Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9Z0J5 (TRXR2_RAT) Reviewed, UniProtKB/Swiss-Prot

Last modified June 11, 2014. Version 120. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (1) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Thioredoxin reductase 2, mitochondrial

EC=1.8.1.9
Alternative name(s):
Thioredoxin reductase TR3
Gene names
Name:Txnrd2
Synonyms:Trxr2
OrganismRattus norvegicus (Rat) [Reference proteome]
Taxonomic identifier10116 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus

Protein attributes

Sequence length526 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Maintains mitochondrial thioredoxin in a reduced state. Implicated in the defenses against oxidative stress. May play a role in redox-regulated cell signaling. Ref.1

Catalytic activity

Thioredoxin + NADP+ = thioredoxin disulfide + NADPH. Ref.1

Cofactor

FAD. Ref.1

Subunit structure

Homodimer. Ref.1

Subcellular location

Mitochondrion Ref.1.

Tissue specificity

Expressed in liver, kidney, adrenal gland and heart. Ref.1

Miscellaneous

The active site is a redox-active disulfide bond. The selenocysteine residue is also essential for catalytic activity By similarity. Ref.1

Sequence similarities

Belongs to the class-I pyridine nucleotide-disulfide oxidoreductase family.

Mass spectrometry

Isoform 1: Molecular mass is 53037±2 Da from positions 37 - 526. Determined by ESI. Ref.1

Ontologies

Keywords
   Cellular componentMitochondrion
   Coding sequence diversityAlternative splicing
Selenocysteine
   DomainRedox-active center
Transit peptide
   LigandFAD
Flavoprotein
NADP
   Molecular functionOxidoreductase
   PTMDisulfide bond
   Technical termComplete proteome
Direct protein sequencing
Reference proteome
Gene Ontology (GO)
   Biological_processcell redox homeostasis

Inferred from electronic annotation. Source: InterPro

response to drug

Inferred from expression pattern PubMed 18790005. Source: RGD

response to hydrogen peroxide

Traceable author statement Ref.1. Source: RGD

response to hyperoxia

Inferred from expression pattern PubMed 20493230. Source: RGD

response to oxygen radical

Traceable author statement Ref.1. Source: UniProtKB

response to selenium ion

Inferred from expression pattern PubMed 15792362. Source: RGD

   Cellular_componentaxon

Inferred from direct assay PubMed 20620191. Source: RGD

cytoplasm

Inferred from direct assay PubMed 20620191. Source: RGD

dendrite

Inferred from direct assay PubMed 20620191. Source: RGD

mitochondrion

Inferred from direct assay Ref.1. Source: UniProtKB

neuronal cell body

Inferred from direct assay PubMed 20620191. Source: RGD

   Molecular_functionNADP binding

Inferred from electronic annotation. Source: InterPro

flavin adenine dinucleotide binding

Inferred from electronic annotation. Source: InterPro

protein dimerization activity

Traceable author statement Ref.1. Source: RGD

protein homodimerization activity

Inferred from direct assay Ref.1. Source: UniProtKB

thioredoxin-disulfide reductase activity

Inferred from direct assay Ref.1. Source: UniProtKB

Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9Z0J5-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9Z0J5-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-38: MAAIVAALRGSSGRFRPQTRVLTRGTRGAAGAASAAGG → MEG

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Transit peptide1 – 3636Mitochondrion Ref.1
Chain37 – 526490Thioredoxin reductase 2, mitochondrial Ref.1
PRO_0000030290

Regions

Nucleotide binding43 – 7230FAD By similarity

Sites

Active site4991Proton acceptor By similarity

Amino acid modifications

Non-standard residue5251Selenocysteine
Modified residue811N6-succinyllysine By similarity
Modified residue1771N6-succinyllysine By similarity
Modified residue3311N6-succinyllysine By similarity
Disulfide bond88 ↔ 93Redox-active By similarity UniProtKB P00390
Cross-link524 ↔ 525Cysteinyl-selenocysteine (Cys-Sec) By similarity

Natural variations

Alternative sequence1 – 3838MAAIV…SAAGG → MEG in isoform 2.
VSP_008307

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified February 26, 2008. Version 3.
Checksum: ADEEBAD54BE6F241

FASTA52656,575
        10         20         30         40         50         60 
MAAIVAALRG SSGRFRPQTR VLTRGTRGAA GAASAAGGQQ NFDLLVIGGG SGGLACAKEA 

        70         80         90        100        110        120 
AQLGRKVAVA DYVEPSPRGT KWGLGGTCVN VGCIPKKLMH QAALLGGMIR DAQHYGWEVA 

       130        140        150        160        170        180 
QPVQHNWKAM AEAVQNHVKS LNWGHRVQLQ DRKVKYFNIK ASFVNEHTVH GVDKAGKVTQ 

       190        200        210        220        230        240 
LSAKHIVIAT GGRPKYPTQV KGALEHGITS DDIFWLKESP GKTLVVGASY VALECAGFLT 

       250        260        270        280        290        300 
GIGLDTTVMM RSVPLRGFDQ QMASLVTEHM ESHGTRFLKG CVPSLIRKLP TNQLQVTWED 

       310        320        330        340        350        360 
LASGKEDVGT FDTVLWAIGR VPETRNLNLE KAGVNTNPKN QKIIVDAQEA TSVPHIYAIG 

       370        380        390        400        410        420 
DVAEGRPELT PTAIKAGKLL AQRLFGKSST LMNYSNVPTT VFTPLEYGCV GLSEEEAVAL 

       430        440        450        460        470        480 
HGQEHIEVYH AYYKPLEFTV ADRDASQCYI KMVCMREPPQ LVLGLHFLGP NAGEVTQGFA 

       490        500        510        520 
LGIQCGASYA QVMQTVGIHP TCSEEVVKLH ISKRSGLDPT VTGCUG 

« Hide

Isoform 2 [UniParc].

Checksum: 2700A49416B63831
Show »

FASTA49153,239

References

« Hide 'large scale' references
[1]"Molecular cloning and characterization of a mitochondrial selenocysteine-containing thioredoxin reductase from rat liver."
Lee S.-R., Kim J.-R., Kwon K.-S., Yoon H.W., Levine R.L., Ginsburg A., Rhee S.G.
J. Biol. Chem. 274:4722-4734(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PROTEIN SEQUENCE OF 37-55; 206-217; 343-362 AND 515-526, SELENOCYSTEINE AT SEC-525, FUNCTION, CATALYTIC ACTIVITY, MASS SPECTROMETRY, COFACTOR, SUBUNIT, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
Strain: Sprague-Dawley.
Tissue: Liver.
[2]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Heart.
[3]"Heterogeneity within animal thioredoxin reductases: evidence for alternative first exon splicing."
Sun Q.-A., Zappacosta F., Factor V.M., Wirth P.J., Hatfield D.L., Gladyshev V.N.
J. Biol. Chem. 276:3106-3114(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: ALTERNATIVE SPLICING (ISOFORMS 1 AND 2).
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF072865 mRNA. Translation: AAD13801.1.
BC085734 mRNA. Translation: AAH85734.1.
RefSeqNP_072106.1. NM_022584.2. [Q9Z0J5-1]
UniGeneRn.6300.

3D structure databases

ProteinModelPortalQ9Z0J5.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

STRING10116.ENSRNOP00000002593.

Chemistry

BindingDBQ9Z0J5.
ChEMBLCHEMBL5086.

Proteomic databases

PaxDbQ9Z0J5.
PRIDEQ9Z0J5.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

GeneID50551.
KEGGrno:50551.

Organism-specific databases

CTD10587.
RGD61960. Txnrd2.

Phylogenomic databases

eggNOGCOG1249.
HOGENOMHOG000276712.
HOVERGENHBG004959.
InParanoidQ9Z0J5.
KOK00384.
PhylomeDBQ9Z0J5.

Gene expression databases

GenevestigatorQ9Z0J5.

Family and domain databases

Gene3D3.30.390.30. 1 hit.
InterProIPR016156. FAD/NAD-linked_Rdtase_dimer.
IPR013027. FAD_pyr_nucl-diS_OxRdtase.
IPR004099. Pyr_nucl-diS_OxRdtase_dimer.
IPR023753. Pyr_nucl-diS_OxRdtase_FAD/NAD.
IPR012999. Pyr_OxRdtase_I_AS.
IPR001327. Pyr_OxRdtase_NAD-bd_dom.
IPR006338. Thioredoxin/glutathione_Rdtase.
[Graphical view]
PfamPF00070. Pyr_redox. 1 hit.
PF07992. Pyr_redox_2. 1 hit.
PF02852. Pyr_redox_dim. 1 hit.
[Graphical view]
PRINTSPR00368. FADPNR.
SUPFAMSSF55424. SSF55424. 1 hit.
TIGRFAMsTIGR01438. TGR. 1 hit.
PROSITEPS00076. PYRIDINE_REDOX_1. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

NextBio610344.
PROQ9Z0J5.

Entry information

Entry nameTRXR2_RAT
AccessionPrimary (citable) accession number: Q9Z0J5
Entry history
Integrated into UniProtKB/Swiss-Prot: September 19, 2003
Last sequence update: February 26, 2008
Last modified: June 11, 2014
This is version 120 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families