Q9YGL9 (AT2A3_CHICK) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 95.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 Short name=ChkSERCA3 Short name=SERCA3 Short name=SR Ca(2+)-ATPase 3 EC=3.6.3.8 Alternative name(s): Calcium pump 3 | ||
| Gene names |
| ||
| Organism | Gallus gallus (Chicken) | ||
| Taxonomic identifier | 9031 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Archosauria › Dinosauria › Saurischia › Theropoda › Coelurosauria › Aves › Neognathae › Galliformes › Phasianidae › Phasianinae › Gallus |
Protein attributes
| Sequence length | 1042 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of the calcium. Transports calcium ions from the cytosol into the sarcoplasmic/endoplasmic reticulum lumen. Contributes to calcium sequestration involved in muscular excitation/contraction. |
| Catalytic activity | ATP + H2O + Ca2+[side 1] = ADP + phosphate + Ca2+[side 2]. |
| Subcellular location | Nucleus membrane; Multi-pass membrane protein By similarity. Endoplasmic reticulum membrane; Multi-pass membrane protein By similarity. Sarcoplasmic reticulum membrane; Multi-pass membrane protein By similarity. |
| Tissue specificity | Found in spleen, lung, intestine and brain. |
| Induction | Down-regulated by 1,25-dihydroxyvitamin D3. |
| Sequence similarities | Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type IIA subfamily. [View classification] |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform SERCA3B (identifier: Q9YGL9-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform SERCA3A (identifier: Q9YGL9-2) The sequence of this isoform differs from the canonical sequence as follows: 995-1042: ILRTVRNTWSGEHQLKTCRTPEQGRRGQEMNDTKEMLQAKGPQTCNSD → EEDKK |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1042 | 1042 | Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 | PRO_0000046206 | |||||
Regions | |||||||||
| Topological domain | 1 – 48 | 48 | Cytoplasmic By similarity | ||||||
| Transmembrane | 49 – 69 | 21 | Helical; Name=1; By similarity | ||||||
| Topological domain | 70 – 89 | 20 | Lumenal By similarity | ||||||
| Transmembrane | 90 – 110 | 21 | Helical; Name=2; By similarity | ||||||
| Topological domain | 111 – 253 | 143 | Cytoplasmic By similarity | ||||||
| Transmembrane | 254 – 273 | 20 | Helical; Name=3; By similarity | ||||||
| Topological domain | 274 – 295 | 22 | Lumenal By similarity | ||||||
| Transmembrane | 296 – 313 | 18 | Helical; Name=4; By similarity | ||||||
| Topological domain | 314 – 757 | 444 | Cytoplasmic By similarity | ||||||
| Transmembrane | 758 – 777 | 20 | Helical; Name=5; By similarity | ||||||
| Topological domain | 778 – 787 | 10 | Lumenal By similarity | ||||||
| Transmembrane | 788 – 808 | 21 | Helical; Name=6; By similarity | ||||||
| Topological domain | 809 – 828 | 20 | Cytoplasmic By similarity | ||||||
| Transmembrane | 829 – 851 | 23 | Helical; Name=7; By similarity | ||||||
| Topological domain | 852 – 897 | 46 | Lumenal By similarity | ||||||
| Transmembrane | 898 – 917 | 20 | Helical; Name=8; By similarity | ||||||
| Topological domain | 918 – 930 | 13 | Cytoplasmic By similarity | ||||||
| Transmembrane | 931 – 949 | 19 | Helical; Name=9; By similarity | ||||||
| Topological domain | 950 – 964 | 15 | Lumenal By similarity | ||||||
| Transmembrane | 965 – 985 | 21 | Helical; Name=10; By similarity | ||||||
| Topological domain | 986 – 1042 | 57 | Cytoplasmic By similarity | ||||||
Sites | |||||||||
| Active site | 351 | 1 | 4-aspartylphosphate intermediate By similarity | ||||||
| Metal binding | 304 | 1 | Calcium 2; via carbonyl oxygen By similarity | ||||||
| Metal binding | 305 | 1 | Calcium 2; via carbonyl oxygen By similarity | ||||||
| Metal binding | 307 | 1 | Calcium 2; via carbonyl oxygen By similarity | ||||||
| Metal binding | 309 | 1 | Calcium 2 By similarity | ||||||
| Metal binding | 703 | 1 | Magnesium By similarity | ||||||
| Metal binding | 707 | 1 | Magnesium By similarity | ||||||
| Metal binding | 768 | 1 | Calcium 1 By similarity | ||||||
| Metal binding | 771 | 1 | Calcium 1 By similarity | ||||||
| Metal binding | 796 | 1 | Calcium 2 By similarity | ||||||
| Metal binding | 799 | 1 | Calcium 1 By similarity | ||||||
| Metal binding | 800 | 1 | Calcium 1 By similarity | ||||||
| Metal binding | 800 | 1 | Calcium 2 By similarity | ||||||
| Metal binding | 908 | 1 | Calcium 1 By similarity | ||||||
| Binding site | 515 | 1 | ATP By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 995 – 1042 | 48 | ILRTV…TCNSD → EEDKK in isoform SERCA3A. | VSP_000371 | |||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "Identification of avian sarcoplasmic reticulum Ca(2+)-ATPase (SERCA3) as a novel 1,25(OH)(2)D(3) target gene in the monocytic lineage." Machuca I., Domenget C., Jurdic P. Exp. Cell Res. 250:364-375(1999) [PubMed: 10413590] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS SERCA3A AND SERCA3B). Strain: SPAFAS. Tissue: Macrophage. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | Y18063 mRNA. Translation: CAB38029.1. |
| IPI | IPI00582754. IPI00599579. |
| RefSeq | NP_990222.1. NM_204891.1. |
| UniGene | Gga.16523. |
3D structure databases | |
| ProteinModelPortal | Q9YGL9. |
| SMR | Q9YGL9. Positions 1-994. |
| ModBase | Search... |
Proteomic databases | |
| PRIDE | Q9YGL9. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| GeneID | 395707. |
| KEGG | gga:395707. |
Organism-specific databases | |
| CTD | 489. |
Phylogenomic databases | |
| eggNOG | veNOG07086. |
| GeneTree | ENSGT00560000076887. |
| HOGENOM | HBG456486. |
| HOVERGEN | HBG105648. |
| InParanoid | Q9YGL9. |
| PhylomeDB | Q9YGL9. |
Family and domain databases | |
| InterPro | IPR023306. ATPase_cation_domN. IPR008250. ATPase_P-typ_ATPase-assoc-dom. IPR005782. ATPase_P-typ_Ca-transp. IPR006069. ATPase_P-typ_cation-exchng_asu. IPR006068. ATPase_P-typ_cation-transptr_C. IPR004014. ATPase_P-typ_cation-transptr_N. IPR023300. ATPase_P-typ_cyto_domA. IPR023299. ATPase_P-typ_cyto_domN. IPR001757. ATPase_P-typ_ion-transptr. IPR018303. ATPase_P-typ_P_site. IPR023298. ATPase_P-typ_TM_dom. IPR005834. Dehalogen-like_hydro. IPR023214. HAD-like_dom. [Graphical view] |
| Gene3D | G3DSA:2.70.150.10. ATPase_P-typ_cyto_domA. 2 hits. G3DSA:3.40.1110.10. ATPase_P-typ_cyto_domN. 1 hit. G3DSA:1.20.1110.10. ATPase_P-typ_TM_dom. 2 hits. |
| KO | K05853. |
| Pfam | PF00689. Cation_ATPase_C. 1 hit. PF00690. Cation_ATPase_N. 1 hit. PF00122. E1-E2_ATPase. 1 hit. PF00702. Hydrolase. 1 hit. [Graphical view] |
| PRINTS | PR00119. CATATPASE. PR00121. NAKATPASE. |
| SMART | SM00831. Cation_ATPase_N. 1 hit. [Graphical view] |
| SUPFAM | SSF81660. ATPase_cation_domN. 1 hit. SSF56784. HAD-like_dom. 1 hit. |
| TIGRFAMs | TIGR01116. ATPase-IIA1_Ca. 1 hit. TIGR01494. ATPase_P-type. 3 hits. |
| PROSITE | PS00154. ATPASE_E1_E2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Entry information
| Entry name | AT2A3_CHICK | ||||||||
| Accession | Primary (citable) accession number: Q9YGL9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| SIMILARITY comments Index of protein domains and families |

Clusters with