Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ribosomal protein S6 kinase-like 1

Gene

RPS6KL1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

Catalytic activityi

ATP + a protein = ADP + a phosphoprotein.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei177 – 1771ATPPROSITE-ProRule annotation
Active sitei412 – 4121Proton acceptorPROSITE-ProRule annotation

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi151 – 1599ATPPROSITE-ProRule annotation

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Kinase, Ribonucleoprotein, Ribosomal protein, Serine/threonine-protein kinase, Transferase

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

SignaLinkiQ9Y6S9.

Names & Taxonomyi

Protein namesi
Recommended name:
Ribosomal protein S6 kinase-like 1 (EC:2.7.11.1)
Gene namesi
Name:RPS6KL1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 14

Organism-specific databases

HGNCiHGNC:20222. RPS6KL1.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134868364.

Polymorphism and mutation databases

BioMutaiRPS6KL1.
DMDMi74762793.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 549549Ribosomal protein S6 kinase-like 1PRO_0000232641Add
BLAST

Proteomic databases

EPDiQ9Y6S9.
MaxQBiQ9Y6S9.
PaxDbiQ9Y6S9.
PRIDEiQ9Y6S9.

PTM databases

PhosphoSiteiQ9Y6S9.

Expressioni

Gene expression databases

BgeeiQ9Y6S9.
CleanExiHS_RPS6KL1.
ExpressionAtlasiQ9Y6S9. baseline and differential.
GenevisibleiQ9Y6S9. HS.

Organism-specific databases

HPAiHPA027451.
HPA027794.

Interactioni

Protein-protein interaction databases

BioGridi123728. 1 interaction.
IntActiQ9Y6S9. 1 interaction.
STRINGi9606.ENSP00000351086.

Structurei

3D structure databases

ProteinModelPortaliQ9Y6S9.
SMRiQ9Y6S9. Positions 44-113, 386-547.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini87 – 11529MITAdd
BLAST
Domaini145 – 539395Protein kinasePROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. S6 kinase subfamily.PROSITE-ProRule annotation
Contains 1 MIT domain.Curated
Contains 1 protein kinase domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG0603. Eukaryota.
ENOG410ZH1N. LUCA.
GeneTreeiENSGT00530000063268.
HOGENOMiHOG000154183.
HOVERGENiHBG084136.
InParanoidiQ9Y6S9.
OMAiECPPGPG.
OrthoDBiEOG78PV8C.
PhylomeDBiQ9Y6S9.
TreeFamiTF323964.

Family and domain databases

Gene3Di1.20.58.280. 1 hit.
InterProiIPR011009. Kinase-like_dom.
IPR007330. MIT.
IPR000719. Prot_kinase_dom.
[Graphical view]
PfamiPF04212. MIT. 1 hit.
PF00069. Pkinase. 1 hit.
[Graphical view]
SMARTiSM00745. MIT. 1 hit.
[Graphical view]
SUPFAMiSSF116846. SSF116846. 1 hit.
SSF56112. SSF56112. 2 hits.
PROSITEiPS50011. PROTEIN_KINASE_DOM. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9Y6S9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSLVACECLP SPGLEPEPCS RARSQAHVYL EQIRNRVALG VPDMTKRDYL
60 70 80 90 100
VDAATQIRLA LERDVSEDYE AAFNHYQNGV DVLLRGIHVD PNKERREAVK
110 120 130 140 150
LKITKYLRRA EEIFNCHLQR PLSSGASPSA GFSSLRLRPI RTLSSAVEQL
160 170 180 190 200
RGCRVVGVIE KVQLVQDPAT GGTFVVKSLP RCHMVSRERL TIIPHGVPYM
210 220 230 240 250
TKLLRYFVSE DSIFLHLEHV QGGTLWSHLL SQAHSRHSGL SSGSTQERMK
260 270 280 290 300
AQLNPHLNLL TPARLPSGHA PGQDRIALEP PRTSPNLLLA GEAPSTRPQR
310 320 330 340 350
EAEGEPTART STSGSSDLPK APGGHLHLQA RRAGQNSDAG PPRGLTWVPE
360 370 380 390 400
GAGPVLGGCG RGMDQSCLSA DGAGRGCGRA TWSVREEQVK QWAAEMLVAL
410 420 430 440 450
EALHEQGVLC RDLHPGNLLL DQAGHIRLTY FGQWSEVEPQ CCGEAVDNLY
460 470 480 490 500
SAPEVGGISE LTEACDWWSF GSLLYELLTG MALSQSHPSG IQAHTQLQLP
510 520 530 540
EWLSRPAASL LTELLQFEPT RRLGMGEGGV SKLKSHPFFS TIQWSKLVG
Note: No experimental confirmation available.
Length:549
Mass (Da):60,036
Last modified:November 1, 1999 - v1
Checksum:iC5955B004EAC959A
GO
Isoform 2 (identifier: Q9Y6S9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     131-161: Missing.
     549-549: G → GTSLETHLRTLIHWLSGPKPDCPG

Note: No experimental confirmation available.
Show »
Length:541
Mass (Da):59,167
Checksum:i88C9760751DFCDA9
GO
Isoform 4 (identifier: Q9Y6S9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     223-255: GTLWSHLLSQAHSRHSGLSSGSTQERMKAQLNP → EQAWGPLSAPQAFGVCRQPLKCGALAGRGGSRL
     256-549: Missing.

Note: No experimental confirmation available.
Show »
Length:255
Mass (Da):28,380
Checksum:i692BAFB709865749
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti64 – 641D → G in BAB70808 (PubMed:14702039).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti21 – 211R → Q.1 Publication
Corresponds to variant rs7156590 [ dbSNP | Ensembl ].
VAR_041065
Natural varianti121 – 1211P → L.1 Publication
Corresponds to variant rs2286913 [ dbSNP | Ensembl ].
VAR_041066
Natural varianti332 – 3321R → W.1 Publication
VAR_041067

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei131 – 16131Missing in isoform 2. 1 PublicationVSP_036440Add
BLAST
Alternative sequencei223 – 25533GTLWS…AQLNP → EQAWGPLSAPQAFGVCRQPL KCGALAGRGGSRL in isoform 4. 1 PublicationVSP_017931Add
BLAST
Alternative sequencei256 – 549294Missing in isoform 4. 1 PublicationVSP_017932Add
BLAST
Alternative sequencei549 – 5491G → GTSLETHLRTLIHWLSGPKP DCPG in isoform 2. 1 PublicationVSP_036441

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK054800 mRNA. Translation: BAB70808.1.
AC006530 Genomic DNA. Translation: AAD30182.1.
BC004540 mRNA. Translation: AAH04540.1.
AL390152 mRNA. Translation: CAH10661.1.
CCDSiCCDS9834.2. [Q9Y6S9-1]
RefSeqiNP_113652.2. NM_031464.4. [Q9Y6S9-1]
XP_005268171.1. XM_005268114.2. [Q9Y6S9-1]
UniGeneiHs.414481.

Genome annotation databases

EnsembliENST00000354625; ENSP00000346644; ENSG00000198208. [Q9Y6S9-1]
ENST00000555009; ENSP00000450660; ENSG00000198208. [Q9Y6S9-2]
ENST00000555647; ENSP00000452027; ENSG00000198208. [Q9Y6S9-1]
ENST00000557413; ENSP00000450567; ENSG00000198208. [Q9Y6S9-1]
GeneIDi83694.
KEGGihsa:83694.
UCSCiuc010tux.3. human. [Q9Y6S9-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK054800 mRNA. Translation: BAB70808.1.
AC006530 Genomic DNA. Translation: AAD30182.1.
BC004540 mRNA. Translation: AAH04540.1.
AL390152 mRNA. Translation: CAH10661.1.
CCDSiCCDS9834.2. [Q9Y6S9-1]
RefSeqiNP_113652.2. NM_031464.4. [Q9Y6S9-1]
XP_005268171.1. XM_005268114.2. [Q9Y6S9-1]
UniGeneiHs.414481.

3D structure databases

ProteinModelPortaliQ9Y6S9.
SMRiQ9Y6S9. Positions 44-113, 386-547.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123728. 1 interaction.
IntActiQ9Y6S9. 1 interaction.
STRINGi9606.ENSP00000351086.

PTM databases

PhosphoSiteiQ9Y6S9.

Polymorphism and mutation databases

BioMutaiRPS6KL1.
DMDMi74762793.

Proteomic databases

EPDiQ9Y6S9.
MaxQBiQ9Y6S9.
PaxDbiQ9Y6S9.
PRIDEiQ9Y6S9.

Protocols and materials databases

DNASUi83694.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000354625; ENSP00000346644; ENSG00000198208. [Q9Y6S9-1]
ENST00000555009; ENSP00000450660; ENSG00000198208. [Q9Y6S9-2]
ENST00000555647; ENSP00000452027; ENSG00000198208. [Q9Y6S9-1]
ENST00000557413; ENSP00000450567; ENSG00000198208. [Q9Y6S9-1]
GeneIDi83694.
KEGGihsa:83694.
UCSCiuc010tux.3. human. [Q9Y6S9-1]

Organism-specific databases

CTDi83694.
GeneCardsiRPS6KL1.
H-InvDBHIX0202061.
HGNCiHGNC:20222. RPS6KL1.
HPAiHPA027451.
HPA027794.
neXtProtiNX_Q9Y6S9.
PharmGKBiPA134868364.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0603. Eukaryota.
ENOG410ZH1N. LUCA.
GeneTreeiENSGT00530000063268.
HOGENOMiHOG000154183.
HOVERGENiHBG084136.
InParanoidiQ9Y6S9.
OMAiECPPGPG.
OrthoDBiEOG78PV8C.
PhylomeDBiQ9Y6S9.
TreeFamiTF323964.

Enzyme and pathway databases

SignaLinkiQ9Y6S9.

Miscellaneous databases

GenomeRNAii83694.
NextBioi72663.
PROiQ9Y6S9.

Gene expression databases

BgeeiQ9Y6S9.
CleanExiHS_RPS6KL1.
ExpressionAtlasiQ9Y6S9. baseline and differential.
GenevisibleiQ9Y6S9. HS.

Family and domain databases

Gene3Di1.20.58.280. 1 hit.
InterProiIPR011009. Kinase-like_dom.
IPR007330. MIT.
IPR000719. Prot_kinase_dom.
[Graphical view]
PfamiPF04212. MIT. 1 hit.
PF00069. Pkinase. 1 hit.
[Graphical view]
SMARTiSM00745. MIT. 1 hit.
[Graphical view]
SUPFAMiSSF116846. SSF116846. 1 hit.
SSF56112. SSF56112. 2 hits.
PROSITEiPS50011. PROTEIN_KINASE_DOM. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
    Tissue: Cerebellum.
  2. "The DNA sequence and analysis of human chromosome 14."
    Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H.
    , Pepin K., Artiguenave F., Robert C., Cruaud C., Bruels T., Jaillon O., Friedlander L., Samson G., Brottier P., Cure S., Segurens B., Aniere F., Samain S., Crespeau H., Abbasi N., Aiach N., Boscus D., Dickhoff R., Dors M., Dubois I., Friedman C., Gouyvenoux M., James R., Madan A., Mairey-Estrada B., Mangenot S., Martins N., Menard M., Oztas S., Ratcliffe A., Shaffer T., Trask B., Vacherie B., Bellemere C., Belser C., Besnard-Gonnet M., Bartol-Mavel D., Boutard M., Briez-Silla S., Combette S., Dufosse-Laurent V., Ferron C., Lechaplais C., Louesse C., Muselet D., Magdelenat G., Pateau E., Petit E., Sirvain-Trukniewicz P., Trybou A., Vega-Czarny N., Bataille E., Bluet E., Bordelais I., Dubois M., Dumont C., Guerin T., Haffray S., Hammadi R., Muanga J., Pellouin V., Robert D., Wunderle E., Gauguet G., Roy A., Sainte-Marthe L., Verdier J., Verdier-Discala C., Hillier L.W., Fulton L., McPherson J., Matsuda F., Wilson R., Scarpelli C., Gyapay G., Wincker P., Saurin W., Quetier F., Waterston R., Hood L., Weissenbach J.
    Nature 421:601-607(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Lung.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 507-549.
    Tissue: Testis.
  5. "Patterns of somatic mutation in human cancer genomes."
    Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G.
    , Choudhury B., Clements J., Cole J., Dicks E., Forbes S., Gray K., Halliday K., Harrison R., Hills K., Hinton J., Jenkinson A., Jones D., Menzies A., Mironenko T., Perry J., Raine K., Richardson D., Shepherd R., Small A., Tofts C., Varian J., Webb T., West S., Widaa S., Yates A., Cahill D.P., Louis D.N., Goldstraw P., Nicholson A.G., Brasseur F., Looijenga L., Weber B.L., Chiew Y.-E., DeFazio A., Greaves M.F., Green A.R., Campbell P., Birney E., Easton D.F., Chenevix-Trench G., Tan M.-H., Khoo S.K., Teh B.T., Yuen S.T., Leung S.Y., Wooster R., Futreal P.A., Stratton M.R.
    Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANTS [LARGE SCALE ANALYSIS] GLN-21; LEU-121 AND TRP-332.

Entry informationi

Entry nameiRPKL1_HUMAN
AccessioniPrimary (citable) accession number: Q9Y6S9
Secondary accession number(s): A6NGM9
, Q69YT9, Q6ZMQ6, Q96NR9, Q9BSU9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 18, 2006
Last sequence update: November 1, 1999
Last modified: March 16, 2016
This is version 121 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.