Q9Z0J4 (NOS1_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 133.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Nitric oxide synthase, brain EC=1.14.13.39 Alternative name(s): Constitutive NOS NC-NOS NOS type I Neuronal NOS Short name=N-NOS Short name=nNOS Peptidyl-cysteine S-nitrosylase NOS1 bNOS | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 1429 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Produces nitric oxide (NO) which is a messenger molecule with diverse functions throughout the body. In the brain and peripheral nervous system, NO displays many properties of a neurotransmitter. Probably has nitrosylase activity and mediates cysteine S-nitrosylation of cytoplasmic target proteins such SRR. Isoform NNOS Mu may be an effector enzyme for the dystrophin complex. Ref.8 |
| Catalytic activity | 2 L-arginine + 3 NADPH + 4 O2 = 2 L-citrulline + 2 nitric oxide + 3 NADP+ + 4 H2O. |
| Cofactor | Heme group By similarity. Binds 1 FAD By similarity. Binds 1 FMN By similarity. Tetrahydrobiopterin (BH4). May stabilize the dimeric form of the enzyme By similarity. |
| Enzyme regulation | Stimulated by calcium/calmodulin. Inhibited by n-Nos-inhibiting protein (PIN) which may prevent the dimerization of the protein. Inhibited by NOSIP By similarity. |
| Subunit structure | Homodimer. Forms a ternary complex with CAPON and SYN1. Interacts with ZDHHC23. Interacts with NOSIP; which may impair its synaptic location By similarity. Interacts with DLG4; the interaction possibly being prevented by the association between NOS1 and CAPON. Interacts with HTR4. Forms a ternary complex with CAPON and RASD1. Interacts with VAC14 By similarity. Interacts with SLC6A4. Ref.5 Ref.6 Ref.7 Ref.9 |
| Subcellular location | Cell membrane › sarcolemma; Peripheral membrane protein. Cell projection › dendritic spine By similarity. Note: In skeletal muscle, it is localized beneath the sarcolemma of fast-twitch muscle fiber by associating with the dystrophin glycoprotein complex. In neurons, enriched in dendritic spines By similarity. |
| Tissue specificity | Widely expressed in the nervous system: expressed in cerebrum, olfactory bulb, hippocampus, midbrain, cerebellum, pons, medulla oblongata, and spinal cord. Also found in skeletal muscle, where it is localized beneath the sarcolemma of fast twitch muscle fibers, and in spleen, heart, kidney, and liver. N-NOS-1 and N-NOS-2 are found in all parts of the nervous system. NNOS beta and gamma occur in a region-specific manner in the brain and NNOS beta expression is developmentally regulated. NNOS Mu is only found in mature skeletal and cardiac muscles. |
| Induction | By cholinergic agonists acting at inositol phosphate-linked muscarinic receptors in cardiac myocytes. |
| Domain | The PDZ domain in the N-terminal part of the neuronal isoform participates in protein-protein interaction, and is responsible for targeting nNos to synaptic membranes in muscles. Mediates interaction with VAC14 By similarity. |
| Post-translational modification | Ubiquitinated; mediated by STUB1/CHIP in the presence of Hsp70 and Hsp40 (in vitro) By similarity. |
| Involvement in disease | In MDX mice (mouse model of dystrophinopathy) the dystrophin complex is disrupted and nNOS is displaced from sarcolemma and accumulates in the cytosol. |
| Sequence similarities | Belongs to the NOS family. Contains 1 FAD-binding FR-type domain. Contains 1 flavodoxin-like domain. Contains 1 PDZ (DHR) domain. |
Ontologies
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform N-NOS-1 (identifier: Q9Z0J4-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform N-NOS-2 (identifier: Q9Z0J4-2) The sequence of this isoform differs from the canonical sequence as follows: 504-608: Missing. | ||||||
| Isoform NNOS beta (identifier: Q9Z0J4-3) The sequence of this isoform differs from the canonical sequence as follows: 1-230: Missing. 231-236: TGIQVD → MRGLGS | ||||||
| Isoform NNOS gamma (identifier: Q9Z0J4-4) The sequence of this isoform differs from the canonical sequence as follows: 1-331: Missing. | ||||||
| Isoform NNOS Mu (identifier: Q9Z0J4-5) Also known as: Muscle-specific; The sequence of this isoform differs from the canonical sequence as follows: 839-839: K → KYPEPLRFFPRKGPSLSHVDSEAHSLVAARDSQHR |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1429 | 1429 | Nitric oxide synthase, brain | PRO_0000170922 | |||||||
Regions | |||||||||||
| Domain | 17 – 99 | 83 | PDZ | ||||||||
| Domain | 755 – 935 | 181 | Flavodoxin-like | ||||||||
| Domain | 990 – 1237 | 248 | FAD-binding FR-type | ||||||||
| Nucleotide binding | 881 – 912 | 32 | FMN By similarity | ||||||||
| Nucleotide binding | 1027 – 1038 | 12 | FAD By similarity | ||||||||
| Nucleotide binding | 1170 – 1180 | 11 | FAD By similarity | ||||||||
| Nucleotide binding | 1245 – 1263 | 19 | NADP By similarity | ||||||||
| Nucleotide binding | 1343 – 1358 | 16 | NADP By similarity | ||||||||
| Region | 1 – 200 | 200 | Interaction with NOSIP By similarity | ||||||||
| Region | 163 – 240 | 78 | PIN (nNOS-inhibiting protein) binding By similarity | ||||||||
| Region | 725 – 745 | 21 | Calmodulin-binding | ||||||||
| Region | 750 – 769 | 20 | Tetrahydrobiopterin-binding By similarity | ||||||||
Sites | |||||||||||
| Metal binding | 415 | 1 | Iron (heme axial ligand) By similarity | ||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 – 331 | 331 | Missing in isoform NNOS gamma. | VSP_003577 | |||||||
| Alternative sequence | 1 – 230 | 230 | Missing in isoform NNOS beta. | VSP_003575 | |||||||
| Alternative sequence | 231 – 236 | 6 | TGIQVD → MRGLGS in isoform NNOS beta. | VSP_003576 | |||||||
| Alternative sequence | 504 – 608 | 105 | Missing in isoform N-NOS-2. | VSP_003578 | |||||||
| Alternative sequence | 839 | 1 | K → KYPEPLRFFPRKGPSLSHVD SEAHSLVAARDSQHR in isoform NNOS Mu. | VSP_003579 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 1320 | 1 | K → Q in BAE24878. Ref.3 | ||||||||
Secondary structure | |||||||||||
Helix Strand Turn | |||||||||||
| Helix | 731 – 744 | 14 | |||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Structural diversity of neuronal oxide synthase mRNA in the nervous system." Ogura T., Yokoyama T., Fujisawa H., Kurashima Y., Esumi H. Biochem. Biophys. Res. Commun. 193:1014-1022(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS N-NOS-1 AND N-NOS-2). Strain: BALB/c. Tissue: Brain. |
| [2] | "Neuronal nitric-oxide synthase-mu, an alternatively spliced isoform expressed in differentiated skeletal muscle." Silvagno F., Xia H., Bredt D.S. J. Biol. Chem. 271:11204-11208(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM NNOS MU). Tissue: Skeletal muscle. |
| [3] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1320-1429. Strain: C57BL/6J. Tissue: Spinal ganglion. |
| [4] | "Regulation of neuronal nitric oxide synthase through alternative transcripts." Brenman J.E., Xia H., Chao D.S., Black S.M., Bredt D.S. Dev. Neurosci. 19:224-231(1997) [PubMed] [Europe PMC] [Abstract] Cited for: ALTERNATIVE SPLICING (ISOFORMS NNOS BETA; NNOS GAMMA AND NNOS MU). |
| [5] | "Solution structure and backbone dynamics of the second PDZ domain of postsynaptic density-95." Tochio H., Hung F., Li M., Bredt D.S., Zhang M. J. Mol. Biol. 295:225-237(2000) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH DLG4. |
| [6] | "Dexras1: a G protein specifically coupled to neuronal nitric oxide synthase via CAPON." Fang M., Jaffrey S.R., Sawa A., Ye K., Luo X., Snyder S.H. Neuron 28:183-193(2000) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH RASD1 AND CAPON. |
| [7] | "New sorting nexin (SNX27) and NHERF specifically interact with the 5-HT4a receptor splice variant: roles in receptor targeting." Joubert L., Hanson B., Barthet G., Sebben M., Claeysen S., Hong W., Marin P., Dumuis A., Bockaert J. J. Cell Sci. 117:5367-5379(2004) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH HTR4. |
| [8] | "Nitric oxide S-nitrosylates serine racemase, mediating feedback inhibition of D-serine formation." Mustafa A.K., Kumar M., Selvakumar B., Ho G.P., Ehmsen J.T., Barrow R.K., Amzel L.M., Snyder S.H. Proc. Natl. Acad. Sci. U.S.A. 104:2950-2955(2007) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION AS NITROSYLASE. |
| [9] | "Physical interaction between the serotonin transporter and neuronal nitric oxide synthase underlies reciprocal modulation of their activity." Chanrion B., Mannoury la Cour C., Bertaso F., Lerner-Natoli M., Freissmuth M., Millan M.J., Bockaert J., Marin P. Proc. Natl. Acad. Sci. U.S.A. 104:8119-8124(2007) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH SLC6A4. |
| [10] | "Crystal structure of calmodulin-neuronal nitric oxide synthase complex." Valentine K.G., Ng H.L., Schneeweis L., Kranz J.K., Frederick K.K., Alber T., Wand A.J. Submitted (DEC-2006) to the PDB data bank Cited for: X-RAY CRYSTALLOGRAPHY (1.55 ANGSTROMS) OF 725-747 IN COMPLEX WITH CALMODULIN. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | D14552 mRNA. Translation: BAA03415.1. S81982 mRNA. Translation: AAB36469.1. AK141904 mRNA. Translation: BAE24878.1. | ||||||||||||
| IPI | IPI00129191. IPI00229026. IPI00229027. IPI00229030. IPI00309243. | ||||||||||||
| PIR | JN0609. | ||||||||||||
| RefSeq | NP_032738.1. NM_008712.2. | ||||||||||||
| UniGene | Mm.442195. Mm.44249. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q9Z0J4. | ||||||||||||
| SMR | Q9Z0J4. Positions 12-126, 298-716, 750-1413. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| DIP | DIP-31556N. | ||||||||||||
| IntAct | Q9Z0J4. 3 interactions. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q9Z0J4. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | Q9Z0J4. | ||||||||||||
| PRIDE | Q9Z0J4. | ||||||||||||
Protocols and materials databases | |||||||||||||
| DNASU | 18125. | ||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENSMUST00000142742; ENSMUSP00000120421; ENSMUSG00000029361. ENSMUST00000171055; ENSMUSP00000127432; ENSMUSG00000029361. | ||||||||||||
| GeneID | 18125. | ||||||||||||
| KEGG | mmu:18125. | ||||||||||||
| UCSC | uc008zfy.1. mouse. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 4842. | ||||||||||||
| MGI | MGI:97360. Nos1. | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | COG4362. | ||||||||||||
| GeneTree | ENSGT00620000087711. | ||||||||||||
| HOGENOM | HOG000220884. | ||||||||||||
| HOVERGEN | HBG000159. | ||||||||||||
| InParanoid | Q3UR10. | ||||||||||||
| KO | K13240. | ||||||||||||
| OrthoDB | EOG4MKNFC. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q9Z0J4. | ||||||||||||
| Bgee | Q9Z0J4. | ||||||||||||
| CleanEx | MM_NOS1. | ||||||||||||
| Genevestigator | Q9Z0J4. | ||||||||||||
| GermOnline | ENSMUSG00000029361. Mus musculus. | ||||||||||||
Family and domain databases | |||||||||||||
| Gene3D | 1.20.990.10. 1 hit. 3.90.340.10. 1 hit. | ||||||||||||
| InterPro | IPR003097. FAD-binding_1. IPR017927. Fd_Rdtase_FAD-bd. IPR001094. Flavdoxin. IPR008254. Flavodoxin/NO_synth. IPR001709. Flavoprot_Pyr_Nucl_cyt_Rdtase. IPR023173. NADPH_Cyt_P450_Rdtase_dom3. IPR004030. NO_synthase_oxygenase_dom. IPR026009. NOS. IPR012144. NOS_met. IPR001433. OxRdtase_FAD/NAD-bd. IPR001478. PDZ. IPR017938. Riboflavin_synthase-like_b-brl. [Graphical view] | ||||||||||||
| PANTHER | PTHR19384:SF5. PTHR19384:SF5. 1 hit. | ||||||||||||
| Pfam | PF00667. FAD_binding_1. 1 hit. PF00258. Flavodoxin_1. 1 hit. PF00175. NAD_binding_1. 1 hit. PF02898. NO_synthase. 1 hit. PF00595. PDZ. 1 hit. [Graphical view] | ||||||||||||
| PIRSF | PIRSF000333. NOS. 1 hit. | ||||||||||||
| PRINTS | PR00369. FLAVODOXIN. PR00371. FPNCR. | ||||||||||||
| SMART | SM00228. PDZ. 1 hit. [Graphical view] | ||||||||||||
| SUPFAM | SSF56512. NO_synthase_oxygenase_reg. 1 hit. SSF50156. PDZ. 1 hit. SSF63380. Riboflavin_synthase_like_b-brl. 1 hit. | ||||||||||||
| PROSITE | PS51384. FAD_FR. 1 hit. PS50902. FLAVODOXIN_LIKE. 1 hit. PS60001. NOS. 1 hit. PS50106. PDZ. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| BindingDB | Q9Z0J4. | ||||||||||||
| ChEMBL | CHEMBL4719. | ||||||||||||
| EvolutionaryTrace | Q9Z0J4. | ||||||||||||
| NextBio | 293344. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | NOS1_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q9Z0J4 Secondary accession number(s): Q3UR10, Q64208 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
