Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sarcoplasmic/endoplasmic reticulum calcium ATPase 3

Gene

ATP2A3

Organism
Gallus gallus (Chicken)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of calcium. Transports calcium ions from the cytosol into the sarcoplasmic/endoplasmic reticulum lumen. Contributes to calcium sequestration involved in muscular excitation/contraction.By similarity

Catalytic activityi

ATP + H2O + Ca2+(Side 1) = ADP + phosphate + Ca2+(Side 2).

Enzyme regulationi

Inhibited by sarcolipin (SLN), phospholamban (PLN) and myoregulin (MRLN) (By similarity). Enhanced by DWORF; DWORF increases activity by displacing sarcolipin (SLN), phospholamban (PLN) and myoregulin (MRLN) (By similarity).By similarity

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi304 – 3041Calcium 2; via carbonyl oxygenBy similarity
Metal bindingi305 – 3051Calcium 2; via carbonyl oxygenBy similarity
Metal bindingi307 – 3071Calcium 2; via carbonyl oxygenBy similarity
Metal bindingi309 – 3091Calcium 2By similarity
Active sitei351 – 35114-aspartylphosphate intermediateBy similarity
Binding sitei515 – 5151ATPBy similarity
Metal bindingi703 – 7031MagnesiumBy similarity
Metal bindingi707 – 7071MagnesiumBy similarity
Metal bindingi768 – 7681Calcium 1By similarity
Metal bindingi771 – 7711Calcium 1By similarity
Metal bindingi796 – 7961Calcium 2By similarity
Metal bindingi799 – 7991Calcium 1By similarity
Metal bindingi800 – 8001Calcium 1By similarity
Metal bindingi800 – 8001Calcium 2By similarity
Metal bindingi908 – 9081Calcium 1By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Biological processi

Calcium transport, Ion transport, Transport

Keywords - Ligandi

ATP-binding, Calcium, Magnesium, Metal-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 (EC:3.6.3.8)
Short name:
ChkSERCA3
Short name:
SERCA3
Short name:
SR Ca(2+)-ATPase 3
Alternative name(s):
Calcium pump 3
Gene namesi
Name:ATP2A3
OrganismiGallus gallus (Chicken)
Taxonomic identifieri9031 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiArchelosauriaArchosauriaDinosauriaSaurischiaTheropodaCoelurosauriaAvesNeognathaeGalloanseraeGalliformesPhasianidaePhasianinaeGallus
Proteomesi
  • UP000000539 Componenti: Unplaced

Subcellular locationi

  • Endoplasmic reticulum membrane By similarity; Multi-pass membrane protein By similarity
  • Sarcoplasmic reticulum membrane By similarity; Multi-pass membrane protein By similarity

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 4848CytoplasmicBy similarityAdd
BLAST
Transmembranei49 – 6921Helical; Name=1By similarityAdd
BLAST
Topological domaini70 – 8920LumenalBy similarityAdd
BLAST
Transmembranei90 – 11021Helical; Name=2By similarityAdd
BLAST
Topological domaini111 – 253143CytoplasmicBy similarityAdd
BLAST
Transmembranei254 – 27320Helical; Name=3By similarityAdd
BLAST
Topological domaini274 – 29522LumenalBy similarityAdd
BLAST
Transmembranei296 – 31318Helical; Name=4By similarityAdd
BLAST
Topological domaini314 – 757444CytoplasmicBy similarityAdd
BLAST
Transmembranei758 – 77720Helical; Name=5By similarityAdd
BLAST
Topological domaini778 – 78710LumenalBy similarity
Transmembranei788 – 80821Helical; Name=6By similarityAdd
BLAST
Topological domaini809 – 82820CytoplasmicBy similarityAdd
BLAST
Transmembranei829 – 85123Helical; Name=7By similarityAdd
BLAST
Topological domaini852 – 89746LumenalBy similarityAdd
BLAST
Transmembranei898 – 91720Helical; Name=8By similarityAdd
BLAST
Topological domaini918 – 93013CytoplasmicBy similarityAdd
BLAST
Transmembranei931 – 94919Helical; Name=9By similarityAdd
BLAST
Topological domaini950 – 96415LumenalBy similarityAdd
BLAST
Transmembranei965 – 98521Helical; Name=10By similarityAdd
BLAST
Topological domaini986 – 104257CytoplasmicBy similarityAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane, Sarcoplasmic reticulum

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 10421042Sarcoplasmic/endoplasmic reticulum calcium ATPase 3PRO_0000046206Add
BLAST

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ9YGL9.
PRIDEiQ9YGL9.

Expressioni

Tissue specificityi

Found in spleen, lung, intestine and brain.

Inductioni

Down-regulated by 1,25-dihydroxyvitamin D3.

Interactioni

Subunit structurei

Interacts with sarcolipin (SLN) (By similarity). Interacts with phospholamban (PLN) (By similarity). Interacts with myoregulin (MRLN). Interacts with DWORF (By similarity).By similarity

Protein-protein interaction databases

STRINGi9031.ENSGALP00000002373.

Structurei

3D structure databases

ProteinModelPortaliQ9YGL9.
SMRiQ9YGL9. Positions 1-994.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni370 – 40031Interacts with phospholamban 1By similarityAdd
BLAST
Regioni788 – 80821Interacts with phospholamban 2By similarityAdd
BLAST

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG0202. Eukaryota.
COG0474. LUCA.
HOGENOMiHOG000265621.
HOVERGENiHBG105648.
InParanoidiQ9YGL9.
KOiK05853.
PhylomeDBiQ9YGL9.

Family and domain databases

Gene3Di1.20.1110.10. 2 hits.
2.70.150.10. 2 hits.
3.40.1110.10. 1 hit.
InterProiIPR006068. ATPase_P-typ_cation-transptr_C.
IPR004014. ATPase_P-typ_cation-transptr_N.
IPR023299. ATPase_P-typ_cyto_domN.
IPR018303. ATPase_P-typ_P_site.
IPR023298. ATPase_P-typ_TM_dom.
IPR008250. ATPase_P-typ_transduc_dom_A.
IPR023214. HAD-like_dom.
IPR005782. P-type_ATPase_IIA.
IPR001757. P_typ_ATPase.
[Graphical view]
PfamiPF00689. Cation_ATPase_C. 1 hit.
PF00690. Cation_ATPase_N. 1 hit.
PF00122. E1-E2_ATPase. 1 hit.
PF08282. Hydrolase_3. 1 hit.
[Graphical view]
SMARTiSM00831. Cation_ATPase_N. 1 hit.
[Graphical view]
SUPFAMiSSF56784. SSF56784. 1 hit.
SSF81660. SSF81660. 1 hit.
TIGRFAMsiTIGR01116. ATPase-IIA1_Ca. 1 hit.
TIGR01494. ATPase_P-type. 3 hits.
PROSITEiPS00154. ATPASE_E1_E2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform SERCA3B (identifier: Q9YGL9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEAAHSVPVQ DVLSRFGVAE SCGLSPEQVR RNREKYGPNE LPAEERKSLW
60 70 80 90 100
ELVLEQFEDL LVRILLMAAF LSFILAWFEE GEESTTAFVE PIVIIMILIA
110 120 130 140 150
NAVVGVWQER NAESAIEALK EYEPEMGKVI RADRSGVQRI RARDIVPGDI
160 170 180 190 200
VEVAVGDKVP ADIRIIEIRS TTLRVDQSIL TGESMSVIKH ADPIPDPRAV
210 220 230 240 250
NQDKKNMLFS GTNIAAGKAV GIVIATGVYT EIGKIRNQMV ETEPEKTPLQ
260 270 280 290 300
QKLDEFSQQL SKVIFLVCIA VWVINISHFS DPVHGGSWFR GAIYYFKTSV
310 320 330 340 350
ALAVAAIPEG LPAVITTCLA LGTRRMAKKN AIVRSLPSVE TLGCTSVICS
360 370 380 390 400
DKTGTLTTNQ MSVCRMFIME KVEGTQCSLH EFSITGSTYA PEGQILKDEK
410 420 430 440 450
PVRCGQYDGL VELATICALC NDSSLDYNES KKVYEKVGEA TETALTCLVE
460 470 480 490 500
KMNVFDTDTS KLSKVERANA CNSVIKHLMR KECTLEFSRD RKSMSVYCTP
510 520 530 540 550
TGPGHNSAGS KMFVKGAPES VIERCTHVRV GTAKVPLTPP VREKILSQIR
560 570 580 590 600
DWGMGTDTLR CLALATHDAP VQRETMQLHD STTFTHYETN LTFVGCVGML
610 620 630 640 650
DPPRKEVTSS IEMCRKAGIR VIMITGDNKG TAVAICRRIG IFTESEDVAG
660 670 680 690 700
KAYTGREFDE LSPEAQRQAC REARCFARVE PAHKSRIVEY LQSFNEITAM
710 720 730 740 750
TGDGVNDAPA LKKAEIGIAM GSGTAVAKSA AEMVLSDDNF STIVSAVEEG
760 770 780 790 800
RAIYNNMKQF IRYLISSNVG EVVCIFLTAI LGLPEALIPV QLLWVNLVTD
810 820 830 840 850
GLPATALGFN PPDLDIMDKL PRNPKEPLIS GWLFFRYLAI GVYVGLATVG
860 870 880 890 900
AATWWFLYDA EGPQVSFHQL RNFMRCTEDN PIFEGVNCEI FESRYPTTMA
910 920 930 940 950
LSVLVTIEMC NALNSVSENQ SLLRMPPWLN IWLLGAIVMS MALHFFILYV
960 970 980 990 1000
KPMPLIFQVT PLSWPQWVVV LKISLPVILL DEGLKYLSRN HLEGILRTVR
1010 1020 1030 1040
NTWSGEHQLK TCRTPEQGRR GQEMNDTKEM LQAKGPQTCN SD
Length:1,042
Mass (Da):115,429
Last modified:May 1, 1999 - v1
Checksum:i3777E0B79311801C
GO
Isoform SERCA3A (identifier: Q9YGL9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     995-1042: ILRTVRNTWSGEHQLKTCRTPEQGRRGQEMNDTKEMLQAKGPQTCNSD → EEDKK

Show »
Length:999
Mass (Da):110,546
Checksum:i53A3FFE8CEFC54CE
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei995 – 104248ILRTV…TCNSD → EEDKK in isoform SERCA3A. 1 PublicationVSP_000371Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y18063 mRNA. Translation: CAB38029.1.
RefSeqiNP_990222.1. NM_204891.1. [Q9YGL9-1]
UniGeneiGga.16523.

Genome annotation databases

GeneIDi395707.
KEGGigga:395707.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y18063 mRNA. Translation: CAB38029.1.
RefSeqiNP_990222.1. NM_204891.1. [Q9YGL9-1]
UniGeneiGga.16523.

3D structure databases

ProteinModelPortaliQ9YGL9.
SMRiQ9YGL9. Positions 1-994.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi9031.ENSGALP00000002373.

Proteomic databases

PaxDbiQ9YGL9.
PRIDEiQ9YGL9.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi395707.
KEGGigga:395707.

Organism-specific databases

CTDi489.

Phylogenomic databases

eggNOGiKOG0202. Eukaryota.
COG0474. LUCA.
HOGENOMiHOG000265621.
HOVERGENiHBG105648.
InParanoidiQ9YGL9.
KOiK05853.
PhylomeDBiQ9YGL9.

Miscellaneous databases

PROiQ9YGL9.

Family and domain databases

Gene3Di1.20.1110.10. 2 hits.
2.70.150.10. 2 hits.
3.40.1110.10. 1 hit.
InterProiIPR006068. ATPase_P-typ_cation-transptr_C.
IPR004014. ATPase_P-typ_cation-transptr_N.
IPR023299. ATPase_P-typ_cyto_domN.
IPR018303. ATPase_P-typ_P_site.
IPR023298. ATPase_P-typ_TM_dom.
IPR008250. ATPase_P-typ_transduc_dom_A.
IPR023214. HAD-like_dom.
IPR005782. P-type_ATPase_IIA.
IPR001757. P_typ_ATPase.
[Graphical view]
PfamiPF00689. Cation_ATPase_C. 1 hit.
PF00690. Cation_ATPase_N. 1 hit.
PF00122. E1-E2_ATPase. 1 hit.
PF08282. Hydrolase_3. 1 hit.
[Graphical view]
SMARTiSM00831. Cation_ATPase_N. 1 hit.
[Graphical view]
SUPFAMiSSF56784. SSF56784. 1 hit.
SSF81660. SSF81660. 1 hit.
TIGRFAMsiTIGR01116. ATPase-IIA1_Ca. 1 hit.
TIGR01494. ATPase_P-type. 3 hits.
PROSITEiPS00154. ATPASE_E1_E2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "Identification of avian sarcoplasmic reticulum Ca(2+)-ATPase (SERCA3) as a novel 1,25(OH)(2)D(3) target gene in the monocytic lineage."
    Machuca I., Domenget C., Jurdic P.
    Exp. Cell Res. 250:364-375(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS SERCA3A AND SERCA3B).
    Strain: SPAFAS.
    Tissue: Macrophage.

Entry informationi

Entry nameiAT2A3_CHICK
AccessioniPrimary (citable) accession number: Q9YGL9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 18, 2001
Last sequence update: May 1, 1999
Last modified: July 6, 2016
This is version 122 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.