Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9Y6V0

- PCLO_HUMAN

UniProt

Q9Y6V0 - PCLO_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Protein piccolo

Gene

PCLO

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

May act as a scaffolding protein involved in the organization of synaptic active zones and in synaptic vesicle trafficking.By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri535 – 55925C4-typeSequence AnalysisAdd
BLAST
Zinc fingeri1005 – 102824C4-typeSequence AnalysisAdd
BLAST

GO - Molecular functioni

  1. calcium-dependent phospholipid binding Source: UniProtKB
  2. calcium ion binding Source: UniProtKB
  3. profilin binding Source: UniProtKB
  4. transporter activity Source: InterPro

GO - Biological processi

  1. cAMP-mediated signaling Source: Ensembl
  2. cytoskeleton organization Source: UniProtKB
  3. insulin secretion Source: Ensembl
  4. regulation of exocytosis Source: Ensembl
  5. synaptic vesicle exocytosis Source: UniProtKB
Complete GO annotation...

Keywords - Ligandi

Calcium, Calcium/phospholipid-binding, Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Protein piccolo
Alternative name(s):
Aczonin
Gene namesi
Name:PCLOBy similarity
Synonyms:ACZImported, KIAA0559
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 7

Organism-specific databases

HGNCiHGNC:13406. PCLO.

Subcellular locationi

Cell junctionsynapse By similarity
Note: Concentrated at the presynaptic side of synaptic junctions.By similarity

GO - Cellular componenti

  1. cell junction Source: UniProtKB-KW
  2. cytoskeleton Source: UniProtKB
  3. membrane Source: InterPro
  4. presynaptic cytoskeletal matrix assembled at active zones Source: ParkinsonsUK-UCL
  5. synapse Source: UniProtKB
  6. synaptic vesicle Source: InterPro
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Synapse

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA33072.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 50655065Protein piccoloPRO_0000058250Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1762 – 17621PhosphoserineBy similarity
Modified residuei3378 – 33781PhosphothreonineBy similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ9Y6V0.
PaxDbiQ9Y6V0.
PRIDEiQ9Y6V0.

PTM databases

PhosphoSiteiQ9Y6V0.

Expressioni

Gene expression databases

BgeeiQ9Y6V0.
CleanExiHS_PCLO.
ExpressionAtlasiQ9Y6V0. baseline and differential.
GenevestigatoriQ9Y6V0.

Organism-specific databases

HPAiHPA015858.
HPA029579.

Interactioni

Subunit structurei

Interacts with RABAC1/PRA1, RIMS2 and profilin.By similarity

Protein-protein interaction databases

BioGridi118178. 6 interactions.
IntActiQ9Y6V0. 3 interactions.
MINTiMINT-4542387.
STRINGi9606.ENSP00000411633.

Structurei

Secondary structure

1
5065
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi4442 – 44465
Helixi4456 – 44638
Beta strandi4470 – 44778

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1UJDNMR-A4441-4480[»]
ProteinModelPortaliQ9Y6V0.
SMRiQ9Y6V0. Positions 4567-4693.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9Y6V0.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini4427 – 447852PDZAdd
BLAST
Domaini4565 – 4669105C2 1PROSITE-ProRule annotationAdd
BLAST
Domaini4934 – 5039106C2 2PROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni397 – 50110510 X 10 AA tandem approximate repeats of P-A-K-P-Q-P-Q-Q-P-XAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi193 – 499307Gln-richAdd
BLAST
Compositional biasi209 – 975767Pro-richAdd
BLAST
Compositional biasi2303 – 2464162Pro-richAdd
BLAST
Compositional biasi2336 – 236126Poly-ProAdd
BLAST
Compositional biasi3141 – 3248108Gln-richAdd
BLAST
Compositional biasi3792 – 3896105Gln-richAdd
BLAST
Compositional biasi4215 – 427864Ser-richAdd
BLAST
Compositional biasi4699 – 476567Ser-richAdd
BLAST

Domaini

C2 domain 1 is involved in binding calcium and phospholipids. Calcium binds with low affinity but with high specificity and induces a large conformational change.By similarity

Sequence similaritiesi

Contains 2 C2 domains.PROSITE-ProRule annotation
Contains 1 PDZ (DHR) domain.Curated

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri535 – 55925C4-typeSequence AnalysisAdd
BLAST
Zinc fingeri1005 – 102824C4-typeSequence AnalysisAdd
BLAST

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiNOG12793.
GeneTreeiENSGT00620000087961.
HOVERGENiHBG074340.
InParanoidiQ9Y6V0.
KOiK16882.
OMAiDQVEPGK.
OrthoDBiEOG73805D.
TreeFamiTF326082.

Family and domain databases

Gene3Di2.60.40.150. 2 hits.
3.30.40.10. 1 hit.
InterProiIPR000008. C2_dom.
IPR001565. Synaptotagmin.
IPR011011. Znf_FYVE_PHD.
IPR008899. Znf_piccolo.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view]
PfamiPF00168. C2. 2 hits.
PF05715. zf-piccolo. 2 hits.
[Graphical view]
PRINTSiPR00360. C2DOMAIN.
PR00399. SYNAPTOTAGMN.
SMARTiSM00239. C2. 2 hits.
[Graphical view]
SUPFAMiSSF49562. SSF49562. 2 hits.
SSF57903. SSF57903. 2 hits.
PROSITEiPS50004. C2. 2 hits.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. Align

Note: Additional isoforms seem to exist.

Isoform 1 (identifier: Q9Y6V0-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGNEASLEGE GLPEGLAAAA AAGGGASGAG SPSHTAIPAG MEADLSQLSE
60 70 80 90 100
EERRQIAAVM SRAQGLPKGS VPPAAAESPS MHRKQELDSS HPPKQSGRPP
110 120 130 140 150
DPGRPAQPGL SKSRTTDTFR SEQKLPGRSP STISLKESKS RTDLKEEHKS
160 170 180 190 200
SMMPGFLSEV NALSAVSSVV NKFNPFDLIS DSEASQEETT KKQKVVQKEQ
210 220 230 240 250
GKPEGIIKPP LQQQPPKPIP KQQGPGRDPL QQDGTPKSIS SQQPEKIKSQ
260 270 280 290 300
PPGTGKPIQG PTQTPQTDHA KLPLQRDASR PQTKQADIVR GESVKPSLPS
310 320 330 340 350
PSKPPIQQPT PGKPPAQQPG HEKSQPGPAK PPAQPSGLTK PLAQQPGTVK
360 370 380 390 400
PPVQPPGTTK PPAQPLGPAK PPAQQTGSEK PSSEQPGPKA LAQPPGVGKT
410 420 430 440 450
PAQQPGPAKP PTQQVGTPKP LAQQPGLQSP AKAPGPTKTP VQAKPPSQQP
460 470 480 490 500
GSTKPPPQQP GPAKPSPQQP GSTKPPSQQP GSAKPSAQQP SPAKPSAQQS
510 520 530 540 550
TKPVSQTGSG KPLQPPTVSP SAKQPPSQGL PKTICPLCNT TELLLHVPEK
560 570 580 590 600
ANFNTCTECQ TTVCSLCGFN PNPHLTEVKE WLCLNCQMKR ALGGDLAPVP
610 620 630 640 650
SSPQPKLKTA PVTTTSAVSK SSPQPQQTSP KKDAAPKQDL SKAPEPKKPP
660 670 680 690 700
PLVKQPTLHG SPSAKAKQPP EADSLSKPAP PKEPSVPSEQ DKAPVADDKP
710 720 730 740 750
KQPKMVKPTT DLVSSSSATT KPDIPSSKVQ SQAEEKTTPP LKTDSAKPSQ
760 770 780 790 800
SFPPTGEKVS PFDSKAIPRP ASDSKIISHP GPSSESKGQK QVDPVQKKEE
810 820 830 840 850
PKKAQTKMSP KPDAKPMPKG SPTPPGPRPT AGQTVPTPQQ SPKPQEQSRR
860 870 880 890 900
FSLNLGSITD APKSQPTTPQ ETVTGKLFGF GASIFSQASN LISTAGQPGP
910 920 930 940 950
HSQSGPGAPM KQAPAPSQPP TSQGPPKSTG QAPPAPAKSI PVKKETKAPA
960 970 980 990 1000
AEKLEPKAEQ APTVKRTETE KKPPPIKDSK SLTAEPQKAV LPTKLEKSPK
1010 1020 1030 1040 1050
PESTCPLCKT ELNIGSKDPP NFNTCTECKN QVCNLCGFNP TPHLTENCQT
1060 1070 1080 1090 1100
QRAISGQLGD IRKMPPAPSG PKASPMPVPT ESSSQKTAVP PQVKLVKKQE
1110 1120 1130 1140 1150
QEVKTEAEKV ILEKVKETLS MEKIPPMVTT DQKQEESKLE KDKASALQEK
1160 1170 1180 1190 1200
KPLPEEKKLI PEEEKIRSEE KKPLLEEKKP TPEDKKLLPE AKTSAPEEQK
1210 1220 1230 1240 1250
HDLLKSQVQI AEEKLEGRVA PKTVQEGKQP QTKMEGLPSG TPQSLPKEDD
1260 1270 1280 1290 1300
KTTKTIKEQP QPPCTAKPDQ EKEDDKSDTS SSQQPKSPQG LSDTGYSSDG
1310 1320 1330 1340 1350
ISSSLGEIPS LIPTDEKDIL KGLKKDSFSQ ESSPSSPSDL AKLESTVLSI
1360 1370 1380 1390 1400
LEAQASTLAD EKSEKKTQPH EVSPEQPKDQ EKTQSLSETL EITISEEEIK
1410 1420 1430 1440 1450
ESQEERKDTF KKDSQQDIPS SKDHKEKSEF VDDITTRREP YDSVEESSES
1460 1470 1480 1490 1500
ENSPVPQRKR RTSVGSSSSD EYKQEDSQGS GEEEDFIRKQ IIEMSADEDA
1510 1520 1530 1540 1550
SGSEDDEFIR NQLKEISSST ESQKKEETKG KGKITAGKHR RLTRKSSTSI
1560 1570 1580 1590 1600
DEDAGRRHSW HDEDDEAFDE SPELKYRETK SQESEELVVT GGGGLRRFKT
1610 1620 1630 1640 1650
IELNSTIADK YSAESSQKKT SLYFDEEPEL EMESLTDSPE DRSRGEGSSS
1660 1670 1680 1690 1700
LHASSFTPGT SPTSVSSLDE DSDSSPSHKK GESKQQRKAR HRPHGPLLPT
1710 1720 1730 1740 1750
IEDSSEEEEL REEEELLKEQ EKQREIEQQQ RKSSSKKSKK DKDELRAQRR
1760 1770 1780 1790 1800
RERPKTPPSN LSPIEDASPT EELRQAAEME ELHRSSCSEY SPSIESDPEG
1810 1820 1830 1840 1850
FEISPEKIIE VQKVYKLPTA VSLYSPTDEQ SIMQKEGSQK ALKSAEEMYE
1860 1870 1880 1890 1900
EMMHKTHKYK AFPAANERDE VFEKEPLYGG MLIEDYIYES LVEDTYNGSV
1910 1920 1930 1940 1950
DGSLLTRQEE ENGFMQQKGR EQKIRLSEQI YEDPMQKITD LQKEFYELES
1960 1970 1980 1990 2000
LHSVVPQEDI VSSSFIIPES HEIVDLGTMV TSTEEERKLL DADAAYEELM
2010 2020 2030 2040 2050
KRQQMQLTPG SSPTQAPIGE DMTESTMDFD RMPDASLTSS VLSGASLTDS
2060 2070 2080 2090 2100
TSSATLSIPD VKITQHFSTE EIEDEYVTDY TREIQEIIAH ESLILTYSEP
2110 2120 2130 2140 2150
SESATSVPPS DTPSLTSSVS SVCTTDSSSP ITTLDSITTV YTEPVDMITK
2160 2170 2180 2190 2200
FEDSEEISSS TYFPGSIIDY PEEISVSLDR TAPPDGRASA DHIVISLSDM
2210 2220 2230 2240 2250
ASSIIESVVP KPEGPVADTV STDLLISEKD PVKKAKKETG NGIILEVLEA
2260 2270 2280 2290 2300
YRDKKELEAE RTKSSLSETV FDHPPSSVIA LPMKEQLSTT YFTSGETFGQ
2310 2320 2330 2340 2350
EKPASQLPSG SPSVSSLPAK PRPFFRSSSL DISAQPPPPP PPPPPPPPPP
2360 2370 2380 2390 2400
PPPPPPPLPP PTSPKPTILP KKKLTVASPV TTATPLFDAV TTLETTAVLR
2410 2420 2430 2440 2450
SNGLPVTRIC TTAPPPVPPK PSSIPSGLVF THRPEPSKPP IAPKPVIPQL
2460 2470 2480 2490 2500
PTTTQKPTDI HPKPTGLSLT SSMTLNLVTS ADYKLPSPTS PLSPHSNKSS
2510 2520 2530 2540 2550
PRFSKSLTET YVVITLPSEP GTPTDSSASQ AITSWPLGSP SKDLVSVEPV
2560 2570 2580 2590 2600
FSVVPPVTAV EIPISSEQTF YISGALQTFS ATPVTAPSSF QAAPTSVTQF
2610 2620 2630 2640 2650
LTTEVSKTEV SATRSTAPSV GLSSISITIP PEPLALDNIH LEKPQYKEDG
2660 2670 2680 2690 2700
KLQLVGDVID LRTVPKVEVK TTDKCIDLSA STMDVKRQIT ANEVYGKQIS
2710 2720 2730 2740 2750
AVQPSIINLS VTSSIVTPVS LATETVTFVT CTASASYTTG TESLVGAEHA
2760 2770 2780 2790 2800
MTTPLQLTTS KHAEPPYRIP SDQVFPIARE EAPINLSLGT PAHAVTLAIT
2810 2820 2830 2840 2850
KPVTVPPVGV TNGWTDSTVS QGITDGEVVD LSTTKSHRTV VTMDESTSSV
2860 2870 2880 2890 2900
MTKIIEDEKP VDLTAGRRAV CCDVVYKLPF GRSCTAQQPA TTLPEDRFGY
2910 2920 2930 2940 2950
RDDHYQYDRS GPYGYRGIGG MKPSMSDTNL AEAGHFFYKS KNAFDYSEGT
2960 2970 2980 2990 3000
DTAVDLTSGR VTTGEVMDYS SKTTGPYPET RQVISGAGIS TPQYSTARMT
3010 3020 3030 3040 3050
PPPGPQYCVG SVLRSSNGVV YSSVATPTPS TFAITTQPGS IFSTTVRDLS
3060 3070 3080 3090 3100
GIHTADAVTS LPAMHHSQPM PRSYFITTGA SETDIAVTGI DISASLQTIT
3110 3120 3130 3140 3150
MESLTAETID SVPTLTTASE VFPEVVGDES ALLIVPEEDK QQQQLDLERE
3160 3170 3180 3190 3200
LLELEKIKQQ RFAEELEWER QEIQRFREQE KIMVQKKLEE LQSMKQHLLF
3210 3220 3230 3240 3250
QQEEERQAQF MMRQETLAQQ QLQLEQIQQL QQQLHQQLEE QKIRQIYQYN
3260 3270 3280 3290 3300
YDPSGTASPQ TTTEQAILEG QYAALEGSQF WATEDATTTA SAVVAIEIPQ
3310 3320 3330 3340 3350
SQGWYTVQSD GVTQYIAPPG ILSTVSEIPL TDVVVKEEKQ PKKRSSGAKV
3360 3370 3380 3390 3400
RGQYDDMGEN MTDDPRSFKK IVDSGVQTDD EDATDRSYVS RRRRTKKSVD
3410 3420 3430 3440 3450
TSVQTDDEDQ DEWDMPTRSR RKARVGKYGD SMTEADKTKP LSKVSSIAVQ
3460 3470 3480 3490 3500
TVAEISVQTE PVGTIRTPSI RARVDAKVEI IKHISAPEKT YKGGSLGCQT
3510 3520 3530 3540 3550
EADSDTQSPQ YLSATSPPKD KKRPTPLEIG YSSHLRADST VQLAPSPPKS
3560 3570 3580 3590 3600
PKVLYSPISP LSPGKALESA FVPYEKPLPD DISPQKVLHP DMAKVPPASP
3610 3620 3630 3640 3650
KTAKMMQRSM SDPKPLSPTA DESSRAPFQY TEGYTTKGSQ TMTSSGAQKK
3660 3670 3680 3690 3700
VKRTLPNPPP EEISTGTQST FSTMGTVSRR RICRTNTMAR AKILQDIDRE
3710 3720 3730 3740 3750
LDLVERESAK LRKKQAELDE EEKEIDAKLR YLEMGINRRK EALLKEREKR
3760 3770 3780 3790 3800
ERAYLQGVAE DRDYMSDSEV SSTRPTRIES QHGIERPRTA PQTEFSQFIP
3810 3820 3830 3840 3850
PQTQTESQLV PPTSPYTQYQ YSSPALPTQA PTSYTQQSHF EQQTLYHQQV
3860 3870 3880 3890 3900
SPYQTQPTFQ AVATMSFTPQ VQPTPTPQPS YQLPSQMMVI QQKPRQTTLY
3910 3920 3930 3940 3950
LEPKITSNYE VIRNQPLMIA PVSTDNTFAV SHLGSKYNSL DLRIGLEERS
3960 3970 3980 3990 4000
SMASSPISSI SADSFYADID HHTPRNYVLI DDIGEITKGT AALSTAFSLH
4010 4020 4030 4040 4050
EKDLSKTDRL LRTTETRRSQ EVTDFLAPLQ SSSRLHSYVK AEEDPMEDPY
4060 4070 4080 4090 4100
ELKLLKHQIK QEFRRGTESL DHLAGLSHYY HADTSYRHFP KSEKYSISRL
4110 4120 4130 4140 4150
TLEKQAAKQL PAAILYQKQS KHKKSLIDPK MSKFSPIQES RDLEPDYSSY
4160 4170 4180 4190 4200
MTSSTSSIGG ISSRARLLQD DITFGLRKNI TDQQKFMGSS LGTGLGTLGN
4210 4220 4230 4240 4250
TIRSALQDEA DKPYSSGSRS RPSSRPSSVY GLDLSIKRDS SSSSLRLKAQ
4260 4270 4280 4290 4300
EAEALDVSFS HASSSARTKP TSLPISQSRG RIPIVAQNSE EESPLSPVGQ
4310 4320 4330 4340 4350
PMGMARAAAG PLPPISADTR DQFGSSHSLP EVQQHMREES RTRGYDRDIA
4360 4370 4380 4390 4400
FIMDDFQHAM SDSEAYHLRR EETDWFDKPR ESRLENGHGL DRKLPERLVH
4410 4420 4430 4440 4450
SRPLSQHQEQ IIQMNGKTMH YIFPHARIKI TRDSKDHTVS MQVLEWNGIP
4460 4470 4480 4490 4500
LTSKTYEEVQ SIISQQSGEA EICVRLDLNM LSDSENSQHL ELHEPPKAVD
4510 4520 4530 4540 4550
KAKSPGVDPK QLAAELQKVS LQQSPLVLSS VVEKGSHVHS GPTSAGSSSV
4560 4570 4580 4590 4600
PSPGQPGSPS VSKKKHGSSK LQINYDLGNL IIHILQARNL VPRDNNGYSD
4610 4620 4630 4640 4650
PFVKVYLLPG RGAEYKRRTK HVQKSLNPEW NQTVIYKSIS MEQLKKKTLE
4660 4670 4680 4690 4700
VTVWDYDRFS SNDFLGEVLI DLSSTSHLDN TPRWYPLKEQ TESIDHGKSH
4710 4720 4730 4740 4750
SSQSSQQSPK PSVIKSRSHG IFPDPSKDMQ VPTIEKSHSS PGSSKSSSEG
4760 4770 4780 4790 4800
HLRSHGPSRS QSKTSVTQTH LEDAGAAIAA AEAAVQQLRI QPTAHKSGQS
4810 4820 4830 4840 4850
NHARKQHRHS IAGVLPIQRT QSDNLPPPAN GNQDQSQLAL RKVMSDGPVK
4860 4870 4880 4890 4900
PEGAKPPNHR PAESSVSTGS SGSSFGSGYS VDSEGSSSTA GETNLFPIPR
4910 4920 4930 4940 4950
IGKMGQNGQE PVKQPGVGVG LADTEAKTQV MGEIKIALKK EMKTDGEQLI
4960 4970 4980 4990 5000
VEILQCRNIT YKFKSPDHLP DLYVKIYVMN ISTQKKVIKK KTRVCRHDRE
5010 5020 5030 5040 5050
PSFNETFRFS LSPAGHSLQI LLFSNGGKFM KKTLIGEACI WLDKVDLRKR
5060
IVNWHKLLVS PTQTH
Length:5,065
Mass (Da):553,277
Last modified:May 3, 2011 - v4
Checksum:i0CE4F2990F74AFFF
GO
Isoform 2 (identifier: Q9Y6V0-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     4440-4440: S → SGNGLGIRIVGGKEIPGHSGEIGAYIAKILPGGSAEQTGKLMEG
     4570-4570: K → KPTDGTKVVSHPITGEIQ
     4612-4612: G → GQVMVVQNAS
     4793-4797: TAHKS → SKRRK
     4798-5065: Missing.

Show »
Length:4,866
Mass (Da):530,858
Checksum:iC9939ED01362785E
GO
Isoform 3 (identifier: Q9Y6V0-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-4458: Missing.
     4459-4476: VQSIISQQSGEAEICVRL → MKKFRVSLVSKVGKQKYV
     4570-4570: K → KPTDGTKVVSHPITGEIQ
     4793-4797: TAHKS → SKRRK
     4798-5065: Missing.

Note: No experimental confirmation available.

Show »
Length:356
Mass (Da):39,047
Checksum:iB515BD682ECC0154
GO
Isoform 4 (identifier: Q9Y6V0-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     443-490: AKPPSQQPGS...GSAKPSAQQP → HKAPISTAWL...WLSKTLSSTA
     491-5065: Missing.

Note: No experimental confirmation available.

Show »
Length:490
Mass (Da):51,012
Checksum:i6F57A26F73587277
GO
Isoform 5 (identifier: Q9Y6V0-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     442-442: Q → QQPGPGKIPAQQAGPGKTSAQQTGPTKPPSQLPGPAKPPPQQPGPAKPPPQQPGS
     1046-1046: E → EIQEWLCL
     1270-1270: Q → QVEPGKEKT
     4440-4440: S → SGNGLGIRIVGGKEIPGHSGEIGAYIAKILPGGSAEQTGKLMEG
     4570-4570: K → KPTDGTKVVSHPITGEIQ
     4612-4612: G → GQVMVVQNAS
     4794-4854: Missing.

Note: No experimental confirmation available.

Show »
Length:5,142
Mass (Da):560,699
Checksum:i18F145349952C935
GO
Isoform 6 (identifier: Q9Y6V0-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     442-442: Q → QQPGPGKIPAQQAGPGKTSAQQTGPTKPPSQLPGPAKPPPQQPGPAKPPPQQPGS
     1046-1046: E → EIQEWLCL
     1270-1270: Q → QVEPGKEKT
     4440-4440: S → SGNGLGIRIVGGKEIPGHSGEIGAYIAKILPGGSAEQTGKLMEG
     4570-4570: K → KPTDGTKVVSHPITGEIQ
     4612-4612: G → GQVMVVQNAS
     4793-4797: TAHKS → SKRRK
     4798-5065: Missing.

Note: No experimental confirmation available.

Show »
Length:4,935
Mass (Da):537,886
Checksum:iE9D027F9FB9879F2
GO

Sequence cautioni

The sequence AAB97937.1 differs from that shown. Reason: Erroneous gene model prediction.
The sequence AAD21789.2 differs from that shown. Reason: Erroneous gene model prediction.

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti441 – 4411V → A in CAB60727. (PubMed:10508862)Curated
Sequence conflicti443 – 4431A → T in CAB60727. (PubMed:10508862)Curated
Sequence conflicti447 – 4471S → P in AAI22566. (PubMed:15489334)Curated
Sequence conflicti500 – 5001S → F in CAB60727. (PubMed:10508862)Curated
Sequence conflicti509 – 5091S → F in CAB60727. (PubMed:10508862)Curated
Sequence conflicti578 – 5781V → A in CAB60727. (PubMed:10508862)Curated
Sequence conflicti760 – 7601S → T in CAB60727. (PubMed:10508862)Curated
Sequence conflicti4676 – 46761S → A in AAH01304. (PubMed:15489334)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti2602 – 26021T → P.
Corresponds to variant rs10261848 [ dbSNP | Ensembl ].
VAR_056959
Natural varianti2735 – 27351A → T.
Corresponds to variant rs976714 [ dbSNP | Ensembl ].
VAR_056960

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 44584458Missing in isoform 3. 1 PublicationVSP_012348Add
BLAST
Alternative sequencei442 – 4421Q → QQPGPGKIPAQQAGPGKTSA QQTGPTKPPSQLPGPAKPPP QQPGPAKPPPQQPGS in isoform 5 and isoform 6. CuratedVSP_041004
Alternative sequencei443 – 49048AKPPS…SAQQP → HKAPISTAWLNKTPTSTAWP SKALTSTAWLNKTPISTAWL SKTLSSTA in isoform 4. CuratedVSP_041005Add
BLAST
Alternative sequencei491 – 50654575Missing in isoform 4. CuratedVSP_041006Add
BLAST
Alternative sequencei1046 – 10461E → EIQEWLCL in isoform 5 and isoform 6. CuratedVSP_041007
Alternative sequencei1270 – 12701Q → QVEPGKEKT in isoform 5 and isoform 6. CuratedVSP_041008
Alternative sequencei4440 – 44401S → SGNGLGIRIVGGKEIPGHSG EIGAYIAKILPGGSAEQTGK LMEG in isoform 2, isoform 5 and isoform 6. 1 PublicationVSP_003923
Alternative sequencei4459 – 447618VQSII…ICVRL → MKKFRVSLVSKVGKQKYV in isoform 3. 1 PublicationVSP_012349Add
BLAST
Alternative sequencei4570 – 45701K → KPTDGTKVVSHPITGEIQ in isoform 2, isoform 3, isoform 5 and isoform 6. 2 PublicationsVSP_003924
Alternative sequencei4612 – 46121G → GQVMVVQNAS in isoform 2, isoform 5 and isoform 6. 1 PublicationVSP_003925
Alternative sequencei4793 – 47975TAHKS → SKRRK in isoform 2, isoform 3 and isoform 6. 2 PublicationsVSP_003926
Alternative sequencei4794 – 485461Missing in isoform 5. CuratedVSP_041009Add
BLAST
Alternative sequencei4798 – 5065268Missing in isoform 2, isoform 3 and isoform 6. 2 PublicationsVSP_003927Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AC004006 Genomic DNA. No translation available.
AC004082 Genomic DNA. Translation: AAB97937.1. Sequence problems.
AC080093 Genomic DNA. No translation available.
AC004886 Genomic DNA. Translation: AAD21789.2. Sequence problems.
AC004903 Genomic DNA. No translation available.
AC093461 Genomic DNA. No translation available.
CH236949 Genomic DNA. Translation: EAL24187.1.
BC001304 mRNA. Translation: AAH01304.2.
BC122565 mRNA. Translation: AAI22566.1.
BC125271 mRNA. Translation: AAI25272.1.
Y19188 mRNA. Translation: CAB60727.1.
AB011131 mRNA. Translation: BAA25485.1.
CCDSiCCDS47630.1. [Q9Y6V0-5]
CCDS47631.1. [Q9Y6V0-6]
PIRiT00332.
T00634.
RefSeqiNP_055325.2. NM_014510.2. [Q9Y6V0-6]
NP_149015.2. NM_033026.5. [Q9Y6V0-5]
UniGeneiHs.12376.

Genome annotation databases

EnsembliENST00000333891; ENSP00000334319; ENSG00000186472. [Q9Y6V0-5]
ENST00000423517; ENSP00000388393; ENSG00000186472. [Q9Y6V0-6]
ENST00000618073; ENSP00000482390; ENSG00000186472. [Q9Y6V0-3]
GeneIDi27445.
KEGGihsa:27445.
UCSCiuc003uhu.1. human. [Q9Y6V0-3]
uc003uhv.2. human. [Q9Y6V0-6]
uc003uhx.2. human. [Q9Y6V0-5]

Polymorphism databases

DMDMi332278245.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AC004006 Genomic DNA. No translation available.
AC004082 Genomic DNA. Translation: AAB97937.1 . Sequence problems.
AC080093 Genomic DNA. No translation available.
AC004886 Genomic DNA. Translation: AAD21789.2 . Sequence problems.
AC004903 Genomic DNA. No translation available.
AC093461 Genomic DNA. No translation available.
CH236949 Genomic DNA. Translation: EAL24187.1 .
BC001304 mRNA. Translation: AAH01304.2 .
BC122565 mRNA. Translation: AAI22566.1 .
BC125271 mRNA. Translation: AAI25272.1 .
Y19188 mRNA. Translation: CAB60727.1 .
AB011131 mRNA. Translation: BAA25485.1 .
CCDSi CCDS47630.1. [Q9Y6V0-5 ]
CCDS47631.1. [Q9Y6V0-6 ]
PIRi T00332.
T00634.
RefSeqi NP_055325.2. NM_014510.2. [Q9Y6V0-6 ]
NP_149015.2. NM_033026.5. [Q9Y6V0-5 ]
UniGenei Hs.12376.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
1UJD NMR - A 4441-4480 [» ]
ProteinModelPortali Q9Y6V0.
SMRi Q9Y6V0. Positions 4567-4693.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 118178. 6 interactions.
IntActi Q9Y6V0. 3 interactions.
MINTi MINT-4542387.
STRINGi 9606.ENSP00000411633.

PTM databases

PhosphoSitei Q9Y6V0.

Polymorphism databases

DMDMi 332278245.

Proteomic databases

MaxQBi Q9Y6V0.
PaxDbi Q9Y6V0.
PRIDEi Q9Y6V0.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000333891 ; ENSP00000334319 ; ENSG00000186472 . [Q9Y6V0-5 ]
ENST00000423517 ; ENSP00000388393 ; ENSG00000186472 . [Q9Y6V0-6 ]
ENST00000618073 ; ENSP00000482390 ; ENSG00000186472 . [Q9Y6V0-3 ]
GeneIDi 27445.
KEGGi hsa:27445.
UCSCi uc003uhu.1. human. [Q9Y6V0-3 ]
uc003uhv.2. human. [Q9Y6V0-6 ]
uc003uhx.2. human. [Q9Y6V0-5 ]

Organism-specific databases

CTDi 27445.
GeneCardsi GC07M082383.
HGNCi HGNC:13406. PCLO.
HPAi HPA015858.
HPA029579.
MIMi 604918. gene.
neXtProti NX_Q9Y6V0.
PharmGKBi PA33072.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG12793.
GeneTreei ENSGT00620000087961.
HOVERGENi HBG074340.
InParanoidi Q9Y6V0.
KOi K16882.
OMAi DQVEPGK.
OrthoDBi EOG73805D.
TreeFami TF326082.

Miscellaneous databases

ChiTaRSi PCLO. human.
EvolutionaryTracei Q9Y6V0.
GeneWikii PCLO.
GenomeRNAii 27445.
NextBioi 50526.
PROi Q9Y6V0.
SOURCEi Search...

Gene expression databases

Bgeei Q9Y6V0.
CleanExi HS_PCLO.
ExpressionAtlasi Q9Y6V0. baseline and differential.
Genevestigatori Q9Y6V0.

Family and domain databases

Gene3Di 2.60.40.150. 2 hits.
3.30.40.10. 1 hit.
InterProi IPR000008. C2_dom.
IPR001565. Synaptotagmin.
IPR011011. Znf_FYVE_PHD.
IPR008899. Znf_piccolo.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view ]
Pfami PF00168. C2. 2 hits.
PF05715. zf-piccolo. 2 hits.
[Graphical view ]
PRINTSi PR00360. C2DOMAIN.
PR00399. SYNAPTOTAGMN.
SMARTi SM00239. C2. 2 hits.
[Graphical view ]
SUPFAMi SSF49562. SSF49562. 2 hits.
SSF57903. SSF57903. 2 hits.
PROSITEi PS50004. C2. 2 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "The DNA sequence of human chromosome 7."
    Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L.
    , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
    Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 21-607 (ISOFORMS 5/6).
    Tissue: Placenta.
  4. "Aczonin, a 550-kd putative scaffolding protein of presynaptic active zones, shares homology regions with rim and bassoon and binds profilin."
    Wang X., Kibschull M., Laue M.M., Lichte B., Petrasch-Parwez E., Kilimann M.W.
    J. Cell Biol. 147:151-162(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 37-795 (ISOFORMS 1/2).
    Tissue: Brain.
  5. "Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro."
    Nagase T., Ishikawa K., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
    DNA Res. 5:31-39(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 3655-5065 (ISOFORM 2).
    Tissue: Brain.
  6. "Solution structure of RSGI RUH-003, a PDZ domain of hypothetical KIAA0559 protein from human."
    RIKEN structural genomics initiative (RSGI)
    Submitted (JAN-2004) to the PDB data bank
    Cited for: STRUCTURE BY NMR OF 4390-4480.

Entry informationi

Entry nameiPCLO_HUMAN
AccessioniPrimary (citable) accession number: Q9Y6V0
Secondary accession number(s): A4D1A7
, A6NNX9, O43373, O60305, Q08E72, Q9BVC8, Q9UIV2, Q9Y6U9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 19, 2002
Last sequence update: May 3, 2011
Last modified: October 29, 2014
This is version 141 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3