Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9Y6V0

- PCLO_HUMAN

UniProt

Q9Y6V0 - PCLO_HUMAN

Protein

Protein piccolo

Gene

PCLO

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 140 (01 Oct 2014)
      Sequence version 4 (03 May 2011)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May act as a scaffolding protein involved in the organization of synaptic active zones and in synaptic vesicle trafficking.By similarity

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri535 – 55925C4-typeSequence AnalysisAdd
    BLAST
    Zinc fingeri1005 – 102824C4-typeSequence AnalysisAdd
    BLAST

    GO - Molecular functioni

    1. calcium-dependent phospholipid binding Source: UniProtKB
    2. calcium ion binding Source: UniProtKB
    3. profilin binding Source: UniProtKB
    4. transporter activity Source: InterPro

    GO - Biological processi

    1. cAMP-mediated signaling Source: Ensembl
    2. cytoskeleton organization Source: UniProtKB
    3. insulin secretion Source: Ensembl
    4. regulation of exocytosis Source: Ensembl
    5. synaptic vesicle exocytosis Source: UniProtKB

    Keywords - Ligandi

    Calcium, Calcium/phospholipid-binding, Metal-binding, Zinc

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Protein piccolo
    Alternative name(s):
    Aczonin
    Gene namesi
    Name:PCLOBy similarity
    Synonyms:ACZImported, KIAA0559
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 7

    Organism-specific databases

    HGNCiHGNC:13406. PCLO.

    Subcellular locationi

    Cell junctionsynapse By similarity
    Note: Concentrated at the presynaptic side of synaptic junctions.By similarity

    GO - Cellular componenti

    1. cell junction Source: UniProtKB-KW
    2. cytoskeleton Source: UniProtKB
    3. membrane Source: InterPro
    4. synapse Source: UniProtKB
    5. synaptic vesicle Source: InterPro

    Keywords - Cellular componenti

    Cell junction, Synapse

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA33072.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 50655065Protein piccoloPRO_0000058250Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei1762 – 17621PhosphoserineBy similarity
    Modified residuei3378 – 33781PhosphothreonineBy similarity

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ9Y6V0.
    PaxDbiQ9Y6V0.
    PRIDEiQ9Y6V0.

    PTM databases

    PhosphoSiteiQ9Y6V0.

    Expressioni

    Gene expression databases

    ArrayExpressiQ9Y6V0.
    BgeeiQ9Y6V0.
    CleanExiHS_PCLO.
    GenevestigatoriQ9Y6V0.

    Organism-specific databases

    HPAiHPA015858.
    HPA029579.

    Interactioni

    Subunit structurei

    Interacts with RABAC1/PRA1, RIMS2 and profilin.By similarity

    Protein-protein interaction databases

    BioGridi118178. 5 interactions.
    IntActiQ9Y6V0. 3 interactions.
    MINTiMINT-4542387.
    STRINGi9606.ENSP00000411633.

    Structurei

    Secondary structure

    1
    5065
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi4442 – 44465
    Helixi4456 – 44638
    Beta strandi4470 – 44778

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    1UJDNMR-A4441-4480[»]
    ProteinModelPortaliQ9Y6V0.
    SMRiQ9Y6V0. Positions 4567-4693.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ9Y6V0.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini4427 – 447852PDZAdd
    BLAST
    Domaini4565 – 4669105C2 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini4934 – 5039106C2 2PROSITE-ProRule annotationAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni397 – 50110510 X 10 AA tandem approximate repeats of P-A-K-P-Q-P-Q-Q-P-XAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi193 – 499307Gln-richAdd
    BLAST
    Compositional biasi209 – 975767Pro-richAdd
    BLAST
    Compositional biasi2303 – 2464162Pro-richAdd
    BLAST
    Compositional biasi2336 – 236126Poly-ProAdd
    BLAST
    Compositional biasi3141 – 3248108Gln-richAdd
    BLAST
    Compositional biasi3792 – 3896105Gln-richAdd
    BLAST
    Compositional biasi4215 – 427864Ser-richAdd
    BLAST
    Compositional biasi4699 – 476567Ser-richAdd
    BLAST

    Domaini

    C2 domain 1 is involved in binding calcium and phospholipids. Calcium binds with low affinity but with high specificity and induces a large conformational change.By similarity

    Sequence similaritiesi

    Contains 2 C2 domains.PROSITE-ProRule annotation
    Contains 1 PDZ (DHR) domain.Curated

    Zinc finger

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri535 – 55925C4-typeSequence AnalysisAdd
    BLAST
    Zinc fingeri1005 – 102824C4-typeSequence AnalysisAdd
    BLAST

    Keywords - Domaini

    Repeat, Zinc-finger

    Phylogenomic databases

    eggNOGiNOG12793.
    HOVERGENiHBG074340.
    InParanoidiQ9Y6V0.
    KOiK16882.
    OMAiDQVEPGK.
    OrthoDBiEOG73805D.
    TreeFamiTF326082.

    Family and domain databases

    Gene3Di2.60.40.150. 2 hits.
    3.30.40.10. 1 hit.
    InterProiIPR000008. C2_dom.
    IPR001565. Synaptotagmin.
    IPR011011. Znf_FYVE_PHD.
    IPR008899. Znf_piccolo.
    IPR013083. Znf_RING/FYVE/PHD.
    [Graphical view]
    PfamiPF00168. C2. 2 hits.
    PF05715. zf-piccolo. 2 hits.
    [Graphical view]
    PRINTSiPR00360. C2DOMAIN.
    PR00399. SYNAPTOTAGMN.
    SMARTiSM00239. C2. 2 hits.
    [Graphical view]
    SUPFAMiSSF49562. SSF49562. 2 hits.
    SSF57903. SSF57903. 2 hits.
    PROSITEiPS50004. C2. 2 hits.
    [Graphical view]

    Sequences (6)i

    Sequence statusi: Complete.

    This entry describes 6 isoformsi produced by alternative splicing. Align

    Note: Additional isoforms seem to exist.

    Isoform 1 (identifier: Q9Y6V0-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGNEASLEGE GLPEGLAAAA AAGGGASGAG SPSHTAIPAG MEADLSQLSE     50
    EERRQIAAVM SRAQGLPKGS VPPAAAESPS MHRKQELDSS HPPKQSGRPP 100
    DPGRPAQPGL SKSRTTDTFR SEQKLPGRSP STISLKESKS RTDLKEEHKS 150
    SMMPGFLSEV NALSAVSSVV NKFNPFDLIS DSEASQEETT KKQKVVQKEQ 200
    GKPEGIIKPP LQQQPPKPIP KQQGPGRDPL QQDGTPKSIS SQQPEKIKSQ 250
    PPGTGKPIQG PTQTPQTDHA KLPLQRDASR PQTKQADIVR GESVKPSLPS 300
    PSKPPIQQPT PGKPPAQQPG HEKSQPGPAK PPAQPSGLTK PLAQQPGTVK 350
    PPVQPPGTTK PPAQPLGPAK PPAQQTGSEK PSSEQPGPKA LAQPPGVGKT 400
    PAQQPGPAKP PTQQVGTPKP LAQQPGLQSP AKAPGPTKTP VQAKPPSQQP 450
    GSTKPPPQQP GPAKPSPQQP GSTKPPSQQP GSAKPSAQQP SPAKPSAQQS 500
    TKPVSQTGSG KPLQPPTVSP SAKQPPSQGL PKTICPLCNT TELLLHVPEK 550
    ANFNTCTECQ TTVCSLCGFN PNPHLTEVKE WLCLNCQMKR ALGGDLAPVP 600
    SSPQPKLKTA PVTTTSAVSK SSPQPQQTSP KKDAAPKQDL SKAPEPKKPP 650
    PLVKQPTLHG SPSAKAKQPP EADSLSKPAP PKEPSVPSEQ DKAPVADDKP 700
    KQPKMVKPTT DLVSSSSATT KPDIPSSKVQ SQAEEKTTPP LKTDSAKPSQ 750
    SFPPTGEKVS PFDSKAIPRP ASDSKIISHP GPSSESKGQK QVDPVQKKEE 800
    PKKAQTKMSP KPDAKPMPKG SPTPPGPRPT AGQTVPTPQQ SPKPQEQSRR 850
    FSLNLGSITD APKSQPTTPQ ETVTGKLFGF GASIFSQASN LISTAGQPGP 900
    HSQSGPGAPM KQAPAPSQPP TSQGPPKSTG QAPPAPAKSI PVKKETKAPA 950
    AEKLEPKAEQ APTVKRTETE KKPPPIKDSK SLTAEPQKAV LPTKLEKSPK 1000
    PESTCPLCKT ELNIGSKDPP NFNTCTECKN QVCNLCGFNP TPHLTENCQT 1050
    QRAISGQLGD IRKMPPAPSG PKASPMPVPT ESSSQKTAVP PQVKLVKKQE 1100
    QEVKTEAEKV ILEKVKETLS MEKIPPMVTT DQKQEESKLE KDKASALQEK 1150
    KPLPEEKKLI PEEEKIRSEE KKPLLEEKKP TPEDKKLLPE AKTSAPEEQK 1200
    HDLLKSQVQI AEEKLEGRVA PKTVQEGKQP QTKMEGLPSG TPQSLPKEDD 1250
    KTTKTIKEQP QPPCTAKPDQ EKEDDKSDTS SSQQPKSPQG LSDTGYSSDG 1300
    ISSSLGEIPS LIPTDEKDIL KGLKKDSFSQ ESSPSSPSDL AKLESTVLSI 1350
    LEAQASTLAD EKSEKKTQPH EVSPEQPKDQ EKTQSLSETL EITISEEEIK 1400
    ESQEERKDTF KKDSQQDIPS SKDHKEKSEF VDDITTRREP YDSVEESSES 1450
    ENSPVPQRKR RTSVGSSSSD EYKQEDSQGS GEEEDFIRKQ IIEMSADEDA 1500
    SGSEDDEFIR NQLKEISSST ESQKKEETKG KGKITAGKHR RLTRKSSTSI 1550
    DEDAGRRHSW HDEDDEAFDE SPELKYRETK SQESEELVVT GGGGLRRFKT 1600
    IELNSTIADK YSAESSQKKT SLYFDEEPEL EMESLTDSPE DRSRGEGSSS 1650
    LHASSFTPGT SPTSVSSLDE DSDSSPSHKK GESKQQRKAR HRPHGPLLPT 1700
    IEDSSEEEEL REEEELLKEQ EKQREIEQQQ RKSSSKKSKK DKDELRAQRR 1750
    RERPKTPPSN LSPIEDASPT EELRQAAEME ELHRSSCSEY SPSIESDPEG 1800
    FEISPEKIIE VQKVYKLPTA VSLYSPTDEQ SIMQKEGSQK ALKSAEEMYE 1850
    EMMHKTHKYK AFPAANERDE VFEKEPLYGG MLIEDYIYES LVEDTYNGSV 1900
    DGSLLTRQEE ENGFMQQKGR EQKIRLSEQI YEDPMQKITD LQKEFYELES 1950
    LHSVVPQEDI VSSSFIIPES HEIVDLGTMV TSTEEERKLL DADAAYEELM 2000
    KRQQMQLTPG SSPTQAPIGE DMTESTMDFD RMPDASLTSS VLSGASLTDS 2050
    TSSATLSIPD VKITQHFSTE EIEDEYVTDY TREIQEIIAH ESLILTYSEP 2100
    SESATSVPPS DTPSLTSSVS SVCTTDSSSP ITTLDSITTV YTEPVDMITK 2150
    FEDSEEISSS TYFPGSIIDY PEEISVSLDR TAPPDGRASA DHIVISLSDM 2200
    ASSIIESVVP KPEGPVADTV STDLLISEKD PVKKAKKETG NGIILEVLEA 2250
    YRDKKELEAE RTKSSLSETV FDHPPSSVIA LPMKEQLSTT YFTSGETFGQ 2300
    EKPASQLPSG SPSVSSLPAK PRPFFRSSSL DISAQPPPPP PPPPPPPPPP 2350
    PPPPPPPLPP PTSPKPTILP KKKLTVASPV TTATPLFDAV TTLETTAVLR 2400
    SNGLPVTRIC TTAPPPVPPK PSSIPSGLVF THRPEPSKPP IAPKPVIPQL 2450
    PTTTQKPTDI HPKPTGLSLT SSMTLNLVTS ADYKLPSPTS PLSPHSNKSS 2500
    PRFSKSLTET YVVITLPSEP GTPTDSSASQ AITSWPLGSP SKDLVSVEPV 2550
    FSVVPPVTAV EIPISSEQTF YISGALQTFS ATPVTAPSSF QAAPTSVTQF 2600
    LTTEVSKTEV SATRSTAPSV GLSSISITIP PEPLALDNIH LEKPQYKEDG 2650
    KLQLVGDVID LRTVPKVEVK TTDKCIDLSA STMDVKRQIT ANEVYGKQIS 2700
    AVQPSIINLS VTSSIVTPVS LATETVTFVT CTASASYTTG TESLVGAEHA 2750
    MTTPLQLTTS KHAEPPYRIP SDQVFPIARE EAPINLSLGT PAHAVTLAIT 2800
    KPVTVPPVGV TNGWTDSTVS QGITDGEVVD LSTTKSHRTV VTMDESTSSV 2850
    MTKIIEDEKP VDLTAGRRAV CCDVVYKLPF GRSCTAQQPA TTLPEDRFGY 2900
    RDDHYQYDRS GPYGYRGIGG MKPSMSDTNL AEAGHFFYKS KNAFDYSEGT 2950
    DTAVDLTSGR VTTGEVMDYS SKTTGPYPET RQVISGAGIS TPQYSTARMT 3000
    PPPGPQYCVG SVLRSSNGVV YSSVATPTPS TFAITTQPGS IFSTTVRDLS 3050
    GIHTADAVTS LPAMHHSQPM PRSYFITTGA SETDIAVTGI DISASLQTIT 3100
    MESLTAETID SVPTLTTASE VFPEVVGDES ALLIVPEEDK QQQQLDLERE 3150
    LLELEKIKQQ RFAEELEWER QEIQRFREQE KIMVQKKLEE LQSMKQHLLF 3200
    QQEEERQAQF MMRQETLAQQ QLQLEQIQQL QQQLHQQLEE QKIRQIYQYN 3250
    YDPSGTASPQ TTTEQAILEG QYAALEGSQF WATEDATTTA SAVVAIEIPQ 3300
    SQGWYTVQSD GVTQYIAPPG ILSTVSEIPL TDVVVKEEKQ PKKRSSGAKV 3350
    RGQYDDMGEN MTDDPRSFKK IVDSGVQTDD EDATDRSYVS RRRRTKKSVD 3400
    TSVQTDDEDQ DEWDMPTRSR RKARVGKYGD SMTEADKTKP LSKVSSIAVQ 3450
    TVAEISVQTE PVGTIRTPSI RARVDAKVEI IKHISAPEKT YKGGSLGCQT 3500
    EADSDTQSPQ YLSATSPPKD KKRPTPLEIG YSSHLRADST VQLAPSPPKS 3550
    PKVLYSPISP LSPGKALESA FVPYEKPLPD DISPQKVLHP DMAKVPPASP 3600
    KTAKMMQRSM SDPKPLSPTA DESSRAPFQY TEGYTTKGSQ TMTSSGAQKK 3650
    VKRTLPNPPP EEISTGTQST FSTMGTVSRR RICRTNTMAR AKILQDIDRE 3700
    LDLVERESAK LRKKQAELDE EEKEIDAKLR YLEMGINRRK EALLKEREKR 3750
    ERAYLQGVAE DRDYMSDSEV SSTRPTRIES QHGIERPRTA PQTEFSQFIP 3800
    PQTQTESQLV PPTSPYTQYQ YSSPALPTQA PTSYTQQSHF EQQTLYHQQV 3850
    SPYQTQPTFQ AVATMSFTPQ VQPTPTPQPS YQLPSQMMVI QQKPRQTTLY 3900
    LEPKITSNYE VIRNQPLMIA PVSTDNTFAV SHLGSKYNSL DLRIGLEERS 3950
    SMASSPISSI SADSFYADID HHTPRNYVLI DDIGEITKGT AALSTAFSLH 4000
    EKDLSKTDRL LRTTETRRSQ EVTDFLAPLQ SSSRLHSYVK AEEDPMEDPY 4050
    ELKLLKHQIK QEFRRGTESL DHLAGLSHYY HADTSYRHFP KSEKYSISRL 4100
    TLEKQAAKQL PAAILYQKQS KHKKSLIDPK MSKFSPIQES RDLEPDYSSY 4150
    MTSSTSSIGG ISSRARLLQD DITFGLRKNI TDQQKFMGSS LGTGLGTLGN 4200
    TIRSALQDEA DKPYSSGSRS RPSSRPSSVY GLDLSIKRDS SSSSLRLKAQ 4250
    EAEALDVSFS HASSSARTKP TSLPISQSRG RIPIVAQNSE EESPLSPVGQ 4300
    PMGMARAAAG PLPPISADTR DQFGSSHSLP EVQQHMREES RTRGYDRDIA 4350
    FIMDDFQHAM SDSEAYHLRR EETDWFDKPR ESRLENGHGL DRKLPERLVH 4400
    SRPLSQHQEQ IIQMNGKTMH YIFPHARIKI TRDSKDHTVS MQVLEWNGIP 4450
    LTSKTYEEVQ SIISQQSGEA EICVRLDLNM LSDSENSQHL ELHEPPKAVD 4500
    KAKSPGVDPK QLAAELQKVS LQQSPLVLSS VVEKGSHVHS GPTSAGSSSV 4550
    PSPGQPGSPS VSKKKHGSSK LQINYDLGNL IIHILQARNL VPRDNNGYSD 4600
    PFVKVYLLPG RGAEYKRRTK HVQKSLNPEW NQTVIYKSIS MEQLKKKTLE 4650
    VTVWDYDRFS SNDFLGEVLI DLSSTSHLDN TPRWYPLKEQ TESIDHGKSH 4700
    SSQSSQQSPK PSVIKSRSHG IFPDPSKDMQ VPTIEKSHSS PGSSKSSSEG 4750
    HLRSHGPSRS QSKTSVTQTH LEDAGAAIAA AEAAVQQLRI QPTAHKSGQS 4800
    NHARKQHRHS IAGVLPIQRT QSDNLPPPAN GNQDQSQLAL RKVMSDGPVK 4850
    PEGAKPPNHR PAESSVSTGS SGSSFGSGYS VDSEGSSSTA GETNLFPIPR 4900
    IGKMGQNGQE PVKQPGVGVG LADTEAKTQV MGEIKIALKK EMKTDGEQLI 4950
    VEILQCRNIT YKFKSPDHLP DLYVKIYVMN ISTQKKVIKK KTRVCRHDRE 5000
    PSFNETFRFS LSPAGHSLQI LLFSNGGKFM KKTLIGEACI WLDKVDLRKR 5050
    IVNWHKLLVS PTQTH 5065
    Length:5,065
    Mass (Da):553,277
    Last modified:May 3, 2011 - v4
    Checksum:i0CE4F2990F74AFFF
    GO
    Isoform 2 (identifier: Q9Y6V0-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         4440-4440: S → SGNGLGIRIVGGKEIPGHSGEIGAYIAKILPGGSAEQTGKLMEG
         4570-4570: K → KPTDGTKVVSHPITGEIQ
         4612-4612: G → GQVMVVQNAS
         4793-4797: TAHKS → SKRRK
         4798-5065: Missing.

    Show »
    Length:4,866
    Mass (Da):530,858
    Checksum:iC9939ED01362785E
    GO
    Isoform 3 (identifier: Q9Y6V0-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-4458: Missing.
         4459-4476: VQSIISQQSGEAEICVRL → MKKFRVSLVSKVGKQKYV
         4570-4570: K → KPTDGTKVVSHPITGEIQ
         4793-4797: TAHKS → SKRRK
         4798-5065: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:356
    Mass (Da):39,047
    Checksum:iB515BD682ECC0154
    GO
    Isoform 4 (identifier: Q9Y6V0-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         443-490: AKPPSQQPGS...GSAKPSAQQP → HKAPISTAWL...WLSKTLSSTA
         491-5065: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:490
    Mass (Da):51,012
    Checksum:i6F57A26F73587277
    GO
    Isoform 5 (identifier: Q9Y6V0-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         442-442: Q → QQPGPGKIPAQQAGPGKTSAQQTGPTKPPSQLPGPAKPPPQQPGPAKPPPQQPGS
         1046-1046: E → EIQEWLCL
         1270-1270: Q → QVEPGKEKT
         4440-4440: S → SGNGLGIRIVGGKEIPGHSGEIGAYIAKILPGGSAEQTGKLMEG
         4570-4570: K → KPTDGTKVVSHPITGEIQ
         4612-4612: G → GQVMVVQNAS
         4794-4854: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:5,142
    Mass (Da):560,699
    Checksum:i18F145349952C935
    GO
    Isoform 6 (identifier: Q9Y6V0-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         442-442: Q → QQPGPGKIPAQQAGPGKTSAQQTGPTKPPSQLPGPAKPPPQQPGPAKPPPQQPGS
         1046-1046: E → EIQEWLCL
         1270-1270: Q → QVEPGKEKT
         4440-4440: S → SGNGLGIRIVGGKEIPGHSGEIGAYIAKILPGGSAEQTGKLMEG
         4570-4570: K → KPTDGTKVVSHPITGEIQ
         4612-4612: G → GQVMVVQNAS
         4793-4797: TAHKS → SKRRK
         4798-5065: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:4,935
    Mass (Da):537,886
    Checksum:iE9D027F9FB9879F2
    GO

    Sequence cautioni

    The sequence AAB97937.1 differs from that shown. Reason: Erroneous gene model prediction.
    The sequence AAD21789.2 differs from that shown. Reason: Erroneous gene model prediction.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti441 – 4411V → A in CAB60727. (PubMed:10508862)Curated
    Sequence conflicti443 – 4431A → T in CAB60727. (PubMed:10508862)Curated
    Sequence conflicti447 – 4471S → P in AAI22566. (PubMed:15489334)Curated
    Sequence conflicti500 – 5001S → F in CAB60727. (PubMed:10508862)Curated
    Sequence conflicti509 – 5091S → F in CAB60727. (PubMed:10508862)Curated
    Sequence conflicti578 – 5781V → A in CAB60727. (PubMed:10508862)Curated
    Sequence conflicti760 – 7601S → T in CAB60727. (PubMed:10508862)Curated
    Sequence conflicti4676 – 46761S → A in AAH01304. (PubMed:15489334)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti2602 – 26021T → P.
    Corresponds to variant rs10261848 [ dbSNP | Ensembl ].
    VAR_056959
    Natural varianti2735 – 27351A → T.
    Corresponds to variant rs976714 [ dbSNP | Ensembl ].
    VAR_056960

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 44584458Missing in isoform 3. 1 PublicationVSP_012348Add
    BLAST
    Alternative sequencei442 – 4421Q → QQPGPGKIPAQQAGPGKTSA QQTGPTKPPSQLPGPAKPPP QQPGPAKPPPQQPGS in isoform 5 and isoform 6. CuratedVSP_041004
    Alternative sequencei443 – 49048AKPPS…SAQQP → HKAPISTAWLNKTPTSTAWP SKALTSTAWLNKTPISTAWL SKTLSSTA in isoform 4. CuratedVSP_041005Add
    BLAST
    Alternative sequencei491 – 50654575Missing in isoform 4. CuratedVSP_041006Add
    BLAST
    Alternative sequencei1046 – 10461E → EIQEWLCL in isoform 5 and isoform 6. CuratedVSP_041007
    Alternative sequencei1270 – 12701Q → QVEPGKEKT in isoform 5 and isoform 6. CuratedVSP_041008
    Alternative sequencei4440 – 44401S → SGNGLGIRIVGGKEIPGHSG EIGAYIAKILPGGSAEQTGK LMEG in isoform 2, isoform 5 and isoform 6. 1 PublicationVSP_003923
    Alternative sequencei4459 – 447618VQSII…ICVRL → MKKFRVSLVSKVGKQKYV in isoform 3. 1 PublicationVSP_012349Add
    BLAST
    Alternative sequencei4570 – 45701K → KPTDGTKVVSHPITGEIQ in isoform 2, isoform 3, isoform 5 and isoform 6. 2 PublicationsVSP_003924
    Alternative sequencei4612 – 46121G → GQVMVVQNAS in isoform 2, isoform 5 and isoform 6. 1 PublicationVSP_003925
    Alternative sequencei4793 – 47975TAHKS → SKRRK in isoform 2, isoform 3 and isoform 6. 2 PublicationsVSP_003926
    Alternative sequencei4794 – 485461Missing in isoform 5. CuratedVSP_041009Add
    BLAST
    Alternative sequencei4798 – 5065268Missing in isoform 2, isoform 3 and isoform 6. 2 PublicationsVSP_003927Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AC004006 Genomic DNA. No translation available.
    AC004082 Genomic DNA. Translation: AAB97937.1. Sequence problems.
    AC080093 Genomic DNA. No translation available.
    AC004886 Genomic DNA. Translation: AAD21789.2. Sequence problems.
    AC004903 Genomic DNA. No translation available.
    AC093461 Genomic DNA. No translation available.
    CH236949 Genomic DNA. Translation: EAL24187.1.
    BC001304 mRNA. Translation: AAH01304.2.
    BC122565 mRNA. Translation: AAI22566.1.
    BC125271 mRNA. Translation: AAI25272.1.
    Y19188 mRNA. Translation: CAB60727.1.
    AB011131 mRNA. Translation: BAA25485.1.
    CCDSiCCDS47630.1. [Q9Y6V0-5]
    CCDS47631.1. [Q9Y6V0-6]
    PIRiT00332.
    T00634.
    RefSeqiNP_055325.2. NM_014510.2. [Q9Y6V0-6]
    NP_149015.2. NM_033026.5. [Q9Y6V0-5]
    UniGeneiHs.12376.

    Genome annotation databases

    EnsembliENST00000333891; ENSP00000334319; ENSG00000186472. [Q9Y6V0-5]
    ENST00000423517; ENSP00000388393; ENSG00000186472. [Q9Y6V0-6]
    GeneIDi27445.
    KEGGihsa:27445.
    UCSCiuc003uhu.1. human. [Q9Y6V0-3]
    uc003uhv.2. human. [Q9Y6V0-6]
    uc003uhx.2. human. [Q9Y6V0-5]

    Polymorphism databases

    DMDMi332278245.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AC004006 Genomic DNA. No translation available.
    AC004082 Genomic DNA. Translation: AAB97937.1 . Sequence problems.
    AC080093 Genomic DNA. No translation available.
    AC004886 Genomic DNA. Translation: AAD21789.2 . Sequence problems.
    AC004903 Genomic DNA. No translation available.
    AC093461 Genomic DNA. No translation available.
    CH236949 Genomic DNA. Translation: EAL24187.1 .
    BC001304 mRNA. Translation: AAH01304.2 .
    BC122565 mRNA. Translation: AAI22566.1 .
    BC125271 mRNA. Translation: AAI25272.1 .
    Y19188 mRNA. Translation: CAB60727.1 .
    AB011131 mRNA. Translation: BAA25485.1 .
    CCDSi CCDS47630.1. [Q9Y6V0-5 ]
    CCDS47631.1. [Q9Y6V0-6 ]
    PIRi T00332.
    T00634.
    RefSeqi NP_055325.2. NM_014510.2. [Q9Y6V0-6 ]
    NP_149015.2. NM_033026.5. [Q9Y6V0-5 ]
    UniGenei Hs.12376.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    1UJD NMR - A 4441-4480 [» ]
    ProteinModelPortali Q9Y6V0.
    SMRi Q9Y6V0. Positions 4567-4693.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 118178. 5 interactions.
    IntActi Q9Y6V0. 3 interactions.
    MINTi MINT-4542387.
    STRINGi 9606.ENSP00000411633.

    PTM databases

    PhosphoSitei Q9Y6V0.

    Polymorphism databases

    DMDMi 332278245.

    Proteomic databases

    MaxQBi Q9Y6V0.
    PaxDbi Q9Y6V0.
    PRIDEi Q9Y6V0.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000333891 ; ENSP00000334319 ; ENSG00000186472 . [Q9Y6V0-5 ]
    ENST00000423517 ; ENSP00000388393 ; ENSG00000186472 . [Q9Y6V0-6 ]
    GeneIDi 27445.
    KEGGi hsa:27445.
    UCSCi uc003uhu.1. human. [Q9Y6V0-3 ]
    uc003uhv.2. human. [Q9Y6V0-6 ]
    uc003uhx.2. human. [Q9Y6V0-5 ]

    Organism-specific databases

    CTDi 27445.
    GeneCardsi GC07M082383.
    HGNCi HGNC:13406. PCLO.
    HPAi HPA015858.
    HPA029579.
    MIMi 604918. gene.
    neXtProti NX_Q9Y6V0.
    PharmGKBi PA33072.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG12793.
    HOVERGENi HBG074340.
    InParanoidi Q9Y6V0.
    KOi K16882.
    OMAi DQVEPGK.
    OrthoDBi EOG73805D.
    TreeFami TF326082.

    Miscellaneous databases

    ChiTaRSi PCLO. human.
    EvolutionaryTracei Q9Y6V0.
    GeneWikii PCLO.
    GenomeRNAii 27445.
    NextBioi 50526.
    PROi Q9Y6V0.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9Y6V0.
    Bgeei Q9Y6V0.
    CleanExi HS_PCLO.
    Genevestigatori Q9Y6V0.

    Family and domain databases

    Gene3Di 2.60.40.150. 2 hits.
    3.30.40.10. 1 hit.
    InterProi IPR000008. C2_dom.
    IPR001565. Synaptotagmin.
    IPR011011. Znf_FYVE_PHD.
    IPR008899. Znf_piccolo.
    IPR013083. Znf_RING/FYVE/PHD.
    [Graphical view ]
    Pfami PF00168. C2. 2 hits.
    PF05715. zf-piccolo. 2 hits.
    [Graphical view ]
    PRINTSi PR00360. C2DOMAIN.
    PR00399. SYNAPTOTAGMN.
    SMARTi SM00239. C2. 2 hits.
    [Graphical view ]
    SUPFAMi SSF49562. SSF49562. 2 hits.
    SSF57903. SSF57903. 2 hits.
    PROSITEi PS50004. C2. 2 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "The DNA sequence of human chromosome 7."
      Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L.
      , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
      Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 21-607 (ISOFORMS 5/6).
      Tissue: Placenta.
    4. "Aczonin, a 550-kd putative scaffolding protein of presynaptic active zones, shares homology regions with rim and bassoon and binds profilin."
      Wang X., Kibschull M., Laue M.M., Lichte B., Petrasch-Parwez E., Kilimann M.W.
      J. Cell Biol. 147:151-162(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 37-795 (ISOFORMS 1/2).
      Tissue: Brain.
    5. "Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro."
      Nagase T., Ishikawa K., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
      DNA Res. 5:31-39(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 3655-5065 (ISOFORM 2).
      Tissue: Brain.
    6. "Solution structure of RSGI RUH-003, a PDZ domain of hypothetical KIAA0559 protein from human."
      RIKEN structural genomics initiative (RSGI)
      Submitted (JAN-2004) to the PDB data bank
      Cited for: STRUCTURE BY NMR OF 4390-4480.

    Entry informationi

    Entry nameiPCLO_HUMAN
    AccessioniPrimary (citable) accession number: Q9Y6V0
    Secondary accession number(s): A4D1A7
    , A6NNX9, O43373, O60305, Q08E72, Q9BVC8, Q9UIV2, Q9Y6U9
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 19, 2002
    Last sequence update: May 3, 2011
    Last modified: October 1, 2014
    This is version 140 of the entry and version 4 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 7
      Human chromosome 7: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3