Q9Y6N9 (USH1C_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 122.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Harmonin Alternative name(s): Antigen NY-CO-38/NY-CO-37 Autoimmune enteropathy-related antigen AIE-75 Protein PDZ-73 Renal carcinoma antigen NY-REN-3 Usher syndrome type-1C protein | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 552 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Required for normal development and maintenance of cochlear hair cell bundles. Anchoring/scaffolding protein that is a part of the functional network formed by USH1C, USH1G, CDH23 and MYO7A that mediates mechanotransduction in cochlear hair cells. Required for normal hearing By similarity. |
| Subunit structure | Interacts with F-actin. Interacts with HARP By similarity. Interacts with USH1G/SANS, USH2A and SLC4A7. Interacts (via the first PDZ domain) with the C-terminus of USHBP1. Interacts (via N-terminus and second PDZ domain) with CDH23. Part of a complex composed of USH1C, USH1G and MYO7A. Ref.9 Ref.11 Ref.13 Ref.14 Ref.16 Ref.17 |
| Subcellular location | Cytoplasm › cytosol. Cytoplasm › cytoskeleton. Note: Colocalizes with F-actin By similarity. Detected at the tip of cochlear hair cell stereocilia. Ref.14 Ref.16 Ref.17 |
| Tissue specificity | Expressed in small intestine, colon, kidney, eye and weakly in pancreas. Expressed also in vestibule of the inner ear. Ref.11 |
| Domain | The PDZ domain 1 mediates interactions with USH1G/SANS and SLC4A7. Ref.17 The N-terminal region constitutes an independently folded domain that has structural similarity with the CCM2 C-terminus, despite very low sequence similarity. Ref.17 |
| Involvement in disease | Usher syndrome 1C (USH1C) [MIM:276904]: USH is a genetically heterogeneous condition characterized by the association of retinitis pigmentosa with sensorineural deafness. Age at onset and differences in auditory and vestibular function distinguish Usher syndrome type 1 (USH1), Usher syndrome type 2 (USH2) and Usher syndrome type 3 (USH3). USH1 is characterized by profound congenital sensorineural deafness, absent vestibular function and prepubertal onset of progressive retinitis pigmentosa leading to blindness. Deafness, autosomal recessive, 18A (DFNB18A) [MIM:602092]: A form of non-syndromic sensorineural hearing loss. Sensorineural deafness results from damage to the neural receptors of the inner ear, the nerve pathways to the brain, or the area of the brain that receives sound information. |
| Sequence similarities | Contains 3 PDZ (DHR) domains. |
| Sequence caution | The sequence AAC18049.1 differs from that shown. Reason: Frameshift at position 552. |
Ontologies
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9Y6N9-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9Y6N9-2) The sequence of this isoform differs from the canonical sequence as follows: 1-31: Missing. | ||||||
| Isoform 3 (identifier: Q9Y6N9-3) The sequence of this isoform differs from the canonical sequence as follows: 404-552: Missing. | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform 4 (identifier: Q9Y6N9-4) The sequence of this isoform differs from the canonical sequence as follows: 274-292: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 5 (identifier: Q9Y6N9-5) The sequence of this isoform differs from the canonical sequence as follows: 404-427: YDQGVEPELEPADDLDGGTEEQGE → SFGWFYRYDG...RMVVYQTAFR 550-552: TFF → ASLPSSVAESPQPVRKLLEDRAAVHRHGFLLQLEPTDLLLKSKRGNQIHR | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 552 | 552 | Harmonin | PRO_0000065727 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 87 – 169 | 83 | PDZ 1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 211 – 293 | 83 | PDZ 2 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 452 – 537 | 86 | PDZ 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 1 – 86 | 86 | N-terminal domain | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Coiled coil | 310 – 377 | 68 | Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 31 | 31 | Missing in isoform 2. | VSP_003789 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 274 – 292 | 19 | Missing in isoform 4. | VSP_007422 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 404 – 552 | 149 | Missing in isoform 3. | VSP_003790 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 404 – 427 | 24 | YDQGV…EEQGE → SFGWFYRYDGKFPTIRKKGK DKKKAKYGSLQDLRKNKKEL EFEQKLYKEKEEMLEKEKQL KINRLAQEVSETEREDLEES EKIQYWVERLCQTRLEQISS ADNEISEMTTGPPPPPPSVS PLAPPLRRFAGGLHLHTTDL DDIPLDMFYYPPKTPSALPV MPHPPPSNPPHKVPAPPVLP LSGHVSASSSPWVQRTPPPI PIPPPPSVPTQDLTPTRPLP SALEEALSNHPFRTGDTGNP VEDWEAKNHSGKPTNSPVPE QSFPPTPKTFCPSPQPPRGP GVSTISKPVMVHQEPNFIYR PAVKSEVLPQEMLKRMVVYQ TAFR in isoform 5. | VSP_043520 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 550 – 552 | 3 | TFF → ASLPSSVAESPQPVRKLLED RAAVHRHGFLLQLEPTDLLL KSKRGNQIHR in isoform 5. | VSP_043521 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 519 | 1 | E → D. Ref.1 Ref.3 Ref.6 Corresponds to variant rs1064074 [ dbSNP | Ensembl ]. | VAR_012320 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 103 | 1 | R → H: Strongly reduced affinity for USH1G. Ref.17 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 103 | 1 | R → S in BAA81739. Ref.2 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 280 | 1 | S → N in AAC18049. Ref.1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 280 | 1 | S → N in AAC18048. Ref.1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 305 | 1 | A → T in BAA81739. Ref.2 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 2 – 16 | 15 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 20 – 36 | 17 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 39 – 46 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 47 – 49 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 53 – 56 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 57 – 62 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 63 – 65 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 68 – 70 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 71 – 77 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 86 – 91 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 100 – 105 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 106 – 108 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 110 – 117 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 122 – 125 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 132 – 137 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 147 – 154 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 156 – 166 | 11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 169 – 172 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 181 – 184 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 185 – 191 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 208 – 214 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 217 – 220 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 224 – 228 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 231 – 233 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 235 – 241 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 246 – 251 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 257 – 261 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 273 – 280 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 282 – 288 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 292 – 294 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 295 – 298 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Characterization of human colon cancer antigens recognized by autologous antibodies." Scanlan M.J., Chen Y.-T., Williamson B., Gure A.O., Stockert E., Gordan J.D., Tuereci O., Sahin U., Pfreundschuh M., Old L.J. Int. J. Cancer 76:652-658(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 3), VARIANT ASP-519. Tissue: Colon cancer. |
| [2] | "Identification of an autoimmune enteropathy-related 75-kilodalton antigen." Kobayashi I., Imamura K., Kubota M., Ishikawa S., Yamada M., Tonoki H., Okano M., Storch W.B., Moriuchi T., Sakiyama Y., Kobayashi K. Gastroenterology 117:823-830(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2). Tissue: Duodenum. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT ASP-519. Tissue: Kidney. |
| [4] | "Human chromosome 11 DNA sequence and analysis including novel gene identification." Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. Sakaki Y.Nature 440:497-500(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4), VARIANT ASP-519. Tissue: Colon. |
| [7] | "Antigens recognized by autologous antibody in patients with renal-cell carcinoma." Scanlan M.J., Gordan J.D., Williamson B., Stockert E., Bander N.H., Jongeneel C.V., Gure A.O., Jaeger D., Jaeger E., Knuth A., Chen Y.-T., Old L.J. Int. J. Cancer 83:456-464(1999) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION AS A RENAL CANCER ANTIGEN. Tissue: Renal cell carcinoma. |
| [8] | "A defect in harmonin, a PDZ domain-containing protein expressed in the inner ear sensory hair cells, underlies Usher syndrome type 1C." Verpy E., Leibovici M., Zwaenepoel I., Liu X.-Z., Gal A., Salem N., Mansour A., Blanchard S., Kobayashi I., Keats B.J.B., Slim R., Petit C. Nat. Genet. 26:51-55(2000) [PubMed] [Europe PMC] [Abstract] Cited for: INVOLVEMENT IN USH1C, ALTERNATIVE SPLICING (ISOFORM 5). |
| [9] | "Interaction of MCC2, a novel homologue of MCC tumor suppressor, with PDZ-domain protein AIE-75." Ishikawa S., Kobayashi I., Hamada J., Tada M., Hirai A., Furuuchi K., Takahashi Y., Ba Y., Moriuchi T. Gene 267:101-110(2001) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH USHBP1. |
| [10] | "Nonsyndromic recessive deafness DFNB18 and Usher syndrome type IC are allelic mutations of USHIC." Ahmed Z.M., Smith T.N., Riazuddin S., Makishima T., Ghosh M., Bokhari S., Menon P.S., Deshmukh D., Griffith A.J., Riazuddin S., Friedman T.B., Wilcox E.R. Hum. Genet. 110:527-531(2002) [PubMed] [Europe PMC] [Abstract] Cited for: INVOLVEMENT IN DFNB18A. |
| [11] | "Usher syndrome type I G (USH1G) is caused by mutations in the gene encoding SANS, a protein that associates with the USH1C protein, harmonin." Weil D., El-Amraoui A., Masmoudi S., Mustapha M., Kikkawa Y., Laine S., Delmaghani S., Adato A., Nadifi S., Zina Z.B., Hamel C., Gal A., Ayadi H., Yonekawa H., Petit C. Hum. Mol. Genet. 12:463-471(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH USH1G/SANS, TISSUE SPECIFICITY. |
| [12] | "An unappreciated role for RNA surveillance." Hillman R.T., Green R.E., Brenner S.E. Genome Biol. 5:R8.1-R8.16(2004) [PubMed] [Europe PMC] [Abstract] Cited for: SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S). |
| [13] | "Scaffold protein harmonin (USH1C) provides molecular links between Usher syndrome type 1 and type 2." Reiners J., van Wijk E., Maerker T., Zimmermann U., Juergens K., te Brinke H., Overlack N., Roepman R., Knipper M., Kremer H., Wolfrum U. Hum. Mol. Genet. 14:3933-3943(2005) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH SLC4A7 AND USH2A. |
| [14] | "Myosin VIIa and sans localization at stereocilia upper tip-link density implicates these Usher syndrome proteins in mechanotransduction." Grati M., Kachar B. Proc. Natl. Acad. Sci. U.S.A. 108:11476-11481(2011) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION, IDENTIFICATION IN A COMPLEX WITH MYO7A AND USH1G. |
| [15] | "Solution structure of the second PDZ domain of harmonin protein." RIKEN structural genomics initiative (RSGI) Submitted (NOV-2005) to the PDB data bank Cited for: STRUCTURE BY NMR OF 197-301. |
| [16] | "Assembling stable hair cell tip link complex via multidentate interactions between harmonin and cadherin 23." Pan L., Yan J., Wu L., Zhang M. Proc. Natl. Acad. Sci. U.S.A. 106:5575-5580(2009) [PubMed] [Europe PMC] [Abstract] Cited for: STRUCTURE BY NMR OF 1-80 AND 208-299 IN COMPLEX WITH CDH23, SUBCELLULAR LOCATION, INTERACTION WITH CDH23. |
| [17] | "The structure of the harmonin/sans complex reveals an unexpected interaction mode of the two Usher syndrome proteins." Yan J., Pan L., Chen X., Wu L., Zhang M. Proc. Natl. Acad. Sci. U.S.A. 107:4040-4045(2010) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.3 ANGSTROMS) OF 1-192 IN COMPLEX WITH USH1G, INTERACTION WITH USH1G, MUTAGENESIS OF ARG-103, DOMAIN, SUBCELLULAR LOCATION. |
| + | Additional computationally mapped references. |
Web resources
| Mutations of the USH1C gene Retina International's Scientific Newsletter |
| GeneReviews |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF039700 mRNA. Translation: AAC18049.1. Frameshift. AF039699 mRNA. Translation: AAC18048.1. AB006955 mRNA. Translation: BAA81739.1. AB018687 mRNA. Translation: BAA81740.1. AK290788 mRNA. Translation: BAF83477.1. AC124799 Genomic DNA. No translation available. BC016057 mRNA. Translation: AAH16057.1. CH471064 Genomic DNA. Translation: EAW68432.1. BK000147 mRNA. Translation: DAA00086.1. | ||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00215861. IPI00218195. IPI00412105. IPI00478105. IPI00478519. | ||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_005700.2. NM_005709.3. NP_710142.1. NM_153676.3. | ||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.502072. | ||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | Q9Y6N9. | ||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||
| DIP | DIP-41473N. | ||||||||||||||||||||||||||||||||||||||||||
| IntAct | Q9Y6N9. 1 interaction. | ||||||||||||||||||||||||||||||||||||||||||
| MINT | MINT-196953. | ||||||||||||||||||||||||||||||||||||||||||
| STRING | 9606.ENSP00000005226. | ||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | Q9Y6N9. | ||||||||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||||||||
| DMDM | 160113087. | ||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||
| PaxDb | Q9Y6N9. | ||||||||||||||||||||||||||||||||||||||||||
| PRIDE | Q9Y6N9. | ||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||
| DNASU | 10083. | ||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000005226; ENSP00000005226; ENSG00000006611. ENST00000318024; ENSP00000317018; ENSG00000006611. ENST00000526313; ENSP00000432236; ENSG00000006611. ENST00000527020; ENSP00000436934; ENSG00000006611. ENST00000527720; ENSP00000432944; ENSG00000006611. | ||||||||||||||||||||||||||||||||||||||||||
| GeneID | 10083. | ||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:10083. | ||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc001mnd.3. human. uc001mne.3. human. uc009yhb.3. human. | ||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||
| CTD | 10083. | ||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC11M017515. | ||||||||||||||||||||||||||||||||||||||||||
| H-InvDB | HIX0009478. | ||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:12597. USH1C. | ||||||||||||||||||||||||||||||||||||||||||
| HPA | CAB013690. HPA027398. HPA027492. HPA028033. | ||||||||||||||||||||||||||||||||||||||||||
| MIM | 276900. phenotype. 276904. phenotype. 602092. phenotype. 605242. gene. | ||||||||||||||||||||||||||||||||||||||||||
| neXtProt | NX_Q9Y6N9. | ||||||||||||||||||||||||||||||||||||||||||
| Orphanet | 90636. Autosomal recessive nonsyndromic sensorineural deafness type DFNB. 231169. Usher syndrome type 1. | ||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA37226. | ||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||
| eggNOG | NOG255885. | ||||||||||||||||||||||||||||||||||||||||||
| HOGENOM | HOG000126890. | ||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG057181. | ||||||||||||||||||||||||||||||||||||||||||
| OMA | KRLAMES. | ||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | Q9Y6N9. | ||||||||||||||||||||||||||||||||||||||||||
| Bgee | Q9Y6N9. | ||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_USH1C. | ||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | Q9Y6N9. | ||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000006611. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR001478. PDZ. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF00595. PDZ. 3 hits. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00228. PDZ. 3 hits. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| SUPFAM | SSF50156. PDZ. 3 hits. | ||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS50106. PDZ. 3 hits. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||
| EvolutionaryTrace | Q9Y6N9. | ||||||||||||||||||||||||||||||||||||||||||
| GenomeRNAi | 10083. | ||||||||||||||||||||||||||||||||||||||||||
| NextBio | 38119. | ||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | USH1C_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9Y6N9 Secondary accession number(s): A8K423 Q9UPC3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 11 Human chromosome 11: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
