Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9Y6P5

- SESN1_HUMAN

UniProt

Q9Y6P5 - SESN1_HUMAN

Protein

Sestrin-1

Gene

SESN1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 114 (01 Oct 2014)
      Sequence version 2 (27 Apr 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Involved in the reduction of peroxiredoxins. May also be regulator of cellular growth.1 Publication

    GO - Biological processi

    1. cell cycle arrest Source: ProtInc
    2. cellular response to DNA damage stimulus Source: ProtInc
    3. negative regulation of cell proliferation Source: ProtInc
    4. regulation of response to reactive oxygen species Source: InterPro

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Sestrin-1
    Alternative name(s):
    p53-regulated protein PA26
    Gene namesi
    Name:SESN1
    Synonyms:PA26, SEST1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 6

    Organism-specific databases

    HGNCiHGNC:21595. SESN1.

    Subcellular locationi

    GO - Cellular componenti

    1. nucleus Source: ProtInc

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134927596.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 492492Sestrin-1PRO_0000221178Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei293 – 2931Phosphoserine1 Publication
    Modified residuei314 – 3141Phosphoserine1 Publication

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ9Y6P5.
    PaxDbiQ9Y6P5.
    PRIDEiQ9Y6P5.

    PTM databases

    PhosphoSiteiQ9Y6P5.

    Expressioni

    Tissue specificityi

    Widely expressed.1 Publication

    Inductioni

    Isoform T2 and isoform T3 are induced by genotoxic stress (UV, gamma-irradiation and cytotoxic drugs) in a p53/TP53-dependent manner. Isoform T1 is not induced by p53/TP53.

    Gene expression databases

    BgeeiQ9Y6P5.
    CleanExiHS_SESN1.
    GenevestigatoriQ9Y6P5.

    Interactioni

    Protein-protein interaction databases

    BioGridi118092. 6 interactions.
    STRINGi9606.ENSP00000306734.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9Y6P5.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the sestrin family.Curated

    Phylogenomic databases

    eggNOGiNOG312456.
    HOGENOMiHOG000232949.
    HOVERGENiHBG054648.
    KOiK10141.
    OMAiRMYESFW.
    OrthoDBiEOG7SBNNF.
    PhylomeDBiQ9Y6P5.
    TreeFamiTF314230.

    Family and domain databases

    Gene3Di1.20.1290.10. 1 hit.
    InterProiIPR029032. AhpD-like.
    IPR006730. Sestrin.
    [Graphical view]
    PfamiPF04636. PA26. 1 hit.
    [Graphical view]
    SUPFAMiSSF69118. SSF69118. 1 hit.

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform T2 (identifier: Q9Y6P5-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MRLAAAANEA YTAPLAVSGL LGCKQCGGGR DQDEELGIRI PRPLGQGPSR    50
    FIPEKEILQV GSEDAQMHAL FADSFAALGR LDNITLVMVF HPQYLESFLK 100
    TQHYLLQMDG PLPLHYRHYI GIMAAARHQC SYLVNLHVND FLHVGGDPKW 150
    LNGLENAPQK LQNLGELNKV LAHRPWLITK EHIEGLLKAE EHSWSLAELV 200
    HAVVLLTHYH SLASFTFGCG ISPEIHCDGG HTFRPPSVSN YCICDITNGN 250
    HSVDEMPVNS AENVSVSDSF FEVEALMEKM RQLQECRDEE EASQEEMASR 300
    FEIEKRESMF VFSSDDEEVT PARAVSRHFE DTSYGYKDFS RHGMHVPTFR 350
    VQDYCWEDHG YSLVNRLYPD VGQLIDEKFH IAYNLTYNTM AMHKDVDTSM 400
    LRRAIWNYIH CMFGIRYDDY DYGEINQLLD RSFKVYIKTV VCTPEKVTKR 450
    MYDSFWRQFK HSEKVHVNLL LIEARMQAEL LYALRAITRY MT 492
    Length:492
    Mass (Da):56,557
    Last modified:April 27, 2001 - v2
    Checksum:i824CF6513634C35E
    GO
    Isoform T1 (identifier: Q9Y6P5-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-34: MRLAAAANEAYTAPLAVSGLLGCKQCGGGRDQDE → MAEGENEVRW...KSEFILKSIQ

    Show »
    Length:551
    Mass (Da):63,826
    Checksum:iABFE480007D623BE
    GO
    Isoform T3 (identifier: Q9Y6P5-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-66: Missing.

    Show »
    Length:426
    Mass (Da):49,624
    Checksum:i7B076B9C7783E125
    GO

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti44 – 441L → I.1 Publication
    Corresponds to variant rs2273668 [ dbSNP | Ensembl ].
    VAR_014210

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 6666Missing in isoform T3. 1 PublicationVSP_006060Add
    BLAST
    Alternative sequencei1 – 3434MRLAA…RDQDE → MAEGENEVRWDGLCSRDSTT RETALENIRQTILRKTEYLR SVKETPHRPSDGLSNTESSD GLNKLLAHLLMLSKRCPFKD VREKSEFILKSIQ in isoform T1. 2 PublicationsVSP_006059Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF033122 mRNA. Translation: AAD04812.1.
    AF033120 mRNA. Translation: AAD04810.1.
    AF033121 mRNA. Translation: AAD04811.1.
    AL390208 Genomic DNA. Translation: CAI16720.1.
    CH471051 Genomic DNA. Translation: EAW48367.1.
    CH471051 Genomic DNA. Translation: EAW48368.1.
    BC112036 mRNA. Translation: AAI12037.1.
    BC113569 mRNA. Translation: AAI13570.1.
    AK001886 mRNA. Translation: BAA91961.1.
    CCDSiCCDS5070.1. [Q9Y6P5-2]
    CCDS56444.1. [Q9Y6P5-3]
    CCDS56445.1. [Q9Y6P5-1]
    RefSeqiNP_001186862.1. NM_001199933.1. [Q9Y6P5-1]
    NP_001186863.1. NM_001199934.1. [Q9Y6P5-3]
    NP_055269.1. NM_014454.2. [Q9Y6P5-2]
    UniGeneiHs.591336.

    Genome annotation databases

    EnsembliENST00000302071; ENSP00000306734; ENSG00000080546. [Q9Y6P5-3]
    ENST00000356644; ENSP00000349061; ENSG00000080546. [Q9Y6P5-1]
    ENST00000436639; ENSP00000393762; ENSG00000080546. [Q9Y6P5-2]
    GeneIDi27244.
    KEGGihsa:27244.
    UCSCiuc003pst.4. human. [Q9Y6P5-1]
    uc003psu.3. human. [Q9Y6P5-2]

    Polymorphism databases

    DMDMi13633953.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF033122 mRNA. Translation: AAD04812.1 .
    AF033120 mRNA. Translation: AAD04810.1 .
    AF033121 mRNA. Translation: AAD04811.1 .
    AL390208 Genomic DNA. Translation: CAI16720.1 .
    CH471051 Genomic DNA. Translation: EAW48367.1 .
    CH471051 Genomic DNA. Translation: EAW48368.1 .
    BC112036 mRNA. Translation: AAI12037.1 .
    BC113569 mRNA. Translation: AAI13570.1 .
    AK001886 mRNA. Translation: BAA91961.1 .
    CCDSi CCDS5070.1. [Q9Y6P5-2 ]
    CCDS56444.1. [Q9Y6P5-3 ]
    CCDS56445.1. [Q9Y6P5-1 ]
    RefSeqi NP_001186862.1. NM_001199933.1. [Q9Y6P5-1 ]
    NP_001186863.1. NM_001199934.1. [Q9Y6P5-3 ]
    NP_055269.1. NM_014454.2. [Q9Y6P5-2 ]
    UniGenei Hs.591336.

    3D structure databases

    ProteinModelPortali Q9Y6P5.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 118092. 6 interactions.
    STRINGi 9606.ENSP00000306734.

    PTM databases

    PhosphoSitei Q9Y6P5.

    Polymorphism databases

    DMDMi 13633953.

    Proteomic databases

    MaxQBi Q9Y6P5.
    PaxDbi Q9Y6P5.
    PRIDEi Q9Y6P5.

    Protocols and materials databases

    DNASUi 27244.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000302071 ; ENSP00000306734 ; ENSG00000080546 . [Q9Y6P5-3 ]
    ENST00000356644 ; ENSP00000349061 ; ENSG00000080546 . [Q9Y6P5-1 ]
    ENST00000436639 ; ENSP00000393762 ; ENSG00000080546 . [Q9Y6P5-2 ]
    GeneIDi 27244.
    KEGGi hsa:27244.
    UCSCi uc003pst.4. human. [Q9Y6P5-1 ]
    uc003psu.3. human. [Q9Y6P5-2 ]

    Organism-specific databases

    CTDi 27244.
    GeneCardsi GC06M109353.
    HGNCi HGNC:21595. SESN1.
    MIMi 606103. gene.
    neXtProti NX_Q9Y6P5.
    PharmGKBi PA134927596.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG312456.
    HOGENOMi HOG000232949.
    HOVERGENi HBG054648.
    KOi K10141.
    OMAi RMYESFW.
    OrthoDBi EOG7SBNNF.
    PhylomeDBi Q9Y6P5.
    TreeFami TF314230.

    Miscellaneous databases

    GeneWikii SESN1.
    GenomeRNAii 27244.
    NextBioi 50149.
    PROi Q9Y6P5.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q9Y6P5.
    CleanExi HS_SESN1.
    Genevestigatori Q9Y6P5.

    Family and domain databases

    Gene3Di 1.20.1290.10. 1 hit.
    InterProi IPR029032. AhpD-like.
    IPR006730. Sestrin.
    [Graphical view ]
    Pfami PF04636. PA26. 1 hit.
    [Graphical view ]
    SUPFAMi SSF69118. SSF69118. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "PA26, a novel target of the p53 tumor suppressor and member of the GADD family of DNA damage and growth arrest inducible genes."
      Velasco-Miguel S., Buckbinder L., Jean P., Gelbert L., Talbott R., Laidlaw J., Seizinger B., Kley N.
      Oncogene 18:127-137(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS T1; T2 AND T3).
    2. "PA26 is a candidate gene for heterotaxia in humans: identification of a novel PA26-related gene family in human and mouse."
      Peeters H., Debeer P., Bairoch A., Wilquet V., Huysmans C., Parthoens E., Fryns J.-P., Gewillig M., Nakamura Y., Niikawa N., Van De Ven W., Devriendt K.
      Hum. Genet. 112:573-580(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA], VARIANT ILE-44, TISSUE SPECIFICITY.
    3. "The DNA sequence and analysis of human chromosome 6."
      Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
      , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
      Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM T1).
      Tissue: Lung.
    6. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 309-492.
      Tissue: Placenta.
    7. "Regeneration of peroxiredoxins by p53-regulated sestrins, homologs of bacterial AhpD."
      Budanov A.V., Sablina A.A., Feinstein E., Koonin E.V., Chumakov P.M.
      Science 304:596-600(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION.
    8. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-293, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Embryonic kidney.
    9. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-314, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.

    Entry informationi

    Entry nameiSESN1_HUMAN
    AccessioniPrimary (citable) accession number: Q9Y6P5
    Secondary accession number(s): Q2M2B7
    , Q5T316, Q9NV00, Q9UPD5, Q9Y6P6
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: April 27, 2001
    Last sequence update: April 27, 2001
    Last modified: October 1, 2014
    This is version 114 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 6
      Human chromosome 6: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3