Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9Y6V0 (PCLO_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 137. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (6) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Protein piccolo
Alternative name(s):
Aczonin
Gene names
Name:PCLO
Synonyms:ACZ, KIAA0559
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length5065 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

May act as a scaffolding protein involved in the organization of synaptic active zones and in synaptic vesicle trafficking By similarity. UniProtKB Q9QYX7

Subunit structure

Interacts with RABAC1/PRA1, RIMS2 and profilin By similarity.

Subcellular location

Cell junctionsynapse By similarity. Note: Concentrated at the presynaptic side of synaptic junctions By similarity.

Domain

C2 domain 1 is involved in binding calcium and phospholipids. Calcium binds with low affinity but with high specificity and induces a large conformational change. UniProtKB Q9JKS6

Sequence similarities

Contains 2 C2 domains.

Contains 1 PDZ (DHR) domain.

Sequence caution

The sequence AAB97937.1 differs from that shown. Reason: Erroneous gene model prediction.

The sequence AAD21789.2 differs from that shown. Reason: Erroneous gene model prediction.

Alternative products

This entry describes 6 isoforms produced by alternative splicing. [Align] [Select]

Note: Additional isoforms seem to exist.
Isoform 1 (identifier: Q9Y6V0-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9Y6V0-2)

The sequence of this isoform differs from the canonical sequence as follows:
     4440-4440: S → SGNGLGIRIVGGKEIPGHSGEIGAYIAKILPGGSAEQTGKLMEG
     4570-4570: K → KPTDGTKVVSHPITGEIQ
     4612-4612: G → GQVMVVQNAS
     4793-4797: TAHKS → SKRRK
     4798-5065: Missing.
Isoform 3 (identifier: Q9Y6V0-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-4458: Missing.
     4459-4476: VQSIISQQSGEAEICVRL → MKKFRVSLVSKVGKQKYV
     4570-4570: K → KPTDGTKVVSHPITGEIQ
     4793-4797: TAHKS → SKRRK
     4798-5065: Missing.
Note: No experimental confirmation available.
Isoform 4 (identifier: Q9Y6V0-4)

The sequence of this isoform differs from the canonical sequence as follows:
     443-490: AKPPSQQPGS...GSAKPSAQQP → HKAPISTAWL...WLSKTLSSTA
     491-5065: Missing.
Note: No experimental confirmation available.
Isoform 5 (identifier: Q9Y6V0-5)

The sequence of this isoform differs from the canonical sequence as follows:
     442-442: Q → QQPGPGKIPAQQAGPGKTSAQQTGPTKPPSQLPGPAKPPPQQPGPAKPPPQQPGS
     1046-1046: E → EIQEWLCL
     1270-1270: Q → QVEPGKEKT
     4440-4440: S → SGNGLGIRIVGGKEIPGHSGEIGAYIAKILPGGSAEQTGKLMEG
     4570-4570: K → KPTDGTKVVSHPITGEIQ
     4612-4612: G → GQVMVVQNAS
     4794-4854: Missing.
Note: No experimental confirmation available.
Isoform 6 (identifier: Q9Y6V0-6)

The sequence of this isoform differs from the canonical sequence as follows:
     442-442: Q → QQPGPGKIPAQQAGPGKTSAQQTGPTKPPSQLPGPAKPPPQQPGPAKPPPQQPGS
     1046-1046: E → EIQEWLCL
     1270-1270: Q → QVEPGKEKT
     4440-4440: S → SGNGLGIRIVGGKEIPGHSGEIGAYIAKILPGGSAEQTGKLMEG
     4570-4570: K → KPTDGTKVVSHPITGEIQ
     4612-4612: G → GQVMVVQNAS
     4793-4797: TAHKS → SKRRK
     4798-5065: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 50655065Protein piccolo
PRO_0000058250

Regions

Domain4427 – 447852PDZ
Domain4565 – 4669105C2 1
Domain4934 – 5039106C2 2
Zinc finger535 – 55925C4-type Potential
Zinc finger1005 – 102824C4-type Potential
Region397 – 50110510 X 10 AA tandem approximate repeats of P-A-K-P-Q-P-Q-Q-P-X
Compositional bias193 – 499307Gln-rich
Compositional bias209 – 975767Pro-rich
Compositional bias2303 – 2464162Pro-rich
Compositional bias2336 – 236126Poly-Pro
Compositional bias3141 – 3248108Gln-rich
Compositional bias3792 – 3896105Gln-rich
Compositional bias4215 – 427864Ser-rich
Compositional bias4699 – 476567Ser-rich

Amino acid modifications

Modified residue17621Phosphoserine By similarity
Modified residue33781Phosphothreonine By similarity

Natural variations

Alternative sequence1 – 44584458Missing in isoform 3.
VSP_012348
Alternative sequence4421Q → QQPGPGKIPAQQAGPGKTSA QQTGPTKPPSQLPGPAKPPP QQPGPAKPPPQQPGS in isoform 5 and isoform 6.
VSP_041004
Alternative sequence443 – 49048AKPPS…SAQQP → HKAPISTAWLNKTPTSTAWP SKALTSTAWLNKTPISTAWL SKTLSSTA in isoform 4.
VSP_041005
Alternative sequence491 – 50654575Missing in isoform 4.
VSP_041006
Alternative sequence10461E → EIQEWLCL in isoform 5 and isoform 6.
VSP_041007
Alternative sequence12701Q → QVEPGKEKT in isoform 5 and isoform 6.
VSP_041008
Alternative sequence44401S → SGNGLGIRIVGGKEIPGHSG EIGAYIAKILPGGSAEQTGK LMEG in isoform 2, isoform 5 and isoform 6.
VSP_003923
Alternative sequence4459 – 447618VQSII…ICVRL → MKKFRVSLVSKVGKQKYV in isoform 3.
VSP_012349
Alternative sequence45701K → KPTDGTKVVSHPITGEIQ in isoform 2, isoform 3, isoform 5 and isoform 6.
VSP_003924
Alternative sequence46121G → GQVMVVQNAS in isoform 2, isoform 5 and isoform 6.
VSP_003925
Alternative sequence4793 – 47975TAHKS → SKRRK in isoform 2, isoform 3 and isoform 6.
VSP_003926
Alternative sequence4794 – 485461Missing in isoform 5.
VSP_041009
Alternative sequence4798 – 5065268Missing in isoform 2, isoform 3 and isoform 6.
VSP_003927
Natural variant26021T → P.
Corresponds to variant rs10261848 [ dbSNP | Ensembl ].
VAR_056959
Natural variant27351A → T.
Corresponds to variant rs976714 [ dbSNP | Ensembl ].
VAR_056960

Experimental info

Sequence conflict4411V → A in CAB60727. Ref.4
Sequence conflict4431A → T in CAB60727. Ref.4
Sequence conflict4471S → P in AAI22566. Ref.3
Sequence conflict5001S → F in CAB60727. Ref.4
Sequence conflict5091S → F in CAB60727. Ref.4
Sequence conflict5781V → A in CAB60727. Ref.4
Sequence conflict7601S → T in CAB60727. Ref.4
Sequence conflict46761S → A in AAH01304. Ref.3

Secondary structure

....... 5065
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified May 3, 2011. Version 4.
Checksum: 0CE4F2990F74AFFF

FASTA5,065553,277
        10         20         30         40         50         60 
MGNEASLEGE GLPEGLAAAA AAGGGASGAG SPSHTAIPAG MEADLSQLSE EERRQIAAVM 

        70         80         90        100        110        120 
SRAQGLPKGS VPPAAAESPS MHRKQELDSS HPPKQSGRPP DPGRPAQPGL SKSRTTDTFR 

       130        140        150        160        170        180 
SEQKLPGRSP STISLKESKS RTDLKEEHKS SMMPGFLSEV NALSAVSSVV NKFNPFDLIS 

       190        200        210        220        230        240 
DSEASQEETT KKQKVVQKEQ GKPEGIIKPP LQQQPPKPIP KQQGPGRDPL QQDGTPKSIS 

       250        260        270        280        290        300 
SQQPEKIKSQ PPGTGKPIQG PTQTPQTDHA KLPLQRDASR PQTKQADIVR GESVKPSLPS 

       310        320        330        340        350        360 
PSKPPIQQPT PGKPPAQQPG HEKSQPGPAK PPAQPSGLTK PLAQQPGTVK PPVQPPGTTK 

       370        380        390        400        410        420 
PPAQPLGPAK PPAQQTGSEK PSSEQPGPKA LAQPPGVGKT PAQQPGPAKP PTQQVGTPKP 

       430        440        450        460        470        480 
LAQQPGLQSP AKAPGPTKTP VQAKPPSQQP GSTKPPPQQP GPAKPSPQQP GSTKPPSQQP 

       490        500        510        520        530        540 
GSAKPSAQQP SPAKPSAQQS TKPVSQTGSG KPLQPPTVSP SAKQPPSQGL PKTICPLCNT 

       550        560        570        580        590        600 
TELLLHVPEK ANFNTCTECQ TTVCSLCGFN PNPHLTEVKE WLCLNCQMKR ALGGDLAPVP 

       610        620        630        640        650        660 
SSPQPKLKTA PVTTTSAVSK SSPQPQQTSP KKDAAPKQDL SKAPEPKKPP PLVKQPTLHG 

       670        680        690        700        710        720 
SPSAKAKQPP EADSLSKPAP PKEPSVPSEQ DKAPVADDKP KQPKMVKPTT DLVSSSSATT 

       730        740        750        760        770        780 
KPDIPSSKVQ SQAEEKTTPP LKTDSAKPSQ SFPPTGEKVS PFDSKAIPRP ASDSKIISHP 

       790        800        810        820        830        840 
GPSSESKGQK QVDPVQKKEE PKKAQTKMSP KPDAKPMPKG SPTPPGPRPT AGQTVPTPQQ 

       850        860        870        880        890        900 
SPKPQEQSRR FSLNLGSITD APKSQPTTPQ ETVTGKLFGF GASIFSQASN LISTAGQPGP 

       910        920        930        940        950        960 
HSQSGPGAPM KQAPAPSQPP TSQGPPKSTG QAPPAPAKSI PVKKETKAPA AEKLEPKAEQ 

       970        980        990       1000       1010       1020 
APTVKRTETE KKPPPIKDSK SLTAEPQKAV LPTKLEKSPK PESTCPLCKT ELNIGSKDPP 

      1030       1040       1050       1060       1070       1080 
NFNTCTECKN QVCNLCGFNP TPHLTENCQT QRAISGQLGD IRKMPPAPSG PKASPMPVPT 

      1090       1100       1110       1120       1130       1140 
ESSSQKTAVP PQVKLVKKQE QEVKTEAEKV ILEKVKETLS MEKIPPMVTT DQKQEESKLE 

      1150       1160       1170       1180       1190       1200 
KDKASALQEK KPLPEEKKLI PEEEKIRSEE KKPLLEEKKP TPEDKKLLPE AKTSAPEEQK 

      1210       1220       1230       1240       1250       1260 
HDLLKSQVQI AEEKLEGRVA PKTVQEGKQP QTKMEGLPSG TPQSLPKEDD KTTKTIKEQP 

      1270       1280       1290       1300       1310       1320 
QPPCTAKPDQ EKEDDKSDTS SSQQPKSPQG LSDTGYSSDG ISSSLGEIPS LIPTDEKDIL 

      1330       1340       1350       1360       1370       1380 
KGLKKDSFSQ ESSPSSPSDL AKLESTVLSI LEAQASTLAD EKSEKKTQPH EVSPEQPKDQ 

      1390       1400       1410       1420       1430       1440 
EKTQSLSETL EITISEEEIK ESQEERKDTF KKDSQQDIPS SKDHKEKSEF VDDITTRREP 

      1450       1460       1470       1480       1490       1500 
YDSVEESSES ENSPVPQRKR RTSVGSSSSD EYKQEDSQGS GEEEDFIRKQ IIEMSADEDA 

      1510       1520       1530       1540       1550       1560 
SGSEDDEFIR NQLKEISSST ESQKKEETKG KGKITAGKHR RLTRKSSTSI DEDAGRRHSW 

      1570       1580       1590       1600       1610       1620 
HDEDDEAFDE SPELKYRETK SQESEELVVT GGGGLRRFKT IELNSTIADK YSAESSQKKT 

      1630       1640       1650       1660       1670       1680 
SLYFDEEPEL EMESLTDSPE DRSRGEGSSS LHASSFTPGT SPTSVSSLDE DSDSSPSHKK 

      1690       1700       1710       1720       1730       1740 
GESKQQRKAR HRPHGPLLPT IEDSSEEEEL REEEELLKEQ EKQREIEQQQ RKSSSKKSKK 

      1750       1760       1770       1780       1790       1800 
DKDELRAQRR RERPKTPPSN LSPIEDASPT EELRQAAEME ELHRSSCSEY SPSIESDPEG 

      1810       1820       1830       1840       1850       1860 
FEISPEKIIE VQKVYKLPTA VSLYSPTDEQ SIMQKEGSQK ALKSAEEMYE EMMHKTHKYK 

      1870       1880       1890       1900       1910       1920 
AFPAANERDE VFEKEPLYGG MLIEDYIYES LVEDTYNGSV DGSLLTRQEE ENGFMQQKGR 

      1930       1940       1950       1960       1970       1980 
EQKIRLSEQI YEDPMQKITD LQKEFYELES LHSVVPQEDI VSSSFIIPES HEIVDLGTMV 

      1990       2000       2010       2020       2030       2040 
TSTEEERKLL DADAAYEELM KRQQMQLTPG SSPTQAPIGE DMTESTMDFD RMPDASLTSS 

      2050       2060       2070       2080       2090       2100 
VLSGASLTDS TSSATLSIPD VKITQHFSTE EIEDEYVTDY TREIQEIIAH ESLILTYSEP 

      2110       2120       2130       2140       2150       2160 
SESATSVPPS DTPSLTSSVS SVCTTDSSSP ITTLDSITTV YTEPVDMITK FEDSEEISSS 

      2170       2180       2190       2200       2210       2220 
TYFPGSIIDY PEEISVSLDR TAPPDGRASA DHIVISLSDM ASSIIESVVP KPEGPVADTV 

      2230       2240       2250       2260       2270       2280 
STDLLISEKD PVKKAKKETG NGIILEVLEA YRDKKELEAE RTKSSLSETV FDHPPSSVIA 

      2290       2300       2310       2320       2330       2340 
LPMKEQLSTT YFTSGETFGQ EKPASQLPSG SPSVSSLPAK PRPFFRSSSL DISAQPPPPP 

      2350       2360       2370       2380       2390       2400 
PPPPPPPPPP PPPPPPPLPP PTSPKPTILP KKKLTVASPV TTATPLFDAV TTLETTAVLR 

      2410       2420       2430       2440       2450       2460 
SNGLPVTRIC TTAPPPVPPK PSSIPSGLVF THRPEPSKPP IAPKPVIPQL PTTTQKPTDI 

      2470       2480       2490       2500       2510       2520 
HPKPTGLSLT SSMTLNLVTS ADYKLPSPTS PLSPHSNKSS PRFSKSLTET YVVITLPSEP 

      2530       2540       2550       2560       2570       2580 
GTPTDSSASQ AITSWPLGSP SKDLVSVEPV FSVVPPVTAV EIPISSEQTF YISGALQTFS 

      2590       2600       2610       2620       2630       2640 
ATPVTAPSSF QAAPTSVTQF LTTEVSKTEV SATRSTAPSV GLSSISITIP PEPLALDNIH 

      2650       2660       2670       2680       2690       2700 
LEKPQYKEDG KLQLVGDVID LRTVPKVEVK TTDKCIDLSA STMDVKRQIT ANEVYGKQIS 

      2710       2720       2730       2740       2750       2760 
AVQPSIINLS VTSSIVTPVS LATETVTFVT CTASASYTTG TESLVGAEHA MTTPLQLTTS 

      2770       2780       2790       2800       2810       2820 
KHAEPPYRIP SDQVFPIARE EAPINLSLGT PAHAVTLAIT KPVTVPPVGV TNGWTDSTVS 

      2830       2840       2850       2860       2870       2880 
QGITDGEVVD LSTTKSHRTV VTMDESTSSV MTKIIEDEKP VDLTAGRRAV CCDVVYKLPF 

      2890       2900       2910       2920       2930       2940 
GRSCTAQQPA TTLPEDRFGY RDDHYQYDRS GPYGYRGIGG MKPSMSDTNL AEAGHFFYKS 

      2950       2960       2970       2980       2990       3000 
KNAFDYSEGT DTAVDLTSGR VTTGEVMDYS SKTTGPYPET RQVISGAGIS TPQYSTARMT 

      3010       3020       3030       3040       3050       3060 
PPPGPQYCVG SVLRSSNGVV YSSVATPTPS TFAITTQPGS IFSTTVRDLS GIHTADAVTS 

      3070       3080       3090       3100       3110       3120 
LPAMHHSQPM PRSYFITTGA SETDIAVTGI DISASLQTIT MESLTAETID SVPTLTTASE 

      3130       3140       3150       3160       3170       3180 
VFPEVVGDES ALLIVPEEDK QQQQLDLERE LLELEKIKQQ RFAEELEWER QEIQRFREQE 

      3190       3200       3210       3220       3230       3240 
KIMVQKKLEE LQSMKQHLLF QQEEERQAQF MMRQETLAQQ QLQLEQIQQL QQQLHQQLEE 

      3250       3260       3270       3280       3290       3300 
QKIRQIYQYN YDPSGTASPQ TTTEQAILEG QYAALEGSQF WATEDATTTA SAVVAIEIPQ 

      3310       3320       3330       3340       3350       3360 
SQGWYTVQSD GVTQYIAPPG ILSTVSEIPL TDVVVKEEKQ PKKRSSGAKV RGQYDDMGEN 

      3370       3380       3390       3400       3410       3420 
MTDDPRSFKK IVDSGVQTDD EDATDRSYVS RRRRTKKSVD TSVQTDDEDQ DEWDMPTRSR 

      3430       3440       3450       3460       3470       3480 
RKARVGKYGD SMTEADKTKP LSKVSSIAVQ TVAEISVQTE PVGTIRTPSI RARVDAKVEI 

      3490       3500       3510       3520       3530       3540 
IKHISAPEKT YKGGSLGCQT EADSDTQSPQ YLSATSPPKD KKRPTPLEIG YSSHLRADST 

      3550       3560       3570       3580       3590       3600 
VQLAPSPPKS PKVLYSPISP LSPGKALESA FVPYEKPLPD DISPQKVLHP DMAKVPPASP 

      3610       3620       3630       3640       3650       3660 
KTAKMMQRSM SDPKPLSPTA DESSRAPFQY TEGYTTKGSQ TMTSSGAQKK VKRTLPNPPP 

      3670       3680       3690       3700       3710       3720 
EEISTGTQST FSTMGTVSRR RICRTNTMAR AKILQDIDRE LDLVERESAK LRKKQAELDE 

      3730       3740       3750       3760       3770       3780 
EEKEIDAKLR YLEMGINRRK EALLKEREKR ERAYLQGVAE DRDYMSDSEV SSTRPTRIES 

      3790       3800       3810       3820       3830       3840 
QHGIERPRTA PQTEFSQFIP PQTQTESQLV PPTSPYTQYQ YSSPALPTQA PTSYTQQSHF 

      3850       3860       3870       3880       3890       3900 
EQQTLYHQQV SPYQTQPTFQ AVATMSFTPQ VQPTPTPQPS YQLPSQMMVI QQKPRQTTLY 

      3910       3920       3930       3940       3950       3960 
LEPKITSNYE VIRNQPLMIA PVSTDNTFAV SHLGSKYNSL DLRIGLEERS SMASSPISSI 

      3970       3980       3990       4000       4010       4020 
SADSFYADID HHTPRNYVLI DDIGEITKGT AALSTAFSLH EKDLSKTDRL LRTTETRRSQ 

      4030       4040       4050       4060       4070       4080 
EVTDFLAPLQ SSSRLHSYVK AEEDPMEDPY ELKLLKHQIK QEFRRGTESL DHLAGLSHYY 

      4090       4100       4110       4120       4130       4140 
HADTSYRHFP KSEKYSISRL TLEKQAAKQL PAAILYQKQS KHKKSLIDPK MSKFSPIQES 

      4150       4160       4170       4180       4190       4200 
RDLEPDYSSY MTSSTSSIGG ISSRARLLQD DITFGLRKNI TDQQKFMGSS LGTGLGTLGN 

      4210       4220       4230       4240       4250       4260 
TIRSALQDEA DKPYSSGSRS RPSSRPSSVY GLDLSIKRDS SSSSLRLKAQ EAEALDVSFS 

      4270       4280       4290       4300       4310       4320 
HASSSARTKP TSLPISQSRG RIPIVAQNSE EESPLSPVGQ PMGMARAAAG PLPPISADTR 

      4330       4340       4350       4360       4370       4380 
DQFGSSHSLP EVQQHMREES RTRGYDRDIA FIMDDFQHAM SDSEAYHLRR EETDWFDKPR 

      4390       4400       4410       4420       4430       4440 
ESRLENGHGL DRKLPERLVH SRPLSQHQEQ IIQMNGKTMH YIFPHARIKI TRDSKDHTVS 

      4450       4460       4470       4480       4490       4500 
MQVLEWNGIP LTSKTYEEVQ SIISQQSGEA EICVRLDLNM LSDSENSQHL ELHEPPKAVD 

      4510       4520       4530       4540       4550       4560 
KAKSPGVDPK QLAAELQKVS LQQSPLVLSS VVEKGSHVHS GPTSAGSSSV PSPGQPGSPS 

      4570       4580       4590       4600       4610       4620 
VSKKKHGSSK LQINYDLGNL IIHILQARNL VPRDNNGYSD PFVKVYLLPG RGAEYKRRTK 

      4630       4640       4650       4660       4670       4680 
HVQKSLNPEW NQTVIYKSIS MEQLKKKTLE VTVWDYDRFS SNDFLGEVLI DLSSTSHLDN 

      4690       4700       4710       4720       4730       4740 
TPRWYPLKEQ TESIDHGKSH SSQSSQQSPK PSVIKSRSHG IFPDPSKDMQ VPTIEKSHSS 

      4750       4760       4770       4780       4790       4800 
PGSSKSSSEG HLRSHGPSRS QSKTSVTQTH LEDAGAAIAA AEAAVQQLRI QPTAHKSGQS 

      4810       4820       4830       4840       4850       4860 
NHARKQHRHS IAGVLPIQRT QSDNLPPPAN GNQDQSQLAL RKVMSDGPVK PEGAKPPNHR 

      4870       4880       4890       4900       4910       4920 
PAESSVSTGS SGSSFGSGYS VDSEGSSSTA GETNLFPIPR IGKMGQNGQE PVKQPGVGVG 

      4930       4940       4950       4960       4970       4980 
LADTEAKTQV MGEIKIALKK EMKTDGEQLI VEILQCRNIT YKFKSPDHLP DLYVKIYVMN 

      4990       5000       5010       5020       5030       5040 
ISTQKKVIKK KTRVCRHDRE PSFNETFRFS LSPAGHSLQI LLFSNGGKFM KKTLIGEACI 

      5050       5060 
WLDKVDLRKR IVNWHKLLVS PTQTH 

« Hide

Isoform 2 [UniParc].

Checksum: C9939ED01362785E
Show »

FASTA4,866530,858
Isoform 3 [UniParc].

Checksum: B515BD682ECC0154
Show »

FASTA35639,047
Isoform 4 [UniParc].

Checksum: 6F57A26F73587277
Show »

FASTA49051,012
Isoform 5 [UniParc].

Checksum: 18F145349952C935
Show »

FASTA5,142560,699
Isoform 6 [UniParc].

Checksum: E9D027F9FB9879F2
Show »

FASTA4,935537,886

References

« Hide 'large scale' references
[1]"The DNA sequence of human chromosome 7."
Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L. expand/collapse author list , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[2]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 21-607 (ISOFORMS 5/6).
Tissue: Placenta.
[4]"Aczonin, a 550-kd putative scaffolding protein of presynaptic active zones, shares homology regions with rim and bassoon and binds profilin."
Wang X., Kibschull M., Laue M.M., Lichte B., Petrasch-Parwez E., Kilimann M.W.
J. Cell Biol. 147:151-162(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 37-795 (ISOFORMS 1/2).
Tissue: Brain.
[5]"Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro."
Nagase T., Ishikawa K., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
DNA Res. 5:31-39(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 3655-5065 (ISOFORM 2).
Tissue: Brain.
[6]"Solution structure of RSGI RUH-003, a PDZ domain of hypothetical KIAA0559 protein from human."
RIKEN structural genomics initiative (RSGI)
Submitted (JAN-2004) to the PDB data bank
Cited for: STRUCTURE BY NMR OF 4390-4480.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AC004006 Genomic DNA. No translation available.
AC004082 Genomic DNA. Translation: AAB97937.1. Sequence problems.
AC080093 Genomic DNA. No translation available.
AC004886 Genomic DNA. Translation: AAD21789.2. Sequence problems.
AC004903 Genomic DNA. No translation available.
AC093461 Genomic DNA. No translation available.
CH236949 Genomic DNA. Translation: EAL24187.1.
BC001304 mRNA. Translation: AAH01304.2.
BC122565 mRNA. Translation: AAI22566.1.
BC125271 mRNA. Translation: AAI25272.1.
Y19188 mRNA. Translation: CAB60727.1.
AB011131 mRNA. Translation: BAA25485.1.
PIRT00332.
T00634.
RefSeqNP_055325.2. NM_014510.2.
NP_149015.2. NM_033026.5.
UniGeneHs.12376.

3D structure databases

PDBe
RCSB PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
1UJDNMR-A4420-4480[»]
ProteinModelPortalQ9Y6V0.
SMRQ9Y6V0. Positions 4567-4693.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid118178. 5 interactions.
IntActQ9Y6V0. 3 interactions.
MINTMINT-4542387.
STRING9606.ENSP00000411633.

PTM databases

PhosphoSiteQ9Y6V0.

Polymorphism databases

DMDM332278245.

Proteomic databases

PaxDbQ9Y6V0.
PRIDEQ9Y6V0.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000333891; ENSP00000334319; ENSG00000186472. [Q9Y6V0-5]
ENST00000423517; ENSP00000388393; ENSG00000186472. [Q9Y6V0-6]
GeneID27445.
KEGGhsa:27445.
UCSCuc003uhu.1. human. [Q9Y6V0-3]
uc003uhv.2. human. [Q9Y6V0-6]
uc003uhx.2. human. [Q9Y6V0-5]

Organism-specific databases

CTD27445.
GeneCardsGC07M082383.
HGNCHGNC:13406. PCLO.
HPAHPA015858.
HPA029579.
MIM604918. gene.
neXtProtNX_Q9Y6V0.
PharmGKBPA33072.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG12793.
HOVERGENHBG074340.
InParanoidQ9Y6V0.
KOK16882.
OMAPAAILYQ.
OrthoDBEOG73805D.
TreeFamTF326082.

Gene expression databases

ArrayExpressQ9Y6V0.
BgeeQ9Y6V0.
CleanExHS_PCLO.
GenevestigatorQ9Y6V0.

Family and domain databases

Gene3D2.60.40.150. 2 hits.
3.30.40.10. 1 hit.
InterProIPR000008. C2_dom.
IPR001565. Synaptotagmin.
IPR011011. Znf_FYVE_PHD.
IPR008899. Znf_piccolo.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view]
PfamPF00168. C2. 2 hits.
PF05715. zf-piccolo. 2 hits.
[Graphical view]
PRINTSPR00360. C2DOMAIN.
PR00399. SYNAPTOTAGMN.
SMARTSM00239. C2. 2 hits.
[Graphical view]
SUPFAMSSF49562. SSF49562. 2 hits.
SSF57903. SSF57903. 2 hits.
PROSITEPS50004. C2. 2 hits.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSPCLO. human.
EvolutionaryTraceQ9Y6V0.
GeneWikiPCLO.
GenomeRNAi27445.
NextBio50526.
PROQ9Y6V0.
SOURCESearch...

Entry information

Entry namePCLO_HUMAN
AccessionPrimary (citable) accession number: Q9Y6V0
Secondary accession number(s): A4D1A7 expand/collapse secondary AC list , A6NNX9, O43373, O60305, Q08E72, Q9BVC8, Q9UIV2, Q9Y6U9
Entry history
Integrated into UniProtKB/Swiss-Prot: October 19, 2002
Last sequence update: May 3, 2011
Last modified: April 16, 2014
This is version 137 of the entry and version 4 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 7

Human chromosome 7: entries, gene names and cross-references to MIM