Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

WAS/WASL-interacting protein family member 3

Gene

Wipf3

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May have a role in spermatogenesis (By similarity). May be a regulator of cytoskeletal organization.By similarity1 Publication

GO - Molecular functioni

  • actin filament binding Source: GO_Central
  • SH3 domain binding Source: RGD

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Biological processi

Differentiation, Spermatogenesis

Keywords - Ligandi

Actin-binding

Enzyme and pathway databases

ReactomeiR-RNO-2029482. Regulation of actin dynamics for phagocytic cup formation.
R-RNO-5663213. RHO GTPases Activate WASPs and WAVEs.

Names & Taxonomyi

Protein namesi
Recommended name:
WAS/WASL-interacting protein family member 3
Alternative name(s):
Corticosteroids and regional expression protein 16
Gene namesi
Name:Wipf3
Synonyms:Cr16
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Chromosome 4

Organism-specific databases

RGDi708559. Wipf3.

Subcellular locationi

  • Cytoplasm 1 Publication

  • Note: In hippocampal neurons colocalizes with WASL in the cell body, axons and the growth cone.

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi58 – 614RLRK → AAAA: Does not abolish the ability to suppress the growth defect of yeast lacking VRP1. 1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 485485WAS/WASL-interacting protein family member 3PRO_0000337999Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei150 – 1501PhosphoserineCombined sources
Modified residuei208 – 2081PhosphoserineBy similarity
Modified residuei394 – 3941PhosphoserineBy similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ9Z0G8.
PRIDEiQ9Z0G8.

PTM databases

iPTMnetiQ9Z0G8.
PhosphoSiteiQ9Z0G8.

Expressioni

Tissue specificityi

Detected mainly in brain and at lower levels in heart and lung (at protein level). Also detected in testis but not in kidney, liver or spleen.2 Publications

Inductioni

By aldosterone, corticosterone and RU28362 in hyppocampus. By corticosterone and RU28362 in cortex. The response to corticosterone is slow. Does not respond to vibratory stress. May be regulated by both the mineralocorticoid receptor and glucocorticoid receptor.2 Publications

Gene expression databases

BgeeiENSRNOG00000009571.
ExpressionAtlasiQ9Z0G8. baseline and differential.
GenevisibleiQ9Z0G8. RN.

Interactioni

Subunit structurei

Isoform 1 interacts with WASL (via WH1 domain), and monomeric and filamentous actin.1 Publication

GO - Molecular functioni

  • actin filament binding Source: GO_Central
  • SH3 domain binding Source: RGD

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000012747.

Structurei

3D structure databases

ProteinModelPortaliQ9Z0G8.
SMRiQ9Z0G8. Positions 43-74.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini45 – 6218WH2PROSITE-ProRule annotationAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi3 – 86Profilin-binding motif
Motifi11 – 166Profilin-binding motif
Motifi20 – 256Profilin-binding motif
Motifi58 – 614RLRK
Motifi426 – 45025WASP-binding motifAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi173 – 1786Poly-Pro
Compositional biasi181 – 19818Poly-ProAdd
BLAST
Compositional biasi229 – 24315Poly-ProAdd
BLAST
Compositional biasi293 – 31220Poly-ProAdd
BLAST
Compositional biasi325 – 3317Poly-Pro

Domaini

The WH2 domain is found in a number of putative actin-binding proteins.1 Publication
The profilin-binding motif has been implicated in the interaction with profilin and SH3 domains.1 Publication
The KLKR motif is essential for G-actin binding and for actin polymerization.1 Publication

Sequence similaritiesi

Belongs to the verprolin family.Curated
Contains 1 WH2 domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiENOG410J09R. Eukaryota.
ENOG410Y0AH. LUCA.
GeneTreeiENSGT00840000129980.
HOGENOMiHOG000090003.
InParanoidiQ9Z0G8.
KOiK19475.
OMAiLRNGGQH.
OrthoDBiEOG091G0GSL.
PhylomeDBiQ9Z0G8.

Family and domain databases

InterProiIPR003124. WH2_dom.
[Graphical view]
PfamiPF02205. WH2. 1 hit.
[Graphical view]
SMARTiSM00246. WH2. 1 hit.
[Graphical view]
PROSITEiPS51082. WH2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9Z0G8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPVPPPPPPP LPPPPPPLGA PPPPPPPGPP ISTDAPSLRK SDLKGRSALL
60 70 80 90 100
ADIQQGTRLR KVTQINDRSA PQIESSKGTS KEGGAAGSNA RGGSTPPALG
110 120 130 140 150
DLFAGGFPVL RPAGQRDVAG GKTGQGPGSR APSPRLPTKA ISGPLPAPAS
160 170 180 190 200
PRLGNASDTH SSARPVPPRP SVPAPPPPTT PPPPPPPPPP PPPPPLPPAS
210 220 230 240 250
PIKAPSVSPP VPPTKGNPSA VPAPIPCVPP LPPPPPTPPP LPPASALSEK
260 270 280 290 300
AVRPQLAPLH LPPIPPPLPL LPPYGYPALH SEPSSPAQDV REPPAPPPPP
310 320 330 340 350
PPPPPPPPPP LPTYASCSPR AAVAPPPPPL PGSSNSGSET PPPLPPKSPS
360 370 380 390 400
FQTQKALPTP PGAPGPQIIL QKKRRGPGAG GGKLNPPPAP PARSPTTELS
410 420 430 440 450
SKTQQPGGQL RNGGQHVIDD FESKFTFHSM EDFPPPDEYK PGQKIYPSKV
460 470 480
PRSRTPGSWL QAEAAGQSSD DIKTRNSQLS LKALR
Length:485
Mass (Da):49,381
Last modified:May 1, 1999 - v1
Checksum:i195673E854CB37D9
GO
Isoform 2 (identifier: Q9Z0G8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     419-453: DDFESKFTFHSMEDFPPPDEYKPGQKIYPSKVPRS → G

Show »
Length:451
Mass (Da):45,308
Checksum:i6E2B50D1876E9CEE
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei419 – 45335DDFES…KVPRS → G in isoform 2. 1 PublicationVSP_034031Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U25281 mRNA. Translation: AAA87791.1.
U31159 mRNA. Translation: AAC99858.1.
U31168
, U31161, U31162, U31163, U31164, U31165, U31166, U31167 Genomic DNA. Translation: AAC99859.1.
RefSeqiNP_671744.1. NM_147211.1. [Q9Z0G8-2]
XP_008761099.1. XM_008762877.1. [Q9Z0G8-1]
UniGeneiRn.11272.

Genome annotation databases

EnsembliENSRNOT00000012755; ENSRNOP00000012755; ENSRNOG00000009571. [Q9Z0G8-2]
ENSRNOT00000074054; ENSRNOP00000064597; ENSRNOG00000009571. [Q9Z0G8-1]
GeneIDi259242.
KEGGirno:259242.
UCSCiRGD:708559. rat. [Q9Z0G8-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U25281 mRNA. Translation: AAA87791.1.
U31159 mRNA. Translation: AAC99858.1.
U31168
, U31161, U31162, U31163, U31164, U31165, U31166, U31167 Genomic DNA. Translation: AAC99859.1.
RefSeqiNP_671744.1. NM_147211.1. [Q9Z0G8-2]
XP_008761099.1. XM_008762877.1. [Q9Z0G8-1]
UniGeneiRn.11272.

3D structure databases

ProteinModelPortaliQ9Z0G8.
SMRiQ9Z0G8. Positions 43-74.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000012747.

PTM databases

iPTMnetiQ9Z0G8.
PhosphoSiteiQ9Z0G8.

Proteomic databases

PaxDbiQ9Z0G8.
PRIDEiQ9Z0G8.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSRNOT00000012755; ENSRNOP00000012755; ENSRNOG00000009571. [Q9Z0G8-2]
ENSRNOT00000074054; ENSRNOP00000064597; ENSRNOG00000009571. [Q9Z0G8-1]
GeneIDi259242.
KEGGirno:259242.
UCSCiRGD:708559. rat. [Q9Z0G8-1]

Organism-specific databases

CTDi644150.
RGDi708559. Wipf3.

Phylogenomic databases

eggNOGiENOG410J09R. Eukaryota.
ENOG410Y0AH. LUCA.
GeneTreeiENSGT00840000129980.
HOGENOMiHOG000090003.
InParanoidiQ9Z0G8.
KOiK19475.
OMAiLRNGGQH.
OrthoDBiEOG091G0GSL.
PhylomeDBiQ9Z0G8.

Enzyme and pathway databases

ReactomeiR-RNO-2029482. Regulation of actin dynamics for phagocytic cup formation.
R-RNO-5663213. RHO GTPases Activate WASPs and WAVEs.

Miscellaneous databases

PROiQ9Z0G8.

Gene expression databases

BgeeiENSRNOG00000009571.
ExpressionAtlasiQ9Z0G8. baseline and differential.
GenevisibleiQ9Z0G8. RN.

Family and domain databases

InterProiIPR003124. WH2_dom.
[Graphical view]
PfamiPF02205. WH2. 1 hit.
[Graphical view]
SMARTiSM00246. WH2. 1 hit.
[Graphical view]
PROSITEiPS51082. WH2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiWIPF3_RAT
AccessioniPrimary (citable) accession number: Q9Z0G8
Secondary accession number(s): Q62775
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 10, 2008
Last sequence update: May 1, 1999
Last modified: September 7, 2016
This is version 93 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Miscellaneous

Suppress the growth and endocytosis defect of yeast lacking VRP1 without correcting the actin patch polarization defect.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.