Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9Y6P5 (SESN1_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 112. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Sestrin-1
Alternative name(s):
p53-regulated protein PA26
Gene names
Name:SESN1
Synonyms:PA26, SEST1
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length492 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Involved in the reduction of peroxiredoxins. May also be regulator of cellular growth. Ref.7

Subcellular location

Nucleus.

Tissue specificity

Widely expressed. Ref.2

Induction

Isoform T2 and isoform T3 are induced by genotoxic stress (UV, gamma-irradiation and cytotoxic drugs) in a p53/TP53-dependent manner. Isoform T1 is not induced by p53/TP53.

Sequence similarities

Belongs to the sestrin family.

Ontologies

Keywords
   Cellular componentNucleus
   Coding sequence diversityAlternative splicing
Polymorphism
   PTMPhosphoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processcell cycle arrest

Traceable author statement Ref.1. Source: ProtInc

cellular response to DNA damage stimulus

Traceable author statement Ref.1. Source: ProtInc

negative regulation of cell proliferation

Traceable author statement Ref.1. Source: ProtInc

   Cellular_componentnucleus

Traceable author statement Ref.1. Source: ProtInc

Complete GO annotation...

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform T2 (identifier: Q9Y6P5-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform T1 (identifier: Q9Y6P5-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: MRLAAAANEAYTAPLAVSGLLGCKQCGGGRDQDE → MAEGENEVRW...KSEFILKSIQ
Isoform T3 (identifier: Q9Y6P5-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-66: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 492492Sestrin-1
PRO_0000221178

Amino acid modifications

Modified residue2931Phosphoserine Ref.8
Modified residue3141Phosphoserine Ref.9

Natural variations

Alternative sequence1 – 6666Missing in isoform T3.
VSP_006060
Alternative sequence1 – 3434MRLAA…RDQDE → MAEGENEVRWDGLCSRDSTT RETALENIRQTILRKTEYLR SVKETPHRPSDGLSNTESSD GLNKLLAHLLMLSKRCPFKD VREKSEFILKSIQ in isoform T1.
VSP_006059
Natural variant441L → I. Ref.2
Corresponds to variant rs2273668 [ dbSNP | Ensembl ].
VAR_014210

Sequences

Sequence LengthMass (Da)Tools
Isoform T2 [UniParc].

Last modified April 27, 2001. Version 2.
Checksum: 824CF6513634C35E

FASTA49256,557
        10         20         30         40         50         60 
MRLAAAANEA YTAPLAVSGL LGCKQCGGGR DQDEELGIRI PRPLGQGPSR FIPEKEILQV 

        70         80         90        100        110        120 
GSEDAQMHAL FADSFAALGR LDNITLVMVF HPQYLESFLK TQHYLLQMDG PLPLHYRHYI 

       130        140        150        160        170        180 
GIMAAARHQC SYLVNLHVND FLHVGGDPKW LNGLENAPQK LQNLGELNKV LAHRPWLITK 

       190        200        210        220        230        240 
EHIEGLLKAE EHSWSLAELV HAVVLLTHYH SLASFTFGCG ISPEIHCDGG HTFRPPSVSN 

       250        260        270        280        290        300 
YCICDITNGN HSVDEMPVNS AENVSVSDSF FEVEALMEKM RQLQECRDEE EASQEEMASR 

       310        320        330        340        350        360 
FEIEKRESMF VFSSDDEEVT PARAVSRHFE DTSYGYKDFS RHGMHVPTFR VQDYCWEDHG 

       370        380        390        400        410        420 
YSLVNRLYPD VGQLIDEKFH IAYNLTYNTM AMHKDVDTSM LRRAIWNYIH CMFGIRYDDY 

       430        440        450        460        470        480 
DYGEINQLLD RSFKVYIKTV VCTPEKVTKR MYDSFWRQFK HSEKVHVNLL LIEARMQAEL 

       490 
LYALRAITRY MT 

« Hide

Isoform T1 [UniParc].

Checksum: ABFE480007D623BE
Show »

FASTA55163,826
Isoform T3 [UniParc].

Checksum: 7B076B9C7783E125
Show »

FASTA42649,624

References

« Hide 'large scale' references
[1]"PA26, a novel target of the p53 tumor suppressor and member of the GADD family of DNA damage and growth arrest inducible genes."
Velasco-Miguel S., Buckbinder L., Jean P., Gelbert L., Talbott R., Laidlaw J., Seizinger B., Kley N.
Oncogene 18:127-137(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS T1; T2 AND T3).
[2]"PA26 is a candidate gene for heterotaxia in humans: identification of a novel PA26-related gene family in human and mouse."
Peeters H., Debeer P., Bairoch A., Wilquet V., Huysmans C., Parthoens E., Fryns J.-P., Gewillig M., Nakamura Y., Niikawa N., Van De Ven W., Devriendt K.
Hum. Genet. 112:573-580(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA], VARIANT ILE-44, TISSUE SPECIFICITY.
[3]"The DNA sequence and analysis of human chromosome 6."
Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D. expand/collapse author list , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM T1).
Tissue: Lung.
[6]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 309-492.
Tissue: Placenta.
[7]"Regeneration of peroxiredoxins by p53-regulated sestrins, homologs of bacterial AhpD."
Budanov A.V., Sablina A.A., Feinstein E., Koonin E.V., Chumakov P.M.
Science 304:596-600(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION.
[8]"ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage."
Matsuoka S., Ballif B.A., Smogorzewska A., McDonald E.R. III, Hurov K.E., Luo J., Bakalarski C.E., Zhao Z., Solimini N., Lerenthal Y., Shiloh Y., Gygi S.P., Elledge S.J.
Science 316:1160-1166(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-293, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Embryonic kidney.
[9]"Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-314, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Leukemic T-cell.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF033122 mRNA. Translation: AAD04812.1.
AF033120 mRNA. Translation: AAD04810.1.
AF033121 mRNA. Translation: AAD04811.1.
AL390208 Genomic DNA. Translation: CAI16720.1.
CH471051 Genomic DNA. Translation: EAW48367.1.
CH471051 Genomic DNA. Translation: EAW48368.1.
BC112036 mRNA. Translation: AAI12037.1.
BC113569 mRNA. Translation: AAI13570.1.
AK001886 mRNA. Translation: BAA91961.1.
CCDSCCDS5070.1. [Q9Y6P5-2]
CCDS56444.1. [Q9Y6P5-3]
CCDS56445.1. [Q9Y6P5-1]
RefSeqNP_001186862.1. NM_001199933.1. [Q9Y6P5-1]
NP_001186863.1. NM_001199934.1. [Q9Y6P5-3]
NP_055269.1. NM_014454.2. [Q9Y6P5-2]
UniGeneHs.591336.

3D structure databases

ProteinModelPortalQ9Y6P5.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid118092. 6 interactions.
STRING9606.ENSP00000306734.

PTM databases

PhosphoSiteQ9Y6P5.

Polymorphism databases

DMDM13633953.

Proteomic databases

MaxQBQ9Y6P5.
PaxDbQ9Y6P5.
PRIDEQ9Y6P5.

Protocols and materials databases

DNASU27244.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000302071; ENSP00000306734; ENSG00000080546. [Q9Y6P5-3]
ENST00000356644; ENSP00000349061; ENSG00000080546. [Q9Y6P5-1]
ENST00000436639; ENSP00000393762; ENSG00000080546. [Q9Y6P5-2]
GeneID27244.
KEGGhsa:27244.
UCSCuc003pst.4. human. [Q9Y6P5-1]
uc003psu.3. human. [Q9Y6P5-2]

Organism-specific databases

CTD27244.
GeneCardsGC06M109353.
HGNCHGNC:21595. SESN1.
MIM606103. gene.
neXtProtNX_Q9Y6P5.
PharmGKBPA134927596.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG312456.
HOGENOMHOG000232949.
HOVERGENHBG054648.
KOK10141.
OMARMYESFW.
OrthoDBEOG7SBNNF.
PhylomeDBQ9Y6P5.
TreeFamTF314230.

Gene expression databases

BgeeQ9Y6P5.
CleanExHS_SESN1.
GenevestigatorQ9Y6P5.

Family and domain databases

Gene3D1.20.1290.10. 1 hit.
InterProIPR029032. AhpD-like.
IPR006730. Sestrin.
[Graphical view]
PfamPF04636. PA26. 1 hit.
[Graphical view]
SUPFAMSSF69118. SSF69118. 1 hit.
ProtoNetSearch...

Other

GeneWikiSESN1.
GenomeRNAi27244.
NextBio50149.
PROQ9Y6P5.
SOURCESearch...

Entry information

Entry nameSESN1_HUMAN
AccessionPrimary (citable) accession number: Q9Y6P5
Secondary accession number(s): Q2M2B7 expand/collapse secondary AC list , Q5T316, Q9NV00, Q9UPD5, Q9Y6P6
Entry history
Integrated into UniProtKB/Swiss-Prot: April 27, 2001
Last sequence update: April 27, 2001
Last modified: July 9, 2014
This is version 112 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 6

Human chromosome 6: entries, gene names and cross-references to MIM