SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9Y6V0

- PCLO_HUMAN

UniProt

Q9Y6V0 - PCLO_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Protein piccolo

Gene
PCLO, ACZ, KIAA0559
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

May act as a scaffolding protein involved in the organization of synaptic active zones and in synaptic vesicle trafficking By similarity.By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri535 – 55925C4-type Reviewed predictionAdd
BLAST
Zinc fingeri1005 – 102824C4-type Reviewed predictionAdd
BLAST

GO - Molecular functioni

  1. calcium-dependent phospholipid binding Source: UniProtKB
  2. calcium ion binding Source: UniProtKB
  3. profilin binding Source: UniProtKB
  4. transporter activity Source: InterPro

GO - Biological processi

  1. cAMP-mediated signaling Source: Ensembl
  2. cytoskeleton organization Source: UniProtKB
  3. insulin secretion Source: Ensembl
  4. regulation of exocytosis Source: Ensembl
  5. synaptic vesicle exocytosis Source: UniProtKB
Complete GO annotation...

Keywords - Ligandi

Calcium, Calcium/phospholipid-binding, Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Protein piccolo
Alternative name(s):
Aczonin
Gene namesi
Name:PCLO
Synonyms:ACZ, KIAA0559
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 7

Organism-specific databases

HGNCiHGNC:13406. PCLO.

Subcellular locationi

Cell junctionsynapse By similarity
Note: Concentrated at the presynaptic side of synaptic junctions By similarity.

GO - Cellular componenti

  1. cell junction Source: UniProtKB-KW
  2. cytoskeleton Source: UniProtKB
  3. membrane Source: InterPro
  4. synapse Source: UniProtKB
  5. synaptic vesicle Source: InterPro
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Synapse

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA33072.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 50655065Protein piccoloPRO_0000058250Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1762 – 17621Phosphoserine By similarity
Modified residuei3378 – 33781Phosphothreonine By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ9Y6V0.
PaxDbiQ9Y6V0.
PRIDEiQ9Y6V0.

PTM databases

PhosphoSiteiQ9Y6V0.

Expressioni

Gene expression databases

ArrayExpressiQ9Y6V0.
BgeeiQ9Y6V0.
CleanExiHS_PCLO.
GenevestigatoriQ9Y6V0.

Organism-specific databases

HPAiHPA015858.
HPA029579.

Interactioni

Subunit structurei

Interacts with RABAC1/PRA1, RIMS2 and profilin By similarity.

Protein-protein interaction databases

BioGridi118178. 5 interactions.
IntActiQ9Y6V0. 3 interactions.
MINTiMINT-4542387.
STRINGi9606.ENSP00000411633.

Structurei

Secondary structure

1
5065
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi4442 – 44465
Helixi4456 – 44638
Beta strandi4470 – 44778

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1UJDNMR-A4441-4480[»]
ProteinModelPortaliQ9Y6V0.
SMRiQ9Y6V0. Positions 4567-4693.

Miscellaneous databases

EvolutionaryTraceiQ9Y6V0.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini4427 – 447852PDZAdd
BLAST
Domaini4565 – 4669105C2 1Add
BLAST
Domaini4934 – 5039106C2 2Add
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni397 – 50110510 X 10 AA tandem approximate repeats of P-A-K-P-Q-P-Q-Q-P-XAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi193 – 499307Gln-richAdd
BLAST
Compositional biasi209 – 975767Pro-richAdd
BLAST
Compositional biasi2303 – 2464162Pro-richAdd
BLAST
Compositional biasi2336 – 236126Poly-ProAdd
BLAST
Compositional biasi3141 – 3248108Gln-richAdd
BLAST
Compositional biasi3792 – 3896105Gln-richAdd
BLAST
Compositional biasi4215 – 427864Ser-richAdd
BLAST
Compositional biasi4699 – 476567Ser-richAdd
BLAST

Domaini

C2 domain 1 is involved in binding calcium and phospholipids. Calcium binds with low affinity but with high specificity and induces a large conformational change.By similarity

Sequence similaritiesi

Contains 2 C2 domains.
Contains 1 PDZ (DHR) domain.

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiNOG12793.
HOVERGENiHBG074340.
InParanoidiQ9Y6V0.
KOiK16882.
OMAiDQVEPGK.
OrthoDBiEOG73805D.
TreeFamiTF326082.

Family and domain databases

Gene3Di2.60.40.150. 2 hits.
3.30.40.10. 1 hit.
InterProiIPR000008. C2_dom.
IPR001565. Synaptotagmin.
IPR011011. Znf_FYVE_PHD.
IPR008899. Znf_piccolo.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view]
PfamiPF00168. C2. 2 hits.
PF05715. zf-piccolo. 2 hits.
[Graphical view]
PRINTSiPR00360. C2DOMAIN.
PR00399. SYNAPTOTAGMN.
SMARTiSM00239. C2. 2 hits.
[Graphical view]
SUPFAMiSSF49562. SSF49562. 2 hits.
SSF57903. SSF57903. 2 hits.
PROSITEiPS50004. C2. 2 hits.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. Align

Note: Additional isoforms seem to exist.

Isoform 1 (identifier: Q9Y6V0-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MGNEASLEGE GLPEGLAAAA AAGGGASGAG SPSHTAIPAG MEADLSQLSE     50
EERRQIAAVM SRAQGLPKGS VPPAAAESPS MHRKQELDSS HPPKQSGRPP 100
DPGRPAQPGL SKSRTTDTFR SEQKLPGRSP STISLKESKS RTDLKEEHKS 150
SMMPGFLSEV NALSAVSSVV NKFNPFDLIS DSEASQEETT KKQKVVQKEQ 200
GKPEGIIKPP LQQQPPKPIP KQQGPGRDPL QQDGTPKSIS SQQPEKIKSQ 250
PPGTGKPIQG PTQTPQTDHA KLPLQRDASR PQTKQADIVR GESVKPSLPS 300
PSKPPIQQPT PGKPPAQQPG HEKSQPGPAK PPAQPSGLTK PLAQQPGTVK 350
PPVQPPGTTK PPAQPLGPAK PPAQQTGSEK PSSEQPGPKA LAQPPGVGKT 400
PAQQPGPAKP PTQQVGTPKP LAQQPGLQSP AKAPGPTKTP VQAKPPSQQP 450
GSTKPPPQQP GPAKPSPQQP GSTKPPSQQP GSAKPSAQQP SPAKPSAQQS 500
TKPVSQTGSG KPLQPPTVSP SAKQPPSQGL PKTICPLCNT TELLLHVPEK 550
ANFNTCTECQ TTVCSLCGFN PNPHLTEVKE WLCLNCQMKR ALGGDLAPVP 600
SSPQPKLKTA PVTTTSAVSK SSPQPQQTSP KKDAAPKQDL SKAPEPKKPP 650
PLVKQPTLHG SPSAKAKQPP EADSLSKPAP PKEPSVPSEQ DKAPVADDKP 700
KQPKMVKPTT DLVSSSSATT KPDIPSSKVQ SQAEEKTTPP LKTDSAKPSQ 750
SFPPTGEKVS PFDSKAIPRP ASDSKIISHP GPSSESKGQK QVDPVQKKEE 800
PKKAQTKMSP KPDAKPMPKG SPTPPGPRPT AGQTVPTPQQ SPKPQEQSRR 850
FSLNLGSITD APKSQPTTPQ ETVTGKLFGF GASIFSQASN LISTAGQPGP 900
HSQSGPGAPM KQAPAPSQPP TSQGPPKSTG QAPPAPAKSI PVKKETKAPA 950
AEKLEPKAEQ APTVKRTETE KKPPPIKDSK SLTAEPQKAV LPTKLEKSPK 1000
PESTCPLCKT ELNIGSKDPP NFNTCTECKN QVCNLCGFNP TPHLTENCQT 1050
QRAISGQLGD IRKMPPAPSG PKASPMPVPT ESSSQKTAVP PQVKLVKKQE 1100
QEVKTEAEKV ILEKVKETLS MEKIPPMVTT DQKQEESKLE KDKASALQEK 1150
KPLPEEKKLI PEEEKIRSEE KKPLLEEKKP TPEDKKLLPE AKTSAPEEQK 1200
HDLLKSQVQI AEEKLEGRVA PKTVQEGKQP QTKMEGLPSG TPQSLPKEDD 1250
KTTKTIKEQP QPPCTAKPDQ EKEDDKSDTS SSQQPKSPQG LSDTGYSSDG 1300
ISSSLGEIPS LIPTDEKDIL KGLKKDSFSQ ESSPSSPSDL AKLESTVLSI 1350
LEAQASTLAD EKSEKKTQPH EVSPEQPKDQ EKTQSLSETL EITISEEEIK 1400
ESQEERKDTF KKDSQQDIPS SKDHKEKSEF VDDITTRREP YDSVEESSES 1450
ENSPVPQRKR RTSVGSSSSD EYKQEDSQGS GEEEDFIRKQ IIEMSADEDA 1500
SGSEDDEFIR NQLKEISSST ESQKKEETKG KGKITAGKHR RLTRKSSTSI 1550
DEDAGRRHSW HDEDDEAFDE SPELKYRETK SQESEELVVT GGGGLRRFKT 1600
IELNSTIADK YSAESSQKKT SLYFDEEPEL EMESLTDSPE DRSRGEGSSS 1650
LHASSFTPGT SPTSVSSLDE DSDSSPSHKK GESKQQRKAR HRPHGPLLPT 1700
IEDSSEEEEL REEEELLKEQ EKQREIEQQQ RKSSSKKSKK DKDELRAQRR 1750
RERPKTPPSN LSPIEDASPT EELRQAAEME ELHRSSCSEY SPSIESDPEG 1800
FEISPEKIIE VQKVYKLPTA VSLYSPTDEQ SIMQKEGSQK ALKSAEEMYE 1850
EMMHKTHKYK AFPAANERDE VFEKEPLYGG MLIEDYIYES LVEDTYNGSV 1900
DGSLLTRQEE ENGFMQQKGR EQKIRLSEQI YEDPMQKITD LQKEFYELES 1950
LHSVVPQEDI VSSSFIIPES HEIVDLGTMV TSTEEERKLL DADAAYEELM 2000
KRQQMQLTPG SSPTQAPIGE DMTESTMDFD RMPDASLTSS VLSGASLTDS 2050
TSSATLSIPD VKITQHFSTE EIEDEYVTDY TREIQEIIAH ESLILTYSEP 2100
SESATSVPPS DTPSLTSSVS SVCTTDSSSP ITTLDSITTV YTEPVDMITK 2150
FEDSEEISSS TYFPGSIIDY PEEISVSLDR TAPPDGRASA DHIVISLSDM 2200
ASSIIESVVP KPEGPVADTV STDLLISEKD PVKKAKKETG NGIILEVLEA 2250
YRDKKELEAE RTKSSLSETV FDHPPSSVIA LPMKEQLSTT YFTSGETFGQ 2300
EKPASQLPSG SPSVSSLPAK PRPFFRSSSL DISAQPPPPP PPPPPPPPPP 2350
PPPPPPPLPP PTSPKPTILP KKKLTVASPV TTATPLFDAV TTLETTAVLR 2400
SNGLPVTRIC TTAPPPVPPK PSSIPSGLVF THRPEPSKPP IAPKPVIPQL 2450
PTTTQKPTDI HPKPTGLSLT SSMTLNLVTS ADYKLPSPTS PLSPHSNKSS 2500
PRFSKSLTET YVVITLPSEP GTPTDSSASQ AITSWPLGSP SKDLVSVEPV 2550
FSVVPPVTAV EIPISSEQTF YISGALQTFS ATPVTAPSSF QAAPTSVTQF 2600
LTTEVSKTEV SATRSTAPSV GLSSISITIP PEPLALDNIH LEKPQYKEDG 2650
KLQLVGDVID LRTVPKVEVK TTDKCIDLSA STMDVKRQIT ANEVYGKQIS 2700
AVQPSIINLS VTSSIVTPVS LATETVTFVT CTASASYTTG TESLVGAEHA 2750
MTTPLQLTTS KHAEPPYRIP SDQVFPIARE EAPINLSLGT PAHAVTLAIT 2800
KPVTVPPVGV TNGWTDSTVS QGITDGEVVD LSTTKSHRTV VTMDESTSSV 2850
MTKIIEDEKP VDLTAGRRAV CCDVVYKLPF GRSCTAQQPA TTLPEDRFGY 2900
RDDHYQYDRS GPYGYRGIGG MKPSMSDTNL AEAGHFFYKS KNAFDYSEGT 2950
DTAVDLTSGR VTTGEVMDYS SKTTGPYPET RQVISGAGIS TPQYSTARMT 3000
PPPGPQYCVG SVLRSSNGVV YSSVATPTPS TFAITTQPGS IFSTTVRDLS 3050
GIHTADAVTS LPAMHHSQPM PRSYFITTGA SETDIAVTGI DISASLQTIT 3100
MESLTAETID SVPTLTTASE VFPEVVGDES ALLIVPEEDK QQQQLDLERE 3150
LLELEKIKQQ RFAEELEWER QEIQRFREQE KIMVQKKLEE LQSMKQHLLF 3200
QQEEERQAQF MMRQETLAQQ QLQLEQIQQL QQQLHQQLEE QKIRQIYQYN 3250
YDPSGTASPQ TTTEQAILEG QYAALEGSQF WATEDATTTA SAVVAIEIPQ 3300
SQGWYTVQSD GVTQYIAPPG ILSTVSEIPL TDVVVKEEKQ PKKRSSGAKV 3350
RGQYDDMGEN MTDDPRSFKK IVDSGVQTDD EDATDRSYVS RRRRTKKSVD 3400
TSVQTDDEDQ DEWDMPTRSR RKARVGKYGD SMTEADKTKP LSKVSSIAVQ 3450
TVAEISVQTE PVGTIRTPSI RARVDAKVEI IKHISAPEKT YKGGSLGCQT 3500
EADSDTQSPQ YLSATSPPKD KKRPTPLEIG YSSHLRADST VQLAPSPPKS 3550
PKVLYSPISP LSPGKALESA FVPYEKPLPD DISPQKVLHP DMAKVPPASP 3600
KTAKMMQRSM SDPKPLSPTA DESSRAPFQY TEGYTTKGSQ TMTSSGAQKK 3650
VKRTLPNPPP EEISTGTQST FSTMGTVSRR RICRTNTMAR AKILQDIDRE 3700
LDLVERESAK LRKKQAELDE EEKEIDAKLR YLEMGINRRK EALLKEREKR 3750
ERAYLQGVAE DRDYMSDSEV SSTRPTRIES QHGIERPRTA PQTEFSQFIP 3800
PQTQTESQLV PPTSPYTQYQ YSSPALPTQA PTSYTQQSHF EQQTLYHQQV 3850
SPYQTQPTFQ AVATMSFTPQ VQPTPTPQPS YQLPSQMMVI QQKPRQTTLY 3900
LEPKITSNYE VIRNQPLMIA PVSTDNTFAV SHLGSKYNSL DLRIGLEERS 3950
SMASSPISSI SADSFYADID HHTPRNYVLI DDIGEITKGT AALSTAFSLH 4000
EKDLSKTDRL LRTTETRRSQ EVTDFLAPLQ SSSRLHSYVK AEEDPMEDPY 4050
ELKLLKHQIK QEFRRGTESL DHLAGLSHYY HADTSYRHFP KSEKYSISRL 4100
TLEKQAAKQL PAAILYQKQS KHKKSLIDPK MSKFSPIQES RDLEPDYSSY 4150
MTSSTSSIGG ISSRARLLQD DITFGLRKNI TDQQKFMGSS LGTGLGTLGN 4200
TIRSALQDEA DKPYSSGSRS RPSSRPSSVY GLDLSIKRDS SSSSLRLKAQ 4250
EAEALDVSFS HASSSARTKP TSLPISQSRG RIPIVAQNSE EESPLSPVGQ 4300
PMGMARAAAG PLPPISADTR DQFGSSHSLP EVQQHMREES RTRGYDRDIA 4350
FIMDDFQHAM SDSEAYHLRR EETDWFDKPR ESRLENGHGL DRKLPERLVH 4400
SRPLSQHQEQ IIQMNGKTMH YIFPHARIKI TRDSKDHTVS MQVLEWNGIP 4450
LTSKTYEEVQ SIISQQSGEA EICVRLDLNM LSDSENSQHL ELHEPPKAVD 4500
KAKSPGVDPK QLAAELQKVS LQQSPLVLSS VVEKGSHVHS GPTSAGSSSV 4550
PSPGQPGSPS VSKKKHGSSK LQINYDLGNL IIHILQARNL VPRDNNGYSD 4600
PFVKVYLLPG RGAEYKRRTK HVQKSLNPEW NQTVIYKSIS MEQLKKKTLE 4650
VTVWDYDRFS SNDFLGEVLI DLSSTSHLDN TPRWYPLKEQ TESIDHGKSH 4700
SSQSSQQSPK PSVIKSRSHG IFPDPSKDMQ VPTIEKSHSS PGSSKSSSEG 4750
HLRSHGPSRS QSKTSVTQTH LEDAGAAIAA AEAAVQQLRI QPTAHKSGQS 4800
NHARKQHRHS IAGVLPIQRT QSDNLPPPAN GNQDQSQLAL RKVMSDGPVK 4850
PEGAKPPNHR PAESSVSTGS SGSSFGSGYS VDSEGSSSTA GETNLFPIPR 4900
IGKMGQNGQE PVKQPGVGVG LADTEAKTQV MGEIKIALKK EMKTDGEQLI 4950
VEILQCRNIT YKFKSPDHLP DLYVKIYVMN ISTQKKVIKK KTRVCRHDRE 5000
PSFNETFRFS LSPAGHSLQI LLFSNGGKFM KKTLIGEACI WLDKVDLRKR 5050
IVNWHKLLVS PTQTH 5065
Length:5,065
Mass (Da):553,277
Last modified:May 3, 2011 - v4
Checksum:i0CE4F2990F74AFFF
GO
Isoform 2 (identifier: Q9Y6V0-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     4440-4440: S → SGNGLGIRIVGGKEIPGHSGEIGAYIAKILPGGSAEQTGKLMEG
     4570-4570: K → KPTDGTKVVSHPITGEIQ
     4612-4612: G → GQVMVVQNAS
     4793-4797: TAHKS → SKRRK
     4798-5065: Missing.

Show »
Length:4,866
Mass (Da):530,858
Checksum:iC9939ED01362785E
GO
Isoform 3 (identifier: Q9Y6V0-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-4458: Missing.
     4459-4476: VQSIISQQSGEAEICVRL → MKKFRVSLVSKVGKQKYV
     4570-4570: K → KPTDGTKVVSHPITGEIQ
     4793-4797: TAHKS → SKRRK
     4798-5065: Missing.

Note: No experimental confirmation available.

Show »
Length:356
Mass (Da):39,047
Checksum:iB515BD682ECC0154
GO
Isoform 4 (identifier: Q9Y6V0-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     443-490: AKPPSQQPGS...GSAKPSAQQP → HKAPISTAWL...WLSKTLSSTA
     491-5065: Missing.

Note: No experimental confirmation available.

Show »
Length:490
Mass (Da):51,012
Checksum:i6F57A26F73587277
GO
Isoform 5 (identifier: Q9Y6V0-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     442-442: Q → QQPGPGKIPAQQAGPGKTSAQQTGPTKPPSQLPGPAKPPPQQPGPAKPPPQQPGS
     1046-1046: E → EIQEWLCL
     1270-1270: Q → QVEPGKEKT
     4440-4440: S → SGNGLGIRIVGGKEIPGHSGEIGAYIAKILPGGSAEQTGKLMEG
     4570-4570: K → KPTDGTKVVSHPITGEIQ
     4612-4612: G → GQVMVVQNAS
     4794-4854: Missing.

Note: No experimental confirmation available.

Show »
Length:5,142
Mass (Da):560,699
Checksum:i18F145349952C935
GO
Isoform 6 (identifier: Q9Y6V0-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     442-442: Q → QQPGPGKIPAQQAGPGKTSAQQTGPTKPPSQLPGPAKPPPQQPGPAKPPPQQPGS
     1046-1046: E → EIQEWLCL
     1270-1270: Q → QVEPGKEKT
     4440-4440: S → SGNGLGIRIVGGKEIPGHSGEIGAYIAKILPGGSAEQTGKLMEG
     4570-4570: K → KPTDGTKVVSHPITGEIQ
     4612-4612: G → GQVMVVQNAS
     4793-4797: TAHKS → SKRRK
     4798-5065: Missing.

Note: No experimental confirmation available.

Show »
Length:4,935
Mass (Da):537,886
Checksum:iE9D027F9FB9879F2
GO

Sequence cautioni

The sequence AAB97937.1 differs from that shown. Reason: Erroneous gene model prediction.
The sequence AAD21789.2 differs from that shown. Reason: Erroneous gene model prediction.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti2602 – 26021T → P.
Corresponds to variant rs10261848 [ dbSNP | Ensembl ].
VAR_056959
Natural varianti2735 – 27351A → T.
Corresponds to variant rs976714 [ dbSNP | Ensembl ].
VAR_056960

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 44584458Missing in isoform 3. VSP_012348Add
BLAST
Alternative sequencei442 – 4421Q → QQPGPGKIPAQQAGPGKTSA QQTGPTKPPSQLPGPAKPPP QQPGPAKPPPQQPGS in isoform 5 and isoform 6. VSP_041004
Alternative sequencei443 – 49048AKPPS…SAQQP → HKAPISTAWLNKTPTSTAWP SKALTSTAWLNKTPISTAWL SKTLSSTA in isoform 4. VSP_041005Add
BLAST
Alternative sequencei491 – 50654575Missing in isoform 4. VSP_041006Add
BLAST
Alternative sequencei1046 – 10461E → EIQEWLCL in isoform 5 and isoform 6. VSP_041007
Alternative sequencei1270 – 12701Q → QVEPGKEKT in isoform 5 and isoform 6. VSP_041008
Alternative sequencei4440 – 44401S → SGNGLGIRIVGGKEIPGHSG EIGAYIAKILPGGSAEQTGK LMEG in isoform 2, isoform 5 and isoform 6. VSP_003923
Alternative sequencei4459 – 447618VQSII…ICVRL → MKKFRVSLVSKVGKQKYV in isoform 3. VSP_012349Add
BLAST
Alternative sequencei4570 – 45701K → KPTDGTKVVSHPITGEIQ in isoform 2, isoform 3, isoform 5 and isoform 6. VSP_003924
Alternative sequencei4612 – 46121G → GQVMVVQNAS in isoform 2, isoform 5 and isoform 6. VSP_003925
Alternative sequencei4793 – 47975TAHKS → SKRRK in isoform 2, isoform 3 and isoform 6. VSP_003926
Alternative sequencei4794 – 485461Missing in isoform 5. VSP_041009Add
BLAST
Alternative sequencei4798 – 5065268Missing in isoform 2, isoform 3 and isoform 6. VSP_003927Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti441 – 4411V → A in CAB60727. 1 Publication
Sequence conflicti443 – 4431A → T in CAB60727. 1 Publication
Sequence conflicti447 – 4471S → P in AAI22566. 1 Publication
Sequence conflicti500 – 5001S → F in CAB60727. 1 Publication
Sequence conflicti509 – 5091S → F in CAB60727. 1 Publication
Sequence conflicti578 – 5781V → A in CAB60727. 1 Publication
Sequence conflicti760 – 7601S → T in CAB60727. 1 Publication
Sequence conflicti4676 – 46761S → A in AAH01304. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AC004006 Genomic DNA. No translation available.
AC004082 Genomic DNA. Translation: AAB97937.1. Sequence problems.
AC080093 Genomic DNA. No translation available.
AC004886 Genomic DNA. Translation: AAD21789.2. Sequence problems.
AC004903 Genomic DNA. No translation available.
AC093461 Genomic DNA. No translation available.
CH236949 Genomic DNA. Translation: EAL24187.1.
BC001304 mRNA. Translation: AAH01304.2.
BC122565 mRNA. Translation: AAI22566.1.
BC125271 mRNA. Translation: AAI25272.1.
Y19188 mRNA. Translation: CAB60727.1.
AB011131 mRNA. Translation: BAA25485.1.
CCDSiCCDS47630.1. [Q9Y6V0-5]
CCDS47631.1. [Q9Y6V0-6]
PIRiT00332.
T00634.
RefSeqiNP_055325.2. NM_014510.2. [Q9Y6V0-6]
NP_149015.2. NM_033026.5. [Q9Y6V0-5]
UniGeneiHs.12376.

Genome annotation databases

EnsembliENST00000333891; ENSP00000334319; ENSG00000186472. [Q9Y6V0-5]
ENST00000423517; ENSP00000388393; ENSG00000186472. [Q9Y6V0-6]
GeneIDi27445.
KEGGihsa:27445.
UCSCiuc003uhu.1. human. [Q9Y6V0-3]
uc003uhv.2. human. [Q9Y6V0-6]
uc003uhx.2. human. [Q9Y6V0-5]

Polymorphism databases

DMDMi332278245.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AC004006 Genomic DNA. No translation available.
AC004082 Genomic DNA. Translation: AAB97937.1 . Sequence problems.
AC080093 Genomic DNA. No translation available.
AC004886 Genomic DNA. Translation: AAD21789.2 . Sequence problems.
AC004903 Genomic DNA. No translation available.
AC093461 Genomic DNA. No translation available.
CH236949 Genomic DNA. Translation: EAL24187.1 .
BC001304 mRNA. Translation: AAH01304.2 .
BC122565 mRNA. Translation: AAI22566.1 .
BC125271 mRNA. Translation: AAI25272.1 .
Y19188 mRNA. Translation: CAB60727.1 .
AB011131 mRNA. Translation: BAA25485.1 .
CCDSi CCDS47630.1. [Q9Y6V0-5 ]
CCDS47631.1. [Q9Y6V0-6 ]
PIRi T00332.
T00634.
RefSeqi NP_055325.2. NM_014510.2. [Q9Y6V0-6 ]
NP_149015.2. NM_033026.5. [Q9Y6V0-5 ]
UniGenei Hs.12376.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
1UJD NMR - A 4441-4480 [» ]
ProteinModelPortali Q9Y6V0.
SMRi Q9Y6V0. Positions 4567-4693.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 118178. 5 interactions.
IntActi Q9Y6V0. 3 interactions.
MINTi MINT-4542387.
STRINGi 9606.ENSP00000411633.

PTM databases

PhosphoSitei Q9Y6V0.

Polymorphism databases

DMDMi 332278245.

Proteomic databases

MaxQBi Q9Y6V0.
PaxDbi Q9Y6V0.
PRIDEi Q9Y6V0.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000333891 ; ENSP00000334319 ; ENSG00000186472 . [Q9Y6V0-5 ]
ENST00000423517 ; ENSP00000388393 ; ENSG00000186472 . [Q9Y6V0-6 ]
GeneIDi 27445.
KEGGi hsa:27445.
UCSCi uc003uhu.1. human. [Q9Y6V0-3 ]
uc003uhv.2. human. [Q9Y6V0-6 ]
uc003uhx.2. human. [Q9Y6V0-5 ]

Organism-specific databases

CTDi 27445.
GeneCardsi GC07M082383.
HGNCi HGNC:13406. PCLO.
HPAi HPA015858.
HPA029579.
MIMi 604918. gene.
neXtProti NX_Q9Y6V0.
PharmGKBi PA33072.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG12793.
HOVERGENi HBG074340.
InParanoidi Q9Y6V0.
KOi K16882.
OMAi DQVEPGK.
OrthoDBi EOG73805D.
TreeFami TF326082.

Miscellaneous databases

ChiTaRSi PCLO. human.
EvolutionaryTracei Q9Y6V0.
GeneWikii PCLO.
GenomeRNAii 27445.
NextBioi 50526.
PROi Q9Y6V0.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q9Y6V0.
Bgeei Q9Y6V0.
CleanExi HS_PCLO.
Genevestigatori Q9Y6V0.

Family and domain databases

Gene3Di 2.60.40.150. 2 hits.
3.30.40.10. 1 hit.
InterProi IPR000008. C2_dom.
IPR001565. Synaptotagmin.
IPR011011. Znf_FYVE_PHD.
IPR008899. Znf_piccolo.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view ]
Pfami PF00168. C2. 2 hits.
PF05715. zf-piccolo. 2 hits.
[Graphical view ]
PRINTSi PR00360. C2DOMAIN.
PR00399. SYNAPTOTAGMN.
SMARTi SM00239. C2. 2 hits.
[Graphical view ]
SUPFAMi SSF49562. SSF49562. 2 hits.
SSF57903. SSF57903. 2 hits.
PROSITEi PS50004. C2. 2 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "The DNA sequence of human chromosome 7."
    Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L.
    , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
    Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 21-607 (ISOFORMS 5/6).
    Tissue: Placenta.
  4. "Aczonin, a 550-kd putative scaffolding protein of presynaptic active zones, shares homology regions with rim and bassoon and binds profilin."
    Wang X., Kibschull M., Laue M.M., Lichte B., Petrasch-Parwez E., Kilimann M.W.
    J. Cell Biol. 147:151-162(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 37-795 (ISOFORMS 1/2).
    Tissue: Brain.
  5. "Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro."
    Nagase T., Ishikawa K., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
    DNA Res. 5:31-39(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 3655-5065 (ISOFORM 2).
    Tissue: Brain.
  6. "Solution structure of RSGI RUH-003, a PDZ domain of hypothetical KIAA0559 protein from human."
    RIKEN structural genomics initiative (RSGI)
    Submitted (JAN-2004) to the PDB data bank
    Cited for: STRUCTURE BY NMR OF 4390-4480.

Entry informationi

Entry nameiPCLO_HUMAN
AccessioniPrimary (citable) accession number: Q9Y6V0
Secondary accession number(s): A4D1A7
, A6NNX9, O43373, O60305, Q08E72, Q9BVC8, Q9UIV2, Q9Y6U9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 19, 2002
Last sequence update: May 3, 2011
Last modified: July 9, 2014
This is version 139 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi