Q9Y6V0 (PCLO_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 129.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Protein piccolo Alternative name(s): Aczonin | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 5065 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May act as a scaffolding protein involved in the organization of synaptic active zones and in synaptic vesicle trafficking By similarity. UniProtKB Q9QYX7 |
| Subunit structure | Interacts with RABAC1/PRA1, RIMS2 and profilin By similarity. |
| Subcellular location | Cell junction › synapse By similarity. Note: Concentrated at the presynaptic side of synaptic junctions By similarity. |
| Domain | C2 domain 1 is involved in binding calcium and phospholipids. Calcium binds with low affinity but with high specificity and induces a large conformational change. UniProtKB Q9JKS6 |
| Sequence similarities | Contains 2 C2 domains. Contains 1 PDZ (DHR) domain. |
| Sequence caution | The sequence AAB97937.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAD21789.2 differs from that shown. Reason: Erroneous gene model prediction. |
Ontologies
Alternative products
| This entry describes 6 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. | ||||||
| Isoform 1 (identifier: Q9Y6V0-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9Y6V0-2) The sequence of this isoform differs from the canonical sequence as follows: 4440-4440: S → SGNGLGIRIVGGKEIPGHSGEIGAYIAKILPGGSAEQTGKLMEG 4570-4570: K → KPTDGTKVVSHPITGEIQ 4612-4612: G → GQVMVVQNAS 4793-4797: TAHKS → SKRRK 4798-5065: Missing. | ||||||
| Isoform 3 (identifier: Q9Y6V0-3) The sequence of this isoform differs from the canonical sequence as follows: 1-4458: Missing. 4459-4476: VQSIISQQSGEAEICVRL → MKKFRVSLVSKVGKQKYV 4570-4570: K → KPTDGTKVVSHPITGEIQ 4793-4797: TAHKS → SKRRK 4798-5065: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q9Y6V0-4) The sequence of this isoform differs from the canonical sequence as follows: 443-490: AKPPSQQPGS...GSAKPSAQQP → HKAPISTAWL...WLSKTLSSTA 491-5065: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 5 (identifier: Q9Y6V0-5) The sequence of this isoform differs from the canonical sequence as follows: 442-442: Q → QQPGPGKIPAQQAGPGKTSAQQTGPTKPPSQLPGPAKPPPQQPGPAKPPPQQPGS 1046-1046: E → EIQEWLCL 1270-1270: Q → QVEPGKEKT 4440-4440: S → SGNGLGIRIVGGKEIPGHSGEIGAYIAKILPGGSAEQTGKLMEG 4570-4570: K → KPTDGTKVVSHPITGEIQ 4612-4612: G → GQVMVVQNAS 4794-4854: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 6 (identifier: Q9Y6V0-6) The sequence of this isoform differs from the canonical sequence as follows: 442-442: Q → QQPGPGKIPAQQAGPGKTSAQQTGPTKPPSQLPGPAKPPPQQPGPAKPPPQQPGS 1046-1046: E → EIQEWLCL 1270-1270: Q → QVEPGKEKT 4440-4440: S → SGNGLGIRIVGGKEIPGHSGEIGAYIAKILPGGSAEQTGKLMEG 4570-4570: K → KPTDGTKVVSHPITGEIQ 4612-4612: G → GQVMVVQNAS 4793-4797: TAHKS → SKRRK 4798-5065: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||
Molecule processing | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 5065 | 5065 | Protein piccolo | PRO_0000058250 | |||||||||||||||
Regions | |||||||||||||||||||
| Domain | 4427 – 4478 | 52 | PDZ | ||||||||||||||||
| Domain | 4565 – 4669 | 105 | C2 1 | ||||||||||||||||
| Domain | 4934 – 5039 | 106 | C2 2 | ||||||||||||||||
| Zinc finger | 535 – 559 | 25 | C4-type Potential | ||||||||||||||||
| Zinc finger | 1005 – 1028 | 24 | C4-type Potential | ||||||||||||||||
| Region | 397 – 501 | 105 | 10 X 10 AA tandem approximate repeats of P-A-K-P-Q-P-Q-Q-P-X | ||||||||||||||||
| Compositional bias | 193 – 499 | 307 | Gln-rich | ||||||||||||||||
| Compositional bias | 209 – 975 | 767 | Pro-rich | ||||||||||||||||
| Compositional bias | 2303 – 2464 | 162 | Pro-rich | ||||||||||||||||
| Compositional bias | 2336 – 2361 | 26 | Poly-Pro | ||||||||||||||||
| Compositional bias | 3141 – 3248 | 108 | Gln-rich | ||||||||||||||||
| Compositional bias | 3792 – 3896 | 105 | Gln-rich | ||||||||||||||||
| Compositional bias | 4215 – 4278 | 64 | Ser-rich | ||||||||||||||||
| Compositional bias | 4699 – 4765 | 67 | Ser-rich | ||||||||||||||||
Amino acid modifications | |||||||||||||||||||
| Modified residue | 629 | 1 | Phosphoserine By similarity | ||||||||||||||||
| Modified residue | 751 | 1 | Phosphoserine By similarity | ||||||||||||||||
| Modified residue | 868 | 1 | Phosphothreonine By similarity | ||||||||||||||||
| Modified residue | 1335 | 1 | Phosphoserine By similarity | ||||||||||||||||
| Modified residue | 1336 | 1 | Phosphoserine By similarity | ||||||||||||||||
| Modified residue | 1395 | 1 | Phosphoserine By similarity | ||||||||||||||||
| Modified residue | 1453 | 1 | Phosphoserine By similarity | ||||||||||||||||
| Modified residue | 1571 | 1 | Phosphoserine By similarity | ||||||||||||||||
| Modified residue | 1581 | 1 | Phosphoserine By similarity | ||||||||||||||||
| Modified residue | 1756 | 1 | Phosphothreonine By similarity | ||||||||||||||||
| Modified residue | 1759 | 1 | Phosphoserine By similarity | ||||||||||||||||
| Modified residue | 1762 | 1 | Phosphoserine By similarity | ||||||||||||||||
| Modified residue | 1768 | 1 | Phosphoserine By similarity | ||||||||||||||||
| Modified residue | 1804 | 1 | Phosphoserine By similarity | ||||||||||||||||
| Modified residue | 1824 | 1 | Phosphotyrosine By similarity | ||||||||||||||||
| Modified residue | 1825 | 1 | Phosphoserine By similarity | ||||||||||||||||
| Modified residue | 3000 | 1 | Phosphothreonine By similarity | ||||||||||||||||
| Modified residue | 3378 | 1 | Phosphothreonine By similarity | ||||||||||||||||
| Modified residue | 3515 | 1 | Phosphothreonine By similarity | ||||||||||||||||
| Modified residue | 3546 | 1 | Phosphoserine By similarity | ||||||||||||||||
| Modified residue | 3611 | 1 | Phosphoserine By similarity | ||||||||||||||||
| Modified residue | 3617 | 1 | Phosphoserine By similarity | ||||||||||||||||
| Modified residue | 3764 | 1 | Phosphotyrosine By similarity | ||||||||||||||||
| Modified residue | 3766 | 1 | Phosphoserine By similarity | ||||||||||||||||
| Modified residue | 3897 | 1 | Phosphothreonine By similarity | ||||||||||||||||
| Modified residue | 3898 | 1 | Phosphothreonine By similarity | ||||||||||||||||
| Modified residue | 3939 | 1 | Phosphoserine By similarity | ||||||||||||||||
| Modified residue | 3955 | 1 | Phosphoserine By similarity | ||||||||||||||||
| Modified residue | 4289 | 1 | Phosphoserine By similarity | ||||||||||||||||
| Modified residue | 4293 | 1 | Phosphoserine By similarity | ||||||||||||||||
| Modified residue | 4296 | 1 | Phosphoserine By similarity | ||||||||||||||||
| Modified residue | 4328 | 1 | Phosphoserine By similarity | ||||||||||||||||
Natural variations | |||||||||||||||||||
| Alternative sequence | 1 – 4458 | 4458 | Missing in isoform 3. | VSP_012348 | |||||||||||||||
| Alternative sequence | 442 | 1 | Q → QQPGPGKIPAQQAGPGKTSA QQTGPTKPPSQLPGPAKPPP QQPGPAKPPPQQPGS in isoform 5 and isoform 6. | VSP_041004 | |||||||||||||||
| Alternative sequence | 443 – 490 | 48 | AKPPS…SAQQP → HKAPISTAWLNKTPTSTAWP SKALTSTAWLNKTPISTAWL SKTLSSTA in isoform 4. | VSP_041005 | |||||||||||||||
| Alternative sequence | 491 – 5065 | 4575 | Missing in isoform 4. | VSP_041006 | |||||||||||||||
| Alternative sequence | 1046 | 1 | E → EIQEWLCL in isoform 5 and isoform 6. | VSP_041007 | |||||||||||||||
| Alternative sequence | 1270 | 1 | Q → QVEPGKEKT in isoform 5 and isoform 6. | VSP_041008 | |||||||||||||||
| Alternative sequence | 4440 | 1 | S → SGNGLGIRIVGGKEIPGHSG EIGAYIAKILPGGSAEQTGK LMEG in isoform 2, isoform 5 and isoform 6. | VSP_003923 | |||||||||||||||
| Alternative sequence | 4459 – 4476 | 18 | VQSII…ICVRL → MKKFRVSLVSKVGKQKYV in isoform 3. | VSP_012349 | |||||||||||||||
| Alternative sequence | 4570 | 1 | K → KPTDGTKVVSHPITGEIQ in isoform 2, isoform 3, isoform 5 and isoform 6. | VSP_003924 | |||||||||||||||
| Alternative sequence | 4612 | 1 | G → GQVMVVQNAS in isoform 2, isoform 5 and isoform 6. | VSP_003925 | |||||||||||||||
| Alternative sequence | 4793 – 4797 | 5 | TAHKS → SKRRK in isoform 2, isoform 3 and isoform 6. | VSP_003926 | |||||||||||||||
| Alternative sequence | 4794 – 4854 | 61 | Missing in isoform 5. | VSP_041009 | |||||||||||||||
| Alternative sequence | 4798 – 5065 | 268 | Missing in isoform 2, isoform 3 and isoform 6. | VSP_003927 | |||||||||||||||
| Natural variant | 2602 | 1 | T → P. Corresponds to variant rs10261848 [ dbSNP | Ensembl ]. | VAR_056959 | |||||||||||||||
| Natural variant | 2735 | 1 | A → T. Corresponds to variant rs976714 [ dbSNP | Ensembl ]. | VAR_056960 | |||||||||||||||
Experimental info | |||||||||||||||||||
| Sequence conflict | 441 | 1 | V → A in CAB60727. Ref.4 | ||||||||||||||||
| Sequence conflict | 443 | 1 | A → T in CAB60727. Ref.4 | ||||||||||||||||
| Sequence conflict | 447 | 1 | S → P in AAI22566. Ref.3 | ||||||||||||||||
| Sequence conflict | 500 | 1 | S → F in CAB60727. Ref.4 | ||||||||||||||||
| Sequence conflict | 509 | 1 | S → F in CAB60727. Ref.4 | ||||||||||||||||
| Sequence conflict | 578 | 1 | V → A in CAB60727. Ref.4 | ||||||||||||||||
| Sequence conflict | 760 | 1 | S → T in CAB60727. Ref.4 | ||||||||||||||||
| Sequence conflict | 4676 | 1 | S → A in AAH01304. Ref.3 | ||||||||||||||||
Secondary structure | |||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||
| Beta strand | 4425 – 4430 | 6 | |||||||||||||||||
| Beta strand | 4434 – 4437 | 4 | |||||||||||||||||
| Beta strand | 4442 – 4446 | 5 | |||||||||||||||||
| Helix | 4456 – 4463 | 8 | |||||||||||||||||
| Beta strand | 4470 – 4477 | 8 | |||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The DNA sequence of human chromosome 7." Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L. Wilson R.K.Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [2] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 21-607 (ISOFORMS 5/6). Tissue: Placenta. |
| [4] | "Aczonin, a 550-kd putative scaffolding protein of presynaptic active zones, shares homology regions with rim and bassoon and binds profilin." Wang X., Kibschull M., Laue M.M., Lichte B., Petrasch-Parwez E., Kilimann M.W. J. Cell Biol. 147:151-162(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 37-795 (ISOFORMS 1/2). Tissue: Brain. |
| [5] | "Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro." Nagase T., Ishikawa K., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O. DNA Res. 5:31-39(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 3655-5065 (ISOFORM 2). Tissue: Brain. |
| [6] | "Solution structure of RSGI RUH-003, a PDZ domain of hypothetical KIAA0559 protein from human." RIKEN structural genomics initiative (RSGI) Submitted (JAN-2004) to the PDB data bank Cited for: STRUCTURE BY NMR OF 4390-4480. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AC004006 Genomic DNA. No translation available. AC004082 Genomic DNA. Translation: AAB97937.1. Sequence problems. AC080093 Genomic DNA. No translation available. AC004886 Genomic DNA. Translation: AAD21789.2. Sequence problems. AC004903 Genomic DNA. No translation available. AC093461 Genomic DNA. No translation available. CH236949 Genomic DNA. Translation: EAL24187.1. BC001304 mRNA. Translation: AAH01304.2. BC122565 mRNA. Translation: AAI22566.1. BC125271 mRNA. Translation: AAI25272.1. Y19188 mRNA. Translation: CAB60727.1. AB011131 mRNA. Translation: BAA25485.1. | ||||||||||||
| IPI | IPI00411656. IPI00515102. IPI00789624. IPI00843855. IPI00968106. IPI01014960. | ||||||||||||
| PIR | T00332. T00634. | ||||||||||||
| RefSeq | NP_055325.2. NM_014510.2. NP_149015.2. NM_033026.5. | ||||||||||||
| UniGene | Hs.12376. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q9Y6V0. | ||||||||||||
| SMR | Q9Y6V0. Positions 4567-4693. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| STRING | 9606.ENSP00000411633. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q9Y6V0. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 41019528. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | Q9Y6V0. | ||||||||||||
| PRIDE | Q9Y6V0. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000333891; ENSP00000334319; ENSG00000186472. ENST00000423517; ENSP00000388393; ENSG00000186472. | ||||||||||||
| GeneID | 27445. | ||||||||||||
| KEGG | hsa:27445. | ||||||||||||
| UCSC | uc003uhu.1. human. uc003uhv.2. human. uc003uhx.2. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 27445. | ||||||||||||
| GeneCards | GC07M082383. | ||||||||||||
| HGNC | HGNC:13406. PCLO. | ||||||||||||
| HPA | HPA015858. HPA029579. | ||||||||||||
| MIM | 604918. gene. | ||||||||||||
| neXtProt | NX_Q9Y6V0. | ||||||||||||
| PharmGKB | PA33072. | ||||||||||||
| HUGE | Search... | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | NOG12793. | ||||||||||||
| HOVERGEN | HBG074340. | ||||||||||||
| InParanoid | Q9Y6V0. | ||||||||||||
| OMA | YSVDSEG. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q9Y6V0. | ||||||||||||
| Bgee | Q9Y6V0. | ||||||||||||
| CleanEx | HS_PCLO. | ||||||||||||
| Genevestigator | Q9Y6V0. | ||||||||||||
Family and domain databases | |||||||||||||
| Gene3D | 3.30.40.10. 1 hit. | ||||||||||||
| InterPro | IPR000008. C2_Ca-dep. IPR008973. C2_Ca/lipid-bd_dom_CaLB. IPR020477. C2_dom. IPR018029. C2_membr_targeting. IPR001565. Synaptotagmin. IPR011011. Znf_FYVE_PHD. IPR008899. Znf_piccolo. IPR013083. Znf_RING/FYVE/PHD. [Graphical view] | ||||||||||||
| Pfam | PF00168. C2. 2 hits. PF05715. zf-piccolo. 2 hits. [Graphical view] | ||||||||||||
| PRINTS | PR00360. C2DOMAIN. PR00399. SYNAPTOTAGMN. | ||||||||||||
| SMART | SM00239. C2. 2 hits. [Graphical view] | ||||||||||||
| SUPFAM | SSF49562. C2_CaLB. 2 hits. SSF57903. FYVE_PHD_ZnF. 2 hits. | ||||||||||||
| PROSITE | PS50004. C2. 2 hits. PS50106. PDZ. False negative. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| ChiTaRS | PCLO. human. | ||||||||||||
| EvolutionaryTrace | Q9Y6V0. | ||||||||||||
| GenomeRNAi | 27445. | ||||||||||||
| NextBio | 50526. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | PCLO_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9Y6V0 Secondary accession number(s): A4D1A7 Q9Y6U9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 7 Human chromosome 7: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
