Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9Y6P5

- SESN1_HUMAN

UniProt

Q9Y6P5 - SESN1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Sestrin-1

Gene

SESN1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli

Functioni

Involved in the reduction of peroxiredoxins. May also be regulator of cellular growth.1 Publication

GO - Biological processi

  1. cell cycle arrest Source: ProtInc
  2. cellular response to DNA damage stimulus Source: ProtInc
  3. negative regulation of cell proliferation Source: ProtInc
  4. regulation of protein kinase B signaling Source: Ensembl
  5. regulation of response to reactive oxygen species Source: InterPro
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Sestrin-1
Alternative name(s):
p53-regulated protein PA26
Gene namesi
Name:SESN1
Synonyms:PA26, SEST1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 6

Organism-specific databases

HGNCiHGNC:21595. SESN1.

Subcellular locationi

GO - Cellular componenti

  1. nucleus Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134927596.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 492492Sestrin-1PRO_0000221178Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei293 – 2931Phosphoserine1 Publication
Modified residuei314 – 3141Phosphoserine1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ9Y6P5.
PaxDbiQ9Y6P5.
PRIDEiQ9Y6P5.

PTM databases

PhosphoSiteiQ9Y6P5.

Expressioni

Tissue specificityi

Widely expressed.1 Publication

Inductioni

Isoform T2 and isoform T3 are induced by genotoxic stress (UV, gamma-irradiation and cytotoxic drugs) in a p53/TP53-dependent manner. Isoform T1 is not induced by p53/TP53.

Gene expression databases

BgeeiQ9Y6P5.
CleanExiHS_SESN1.
GenevestigatoriQ9Y6P5.

Interactioni

Protein-protein interaction databases

BioGridi118092. 6 interactions.
STRINGi9606.ENSP00000306734.

Structurei

3D structure databases

ProteinModelPortaliQ9Y6P5.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the sestrin family.Curated

Phylogenomic databases

eggNOGiNOG312456.
GeneTreeiENSGT00440000040103.
HOGENOMiHOG000232949.
HOVERGENiHBG054648.
InParanoidiQ9Y6P5.
KOiK10141.
OMAiRMYESFW.
OrthoDBiEOG7SBNNF.
PhylomeDBiQ9Y6P5.
TreeFamiTF314230.

Family and domain databases

Gene3Di1.20.1290.10. 1 hit.
InterProiIPR029032. AhpD-like.
IPR006730. Sestrin.
[Graphical view]
PfamiPF04636. PA26. 1 hit.
[Graphical view]
SUPFAMiSSF69118. SSF69118. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform T2 (identifier: Q9Y6P5-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRLAAAANEA YTAPLAVSGL LGCKQCGGGR DQDEELGIRI PRPLGQGPSR
60 70 80 90 100
FIPEKEILQV GSEDAQMHAL FADSFAALGR LDNITLVMVF HPQYLESFLK
110 120 130 140 150
TQHYLLQMDG PLPLHYRHYI GIMAAARHQC SYLVNLHVND FLHVGGDPKW
160 170 180 190 200
LNGLENAPQK LQNLGELNKV LAHRPWLITK EHIEGLLKAE EHSWSLAELV
210 220 230 240 250
HAVVLLTHYH SLASFTFGCG ISPEIHCDGG HTFRPPSVSN YCICDITNGN
260 270 280 290 300
HSVDEMPVNS AENVSVSDSF FEVEALMEKM RQLQECRDEE EASQEEMASR
310 320 330 340 350
FEIEKRESMF VFSSDDEEVT PARAVSRHFE DTSYGYKDFS RHGMHVPTFR
360 370 380 390 400
VQDYCWEDHG YSLVNRLYPD VGQLIDEKFH IAYNLTYNTM AMHKDVDTSM
410 420 430 440 450
LRRAIWNYIH CMFGIRYDDY DYGEINQLLD RSFKVYIKTV VCTPEKVTKR
460 470 480 490
MYDSFWRQFK HSEKVHVNLL LIEARMQAEL LYALRAITRY MT
Length:492
Mass (Da):56,557
Last modified:April 27, 2001 - v2
Checksum:i824CF6513634C35E
GO
Isoform T1 (identifier: Q9Y6P5-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: MRLAAAANEAYTAPLAVSGLLGCKQCGGGRDQDE → MAEGENEVRW...KSEFILKSIQ

Show »
Length:551
Mass (Da):63,826
Checksum:iABFE480007D623BE
GO
Isoform T3 (identifier: Q9Y6P5-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-66: Missing.

Show »
Length:426
Mass (Da):49,624
Checksum:i7B076B9C7783E125
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti44 – 441L → I.1 Publication
Corresponds to variant rs2273668 [ dbSNP | Ensembl ].
VAR_014210

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 6666Missing in isoform T3. 1 PublicationVSP_006060Add
BLAST
Alternative sequencei1 – 3434MRLAA…RDQDE → MAEGENEVRWDGLCSRDSTT RETALENIRQTILRKTEYLR SVKETPHRPSDGLSNTESSD GLNKLLAHLLMLSKRCPFKD VREKSEFILKSIQ in isoform T1. 2 PublicationsVSP_006059Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF033122 mRNA. Translation: AAD04812.1.
AF033120 mRNA. Translation: AAD04810.1.
AF033121 mRNA. Translation: AAD04811.1.
AL390208 Genomic DNA. Translation: CAI16720.1.
CH471051 Genomic DNA. Translation: EAW48367.1.
CH471051 Genomic DNA. Translation: EAW48368.1.
BC112036 mRNA. Translation: AAI12037.1.
BC113569 mRNA. Translation: AAI13570.1.
AK001886 mRNA. Translation: BAA91961.1.
CCDSiCCDS5070.1. [Q9Y6P5-2]
CCDS56444.1. [Q9Y6P5-3]
CCDS56445.1. [Q9Y6P5-1]
RefSeqiNP_001186862.1. NM_001199933.1. [Q9Y6P5-1]
NP_001186863.1. NM_001199934.1. [Q9Y6P5-3]
NP_055269.1. NM_014454.2. [Q9Y6P5-2]
UniGeneiHs.591336.

Genome annotation databases

EnsembliENST00000302071; ENSP00000306734; ENSG00000080546. [Q9Y6P5-3]
ENST00000356644; ENSP00000349061; ENSG00000080546. [Q9Y6P5-1]
ENST00000436639; ENSP00000393762; ENSG00000080546. [Q9Y6P5-2]
GeneIDi27244.
KEGGihsa:27244.
UCSCiuc003pst.4. human. [Q9Y6P5-1]
uc003psu.3. human. [Q9Y6P5-2]

Polymorphism databases

DMDMi13633953.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF033122 mRNA. Translation: AAD04812.1 .
AF033120 mRNA. Translation: AAD04810.1 .
AF033121 mRNA. Translation: AAD04811.1 .
AL390208 Genomic DNA. Translation: CAI16720.1 .
CH471051 Genomic DNA. Translation: EAW48367.1 .
CH471051 Genomic DNA. Translation: EAW48368.1 .
BC112036 mRNA. Translation: AAI12037.1 .
BC113569 mRNA. Translation: AAI13570.1 .
AK001886 mRNA. Translation: BAA91961.1 .
CCDSi CCDS5070.1. [Q9Y6P5-2 ]
CCDS56444.1. [Q9Y6P5-3 ]
CCDS56445.1. [Q9Y6P5-1 ]
RefSeqi NP_001186862.1. NM_001199933.1. [Q9Y6P5-1 ]
NP_001186863.1. NM_001199934.1. [Q9Y6P5-3 ]
NP_055269.1. NM_014454.2. [Q9Y6P5-2 ]
UniGenei Hs.591336.

3D structure databases

ProteinModelPortali Q9Y6P5.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 118092. 6 interactions.
STRINGi 9606.ENSP00000306734.

PTM databases

PhosphoSitei Q9Y6P5.

Polymorphism databases

DMDMi 13633953.

Proteomic databases

MaxQBi Q9Y6P5.
PaxDbi Q9Y6P5.
PRIDEi Q9Y6P5.

Protocols and materials databases

DNASUi 27244.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000302071 ; ENSP00000306734 ; ENSG00000080546 . [Q9Y6P5-3 ]
ENST00000356644 ; ENSP00000349061 ; ENSG00000080546 . [Q9Y6P5-1 ]
ENST00000436639 ; ENSP00000393762 ; ENSG00000080546 . [Q9Y6P5-2 ]
GeneIDi 27244.
KEGGi hsa:27244.
UCSCi uc003pst.4. human. [Q9Y6P5-1 ]
uc003psu.3. human. [Q9Y6P5-2 ]

Organism-specific databases

CTDi 27244.
GeneCardsi GC06M109307.
HGNCi HGNC:21595. SESN1.
MIMi 606103. gene.
neXtProti NX_Q9Y6P5.
PharmGKBi PA134927596.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG312456.
GeneTreei ENSGT00440000040103.
HOGENOMi HOG000232949.
HOVERGENi HBG054648.
InParanoidi Q9Y6P5.
KOi K10141.
OMAi RMYESFW.
OrthoDBi EOG7SBNNF.
PhylomeDBi Q9Y6P5.
TreeFami TF314230.

Miscellaneous databases

GeneWikii SESN1.
GenomeRNAii 27244.
NextBioi 50149.
PROi Q9Y6P5.
SOURCEi Search...

Gene expression databases

Bgeei Q9Y6P5.
CleanExi HS_SESN1.
Genevestigatori Q9Y6P5.

Family and domain databases

Gene3Di 1.20.1290.10. 1 hit.
InterProi IPR029032. AhpD-like.
IPR006730. Sestrin.
[Graphical view ]
Pfami PF04636. PA26. 1 hit.
[Graphical view ]
SUPFAMi SSF69118. SSF69118. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "PA26, a novel target of the p53 tumor suppressor and member of the GADD family of DNA damage and growth arrest inducible genes."
    Velasco-Miguel S., Buckbinder L., Jean P., Gelbert L., Talbott R., Laidlaw J., Seizinger B., Kley N.
    Oncogene 18:127-137(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS T1; T2 AND T3).
  2. "PA26 is a candidate gene for heterotaxia in humans: identification of a novel PA26-related gene family in human and mouse."
    Peeters H., Debeer P., Bairoch A., Wilquet V., Huysmans C., Parthoens E., Fryns J.-P., Gewillig M., Nakamura Y., Niikawa N., Van De Ven W., Devriendt K.
    Hum. Genet. 112:573-580(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA], VARIANT ILE-44, TISSUE SPECIFICITY.
  3. "The DNA sequence and analysis of human chromosome 6."
    Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
    , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
    Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM T1).
    Tissue: Lung.
  6. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 309-492.
    Tissue: Placenta.
  7. "Regeneration of peroxiredoxins by p53-regulated sestrins, homologs of bacterial AhpD."
    Budanov A.V., Sablina A.A., Feinstein E., Koonin E.V., Chumakov P.M.
    Science 304:596-600(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  8. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-293, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Embryonic kidney.
  9. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-314, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.

Entry informationi

Entry nameiSESN1_HUMAN
AccessioniPrimary (citable) accession number: Q9Y6P5
Secondary accession number(s): Q2M2B7
, Q5T316, Q9NV00, Q9UPD5, Q9Y6P6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 27, 2001
Last sequence update: April 27, 2001
Last modified: October 29, 2014
This is version 115 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3