism | Rattus norvegicus (Rat) [Reference proteome] | ||||
| Taxonomic identifier | 10116 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Rattus![]() |
Protein attributes
| Sequence length | 526 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Maintains mitochondrial thioredoxin in a reduced state. Implicated in the defenses against oxidative stress. May play a role in redox-regulated cell signaling. Ref.1 |
| Catalytic activity | Thioredoxin + NADP+ = thioredoxin disulfide + NADPH. Ref.1 |
| Cofactor | FAD. Ref.1 |
| Subunit structure | Homodimer. Ref.1 |
| Subcellular location | |
| Tissue specificity | Expressed in liver, kidney, adrenal gland and heart. Ref.1 |
| Miscellaneous | The active site is a redox-active disulfide bond. The selenocysteine residue is also essential for catalytic activity By similarity. Ref.1 |
| Sequence similarities | Belongs to the class-I pyridine nucleotide-disulfide oxidoreductase family. |
| Mass spectrometry | Isoform 1: Molecular mass is 53037±2 Da from positions 37 - 526. Determined by ESI. Ref.1 |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9Z0J5-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9Z0J5-2) The sequence of this isoform differs from the canonical sequence as follows: 1-38: MAAIVAALRGSSGRFRPQTRVLTRGTRGAAGAASAAGG → MEG |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Transit peptide | 1 – 36 | 36 | Mitochondrion Ref.1 | ||||||||
| Chain | 37 – 526 | 490 | Thioredoxin reductase 2, mitochondrial Ref.1 | PRO_0000030290 | |||||||
Regions | |||||||||||
| Nucleotide binding | 43 – 72 | 30 | FAD By similarity | ||||||||
Sites | |||||||||||
| Active site | 499 | 1 | Proton acceptor By similarity | ||||||||
Amino acid modifications | |||||||||||
| Non-standard residue | 525 | 1 | Selenocysteine | ||||||||
| Disulfide bond | 88 ↔ 93 | Redox-active By similarity UniProtKB P00390 | |||||||||
| Cross-link | 524 ↔ 525 | Cysteinyl-selenocysteine (Cys-Sec) By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 – 38 | 38 | MAAIV…SAAGG → MEG in isoform 2. | VSP_008307 | |||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning and characterization of a mitochondrial selenocysteine-containing thioredoxin reductase from rat liver." Lee S.-R., Kim J.-R., Kwon K.-S., Yoon H.W., Levine R.L., Ginsburg A., Rhee S.G. J. Biol. Chem. 274:4722-4734(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PROTEIN SEQUENCE OF 37-55; 206-217; 343-362 AND 515-526, SELENOCYSTEINE AT SEC-525, FUNCTION, CATALYTIC ACTIVITY, MASS SPECTROMETRY, COFACTOR, SUBUNIT, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. Strain: Sprague-Dawley. Tissue: Liver. |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Heart. |
| [3] | "Heterogeneity within animal thioredoxin reductases: evidence for alternative first exon splicing." Sun Q.-A., Zappacosta F., Factor V.M., Wirth P.J., Hatfield D.L., Gladyshev V.N. J. Biol. Chem. 276:3106-3114(2001) [PubMed] [Europe PMC] [Abstract] Cited for: ALTERNATIVE SPLICING (ISOFORMS 1 AND 2). |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF072865 mRNA. Translation: AAD13801.1. BC085734 mRNA. Translation: AAH85734.1. |
| IPI | IPI00196118. IPI00476563. |
| RefSeq | NP_072106.1. NM_022584.2. |
| UniGene | Rn.6300. |
3D structure databases | |
| ProteinModelPortal | Q9Z0J5. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 10116.ENSRNOP00000002593. |
Proteomic databases | |
| PaxDb | Q9Z0J5. |
| PRIDE | Q9Z0J5. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| GeneID | 50551. |
| KEGG | rno:50551. |
Organism-specific databases | |
| CTD | 10587. |
| RGD | 61960. Txnrd2. |
Phylogenomic databases | |
| eggNOG | COG1249. |
| HOGENOM | HOG000276712. |
| HOVERGEN | HBG004959. |
| InParanoid | Q9Z0J5. |
| KO | K00384. |
| OMA | VMRTVGI. |
| OrthoDB | EOG408N7T. |
Gene expression databases | |
| ArrayExpress | Q9Z0J5. |
| Genevestigator | Q9Z0J5. |
Family and domain databases | |
| Gene3D | 3.30.390.30. 1 hit. |
| InterPro | IPR016156. FAD/NAD-linked_Rdtase_dimer. IPR013027. FAD_pyr_nucl-diS_OxRdtase. IPR004099. Pyr_nucl-diS_OxRdtase_dimer. IPR023753. Pyr_nucl-diS_OxRdtase_FAD/NAD. IPR012999. Pyr_OxRdtase_I_AS. IPR001327. Pyr_OxRdtase_NAD-bd_dom. IPR006338. Thioredoxin/glutathione_Rdtase. [Graphical view] |
| PANTHER | PTHR22912:SF23. PTHR22912:SF23. 1 hit. |
| Pfam | PF00070. Pyr_redox. 1 hit. PF07992. Pyr_redox_2. 1 hit. PF02852. Pyr_redox_dim. 1 hit. [Graphical view] |
| PRINTS | PR00368. FADPNR. |
| SUPFAM | SSF55424. FAD/NAD-linked_reductase_dimer. 1 hit. |
| TIGRFAMs | TIGR01438. TGR. 1 hit. |
| PROSITE | PS00076. PYRIDINE_REDOX_1. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| BindingDB | Q9Z0J5. |
| ChEMBL | CHEMBL5086. |
| NextBio | 610344. |
Entry information
| Entry name | TRXR2_RAT | ||||||||
| Accession | Primary (citable) accession number: Q9Z0J5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| SIMILARITY comments Index of protein domains and families |

Clusters with
