Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9Y6N7

- ROBO1_HUMAN

UniProt

Q9Y6N7 - ROBO1_HUMAN

Protein

Roundabout homolog 1

Gene

ROBO1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 129 (01 Oct 2014)
      Sequence version 1 (01 Nov 1999)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Receptor for SLIT1 and SLIT2 which are thought to act as molecular guidance cue in cellular migration, including axonal navigation at the ventral midline of the neural tube and projection of axons to different regions during neuronal development. In axon growth cones, the silencing of the attractive effect of NTN1 by SLIT2 may require the formation of a ROBO1-DCC complex. May be required for lung development.1 Publication

    GO - Molecular functioni

    1. axon guidance receptor activity Source: ProtInc
    2. identical protein binding Source: UniProtKB
    3. LRR domain binding Source: UniProtKB
    4. protein binding Source: UniProtKB

    GO - Biological processi

    1. activation of cysteine-type endopeptidase activity involved in apoptotic process Source: UniProtKB
    2. axon guidance Source: Reactome
    3. axon midline choice point recognition Source: UniProtKB
    4. cell adhesion Source: ProtInc
    5. cell migration involved in sprouting angiogenesis Source: BHF-UCL
    6. chemorepulsion involved in postnatal olfactory bulb interneuron migration Source: UniProtKB
    7. homophilic cell adhesion Source: UniProtKB
    8. mammary duct terminal end bud growth Source: Ensembl
    9. negative regulation of chemokine-mediated signaling pathway Source: BHF-UCL
    10. negative regulation of mammary gland epithelial cell proliferation Source: BHF-UCL
    11. negative regulation of negative chemotaxis Source: UniProtKB
    12. nervous system development Source: ProtInc
    13. positive regulation of axonogenesis Source: UniProtKB
    14. Roundabout signaling pathway Source: BHF-UCL

    Keywords - Molecular functioni

    Developmental protein, Receptor

    Keywords - Biological processi

    Chemotaxis, Differentiation, Neurogenesis

    Enzyme and pathway databases

    ReactomeiREACT_19226. Activation of Rac.
    REACT_19230. Role of Abl in Robo-Slit signaling.
    REACT_19342. Inactivation of Cdc42 and Rac.
    REACT_19351. Signaling by Robo receptor.
    REACT_19376. Regulation of Commissural axon pathfinding by Slit and Robo.
    REACT_22237. Netrin-1 signaling.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Roundabout homolog 1
    Alternative name(s):
    Deleted in U twenty twenty
    H-Robo-1
    Gene namesi
    Name:ROBO1
    Synonyms:DUTT1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 3

    Organism-specific databases

    HGNCiHGNC:10249. ROBO1.

    Subcellular locationi

    GO - Cellular componenti

    1. axolemma Source: Ensembl
    2. cell surface Source: UniProtKB
    3. cytoplasm Source: UniProtKB
    4. integral component of plasma membrane Source: ProtInc
    5. plasma membrane Source: Reactome

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA34620.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2525Sequence AnalysisAdd
    BLAST
    Chaini26 – 16511626Roundabout homolog 1PRO_0000031033Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi89 ↔ 1471 PublicationPROSITE-ProRule annotation
    Glycosylationi160 – 1601N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi191 ↔ 240PROSITE-ProRule annotation
    Disulfide bondi283 ↔ 330PROSITE-ProRule annotation
    Disulfide bondi372 ↔ 428PROSITE-ProRule annotation
    Glycosylationi463 – 4631N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi476 ↔ 525PROSITE-ProRule annotation
    Glycosylationi790 – 7901N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi820 – 8201N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi827 – 8271N-linked (GlcNAc...)Sequence Analysis
    Modified residuei940 – 9401Phosphoserine2 Publications
    Modified residuei1038 – 10381Phosphotyrosine; by ABL; in vitro1 Publication
    Modified residuei1055 – 10551Phosphoserine1 Publication
    Modified residuei1073 – 10731Phosphotyrosine; by ABL; in vitro1 Publication
    Modified residuei1114 – 11141Phosphotyrosine; by ABL; in vitro1 Publication
    Modified residuei1240 – 12401Phosphothreonine1 Publication
    Modified residuei1297 – 12971Phosphoserine1 Publication

    Post-translational modificationi

    Ubiquitinated. May be deubiquitinated by USP33 By similarity.By similarity

    Keywords - PTMi

    Disulfide bond, Glycoprotein, Phosphoprotein, Ubl conjugation

    Proteomic databases

    MaxQBiQ9Y6N7.
    PaxDbiQ9Y6N7.
    PRIDEiQ9Y6N7.

    PTM databases

    PhosphoSiteiQ9Y6N7.

    Expressioni

    Tissue specificityi

    Widely expressed, with exception of kidney.1 Publication

    Gene expression databases

    ArrayExpressiQ9Y6N7.
    BgeeiQ9Y6N7.
    CleanExiHS_ROBO1.
    GenevestigatoriQ9Y6N7.

    Organism-specific databases

    HPAiCAB013524.

    Interactioni

    Subunit structurei

    Interacts with SLIT1 and SLIT2.3 Publications

    Protein-protein interaction databases

    BioGridi112018. 5 interactions.
    DIPiDIP-33034N.
    IntActiQ9Y6N7. 4 interactions.
    MINTiMINT-1392694.
    STRINGi9606.ENSP00000381450.

    Structurei

    Secondary structure

    1
    1651
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi66 – 727
    Beta strandi77 – 793
    Beta strandi85 – 873
    Beta strandi90 – 956
    Beta strandi98 – 1036
    Turni111 – 1133
    Beta strandi118 – 1214
    Beta strandi127 – 1315
    Beta strandi143 – 1519
    Beta strandi154 – 1574
    Beta strandi161 – 1655
    Beta strandi179 – 1824
    Beta strandi187 – 1904
    Beta strandi196 – 1983
    Beta strandi201 – 2066
    Beta strandi209 – 2113
    Beta strandi213 – 2153
    Beta strandi218 – 2214
    Beta strandi224 – 2296
    Helixi232 – 2343
    Beta strandi236 – 2449
    Beta strandi247 – 2504
    Beta strandi254 – 2596
    Helixi261 – 2666
    Beta strandi464 – 4674
    Beta strandi471 – 4755
    Beta strandi485 – 49410
    Beta strandi502 – 5065
    Beta strandi509 – 5146
    Helixi517 – 5193
    Beta strandi523 – 5286
    Beta strandi533 – 5375
    Beta strandi540 – 5434
    Helixi666 – 67510
    Beta strandi676 – 6805
    Beta strandi687 – 6893
    Beta strandi691 – 6999
    Beta strandi706 – 71510
    Helixi719 – 7213
    Beta strandi724 – 7285
    Beta strandi735 – 7384
    Beta strandi746 – 75510
    Beta strandi766 – 7694
    Beta strandi780 – 7867
    Beta strandi794 – 7996
    Helixi803 – 8053
    Beta strandi812 – 82110
    Beta strandi825 – 8317
    Beta strandi836 – 8394
    Beta strandi848 – 8569
    Beta strandi867 – 8693
    Helixi880 – 8834

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2EO9NMR-A454-564[»]
    2V9QX-ray2.50A61-266[»]
    2V9RX-ray2.00A61-266[»]
    2V9TX-ray1.70A61-166[»]
    4HLJX-ray1.80A660-897[»]
    ProteinModelPortaliQ9Y6N7.
    SMRiQ9Y6N7. Positions 61-266, 454-564.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ9Y6N7.

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini26 – 897872ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini919 – 1651733CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei898 – 91821HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini68 – 16497Ig-like C2-type 1Add
    BLAST
    Domaini170 – 25788Ig-like C2-type 2Add
    BLAST
    Domaini262 – 34685Ig-like C2-type 3Add
    BLAST
    Domaini351 – 44696Ig-like C2-type 4Add
    BLAST
    Domaini455 – 54187Ig-like C2-type 5Add
    BLAST
    Domaini563 – 65795Fibronectin type-III 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini676 – 77398Fibronectin type-III 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini778 – 87497Fibronectin type-III 3PROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Belongs to the immunoglobulin superfamily. ROBO family.Curated
    Contains 3 fibronectin type-III domains.PROSITE-ProRule annotation

    Keywords - Domaini

    Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG238978.
    HOGENOMiHOG000010267.
    HOVERGENiHBG073476.
    InParanoidiQ9Y6N7.
    KOiK06753.
    OMAiEDTQNGM.
    OrthoDBiEOG7KWSGP.
    PhylomeDBiQ9Y6N7.
    TreeFamiTF351053.

    Family and domain databases

    Gene3Di2.60.40.10. 9 hits.
    InterProiIPR003961. Fibronectin_type3.
    IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR013098. Ig_I-set.
    IPR003598. Ig_sub2.
    IPR003596. Ig_V-set_subgr.
    [Graphical view]
    PfamiPF00041. fn3. 3 hits.
    PF07679. I-set. 5 hits.
    [Graphical view]
    SMARTiSM00060. FN3. 3 hits.
    SM00408. IGc2. 4 hits.
    SM00406. IGv. 1 hit.
    [Graphical view]
    SUPFAMiSSF49265. SSF49265. 2 hits.
    PROSITEiPS50853. FN3. 3 hits.
    PS50835. IG_LIKE. 5 hits.
    [Graphical view]

    Sequences (6)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 6 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9Y6N7-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MKWKHVPFLV MISLLSLSPN HLFLAQLIPD PEDVERGNDH GTPIPTSDND     50
    DNSLGYTGSR LRQEDFPPRI VEHPSDLIVS KGEPATLNCK AEGRPTPTIE 100
    WYKGGERVET DKDDPRSHRM LLPSGSLFFL RIVHGRKSRP DEGVYVCVAR 150
    NYLGEAVSHN ASLEVAILRD DFRQNPSDVM VAVGEPAVME CQPPRGHPEP 200
    TISWKKDGSP LDDKDERITI RGGKLMITYT RKSDAGKYVC VGTNMVGERE 250
    SEVAELTVLE RPSFVKRPSN LAVTVDDSAE FKCEARGDPV PTVRWRKDDG 300
    ELPKSRYEIR DDHTLKIRKV TAGDMGSYTC VAENMVGKAE ASATLTVQEP 350
    PHFVVKPRDQ VVALGRTVTF QCEATGNPQP AIFWRREGSQ NLLFSYQPPQ 400
    SSSRFSVSQT GDLTITNVQR SDVGYYICQT LNVAGSIITK AYLEVTDVIA 450
    DRPPPVIRQG PVNQTVAVDG TFVLSCVATG SPVPTILWRK DGVLVSTQDS 500
    RIKQLENGVL QIRYAKLGDT GRYTCIASTP SGEATWSAYI EVQEFGVPVQ 550
    PPRPTDPNLI PSAPSKPEVT DVSRNTVTLS WQPNLNSGAT PTSYIIEAFS 600
    HASGSSWQTV AENVKTETSA IKGLKPNAIY LFLVRAANAY GISDPSQISD 650
    PVKTQDVLPT SQGVDHKQVQ RELGNAVLHL HNPTVLSSSS IEVHWTVDQQ 700
    SQYIQGYKIL YRPSGANHGE SDWLVFEVRT PAKNSVVIPD LRKGVNYEIK 750
    ARPFFNEFQG ADSEIKFAKT LEEAPSAPPQ GVTVSKNDGN GTAILVSWQP 800
    PPEDTQNGMV QEYKVWCLGN ETRYHINKTV DGSTFSVVIP FLVPGIRYSV 850
    EVAASTGAGS GVKSEPQFIQ LDAHGNPVSP EDQVSLAQQI SDVVKQPAFI 900
    AGIGAACWII LMVFSIWLYR HRKKRNGLTS TYAGIRKVPS FTFTPTVTYQ 950
    RGGEAVSSGG RPGLLNISEP AAQPWLADTW PNTGNNHNDC SISCCTAGNG 1000
    NSDSNLTTYS RPADCIANYN NQLDNKQTNL MLPESTVYGD VDLSNKINEM 1050
    KTFNSPNLKD GRFVNPSGQP TPYATTQLIQ SNLSNNMNNG SGDSGEKHWK 1100
    PLGQQKQEVA PVQYNIVEQN KLNKDYRAND TVPPTIPYNQ SYDQNTGGSY 1150
    NSSDRGSSTS GSQGHKKGAR TPKVPKQGGM NWADLLPPPP AHPPPHSNSE 1200
    EYNISVDESY DQEMPCPVPP ARMYLQQDEL EEEEDERGPT PPVRGAASSP 1250
    AAVSYSHQST ATLTPSPQEE LQPMLQDCPE ETGHMQHQPD RRRQPVSPPP 1300
    PPRPISPPHT YGYISGPLVS DMDTDAPEEE EDEADMEVAK MQTRRLLLRG 1350
    LEQTPASSVG DLESSVTGSM INGWGSASEE DNISSGRSSV SSSDGSFFTD 1400
    ADFAQAVAAA AEYAGLKVAR RQMQDAAGRR HFHASQCPRP TSPVSTDSNM 1450
    SAAVMQKTRP AKKLKHQPGH LRRETYTDDL PPPPVPPPAI KSPTAQSKTQ 1500
    LEVRPVVVPK LPSMDARTDR SSDRKGSSYK GREVLDGRQV VDMRTNPGDP 1550
    REAQEQQNDG KGRGNKAAKR DLPPAKTHLI QEDILPYCRP TFPTSNNPRD 1600
    PSSSSSMSSR GSGSRQREQA NVGRRNIAEM QVLGGYERGE DNNEELEETE 1650
    S 1651
    Length:1,651
    Mass (Da):180,930
    Last modified:November 1, 1999 - v1
    Checksum:i9D98CD7CAB73074D
    GO
    Isoform 2 (identifier: Q9Y6N7-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         543-543: Q → QGKVN

    Note: Incomplete.

    Show »
    Length:1,655
    Mass (Da):181,328
    Checksum:iEB2C3DFF6013A30F
    GO
    Isoform 3 (identifier: Q9Y6N7-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-39: Missing.
         40-57: HGTPIPTSDNDDNSLGYT → MIAEPAHFYLFGLICLCS
         348-348: Q → QVGS

    Show »
    Length:1,615
    Mass (Da):176,814
    Checksum:i66D6413527161E25
    GO
    Isoform 4 (identifier: Q9Y6N7-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-39: Missing.
         40-57: HGTPIPTSDNDDNSLGYT → MIAEPAHFYLFGLICLCS

    Show »
    Length:1,612
    Mass (Da):176,571
    Checksum:i4625E96485E88C34
    GO
    Isoform 5 (identifier: Q9Y6N7-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-57: MKWKHVPFLVMISLLSLSPNHLFLAQLIPDPEDVERGNDHGTPIPTSDNDDNSLGYT → MIAEPAHFYLFGLICLCS
         348-348: Q → QVGS
         938-946: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:1,606
    Mass (Da):175,836
    Checksum:i79FA0AA96275B1A2
    GO
    Isoform 6 (identifier: Q9Y6N7-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-57: MKWKHVPFLVMISLLSLSPNHLFLAQLIPDPEDVERGNDHGTPIPTSDNDDNSLGYT → MIAEPAHFYLFGLICLCS
         348-348: Q → QVGS
         938-946: Missing.
         1013-1067: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:1,551
    Mass (Da):169,661
    Checksum:i89F1C62C15B8C9A2
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti182 – 1821A → V in AAI15023. (PubMed:15489334)Curated
    Sequence conflicti835 – 8351F → L in AAI15023. (PubMed:15489334)Curated
    Sequence conflicti1095 – 10951G → S in CAD98093. (PubMed:17974005)Curated
    Sequence conflicti1223 – 12231M → T in Z95705. (PubMed:16641997)Curated
    Sequence conflicti1443 – 14431P → L in CAD98093. (PubMed:17974005)Curated
    Sequence conflicti1536 – 15361D → G in Z95705. (PubMed:16641997)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti336 – 3361V → A.
    Corresponds to variant rs9647397 [ dbSNP | Ensembl ].
    VAR_053640
    Natural varianti1055 – 10551S → N in a breast cancer sample. 1 Publication
    VAR_019071
    Natural varianti1091 – 10911S → N.
    Corresponds to variant rs35456279 [ dbSNP | Ensembl ].
    VAR_053641
    Natural varianti1533 – 15331E → D in a breast cancer sample. 1 Publication
    Corresponds to variant rs36055689 [ dbSNP | Ensembl ].
    VAR_019072

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 5757MKWKH…SLGYT → MIAEPAHFYLFGLICLCS in isoform 5 and isoform 6. 1 PublicationVSP_043881Add
    BLAST
    Alternative sequencei1 – 3939Missing in isoform 3 and isoform 4. CuratedVSP_010643Add
    BLAST
    Alternative sequencei40 – 5718HGTPI…SLGYT → MIAEPAHFYLFGLICLCS in isoform 3 and isoform 4. CuratedVSP_010644Add
    BLAST
    Alternative sequencei348 – 3481Q → QVGS in isoform 3, isoform 5 and isoform 6. 1 PublicationVSP_010645
    Alternative sequencei543 – 5431Q → QGKVN in isoform 2. 1 PublicationVSP_010646
    Alternative sequencei938 – 9469Missing in isoform 5 and isoform 6. 1 PublicationVSP_043882
    Alternative sequencei1013 – 106755Missing in isoform 6. 1 PublicationVSP_046084Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF040990 mRNA. Translation: AAC39575.1.
    Z95705 Genomic DNA. No translation available.
    AC016946 Genomic DNA. No translation available.
    AC055731 Genomic DNA. No translation available.
    AC106718 Genomic DNA. No translation available.
    AC106720 Genomic DNA. No translation available.
    AC108719 Genomic DNA. No translation available.
    AC117461 Genomic DNA. No translation available.
    AC117479 Genomic DNA. No translation available.
    AC119035 Genomic DNA. No translation available.
    AC123565 Genomic DNA. No translation available.
    AC125624 Genomic DNA. No translation available.
    AC125766 Genomic DNA. No translation available.
    AC125815 Genomic DNA. No translation available.
    AC131008 Genomic DNA. No translation available.
    CH471110 Genomic DNA. Translation: EAW68884.1.
    CH471110 Genomic DNA. Translation: EAW68885.1.
    BC001969 mRNA. Translation: AAH01969.1.
    BC115022 mRNA. Translation: AAI15023.1.
    BC157861 mRNA. Translation: AAI57862.1.
    BC171855 mRNA. Translation: AAI71855.1.
    BX538319 mRNA. Translation: CAD98093.1.
    CCDSiCCDS46872.2. [Q9Y6N7-5]
    CCDS54610.1. [Q9Y6N7-6]
    CCDS54611.1. [Q9Y6N7-1]
    RefSeqiNP_001139317.1. NM_001145845.1. [Q9Y6N7-6]
    NP_002932.1. NM_002941.3. [Q9Y6N7-1]
    NP_598334.2. NM_133631.3. [Q9Y6N7-5]
    XP_006713340.1. XM_006713277.1. [Q9Y6N7-3]
    UniGeneiHs.744218.

    Genome annotation databases

    EnsembliENST00000436010; ENSP00000406043; ENSG00000169855. [Q9Y6N7-4]
    ENST00000464233; ENSP00000420321; ENSG00000169855. [Q9Y6N7-1]
    ENST00000467549; ENSP00000417992; ENSG00000169855. [Q9Y6N7-6]
    ENST00000495273; ENSP00000420637; ENSG00000169855. [Q9Y6N7-5]
    GeneIDi6091.
    KEGGihsa:6091.
    UCSCiuc003dqb.2. human. [Q9Y6N7-4]
    uc003dqd.2. human. [Q9Y6N7-5]
    uc003dqe.2. human. [Q9Y6N7-1]

    Polymorphism databases

    DMDMi49036500.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    Atlas of Genetics and Cytogenetics in Oncology and Haematology

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF040990 mRNA. Translation: AAC39575.1 .
    Z95705 Genomic DNA. No translation available.
    AC016946 Genomic DNA. No translation available.
    AC055731 Genomic DNA. No translation available.
    AC106718 Genomic DNA. No translation available.
    AC106720 Genomic DNA. No translation available.
    AC108719 Genomic DNA. No translation available.
    AC117461 Genomic DNA. No translation available.
    AC117479 Genomic DNA. No translation available.
    AC119035 Genomic DNA. No translation available.
    AC123565 Genomic DNA. No translation available.
    AC125624 Genomic DNA. No translation available.
    AC125766 Genomic DNA. No translation available.
    AC125815 Genomic DNA. No translation available.
    AC131008 Genomic DNA. No translation available.
    CH471110 Genomic DNA. Translation: EAW68884.1 .
    CH471110 Genomic DNA. Translation: EAW68885.1 .
    BC001969 mRNA. Translation: AAH01969.1 .
    BC115022 mRNA. Translation: AAI15023.1 .
    BC157861 mRNA. Translation: AAI57862.1 .
    BC171855 mRNA. Translation: AAI71855.1 .
    BX538319 mRNA. Translation: CAD98093.1 .
    CCDSi CCDS46872.2. [Q9Y6N7-5 ]
    CCDS54610.1. [Q9Y6N7-6 ]
    CCDS54611.1. [Q9Y6N7-1 ]
    RefSeqi NP_001139317.1. NM_001145845.1. [Q9Y6N7-6 ]
    NP_002932.1. NM_002941.3. [Q9Y6N7-1 ]
    NP_598334.2. NM_133631.3. [Q9Y6N7-5 ]
    XP_006713340.1. XM_006713277.1. [Q9Y6N7-3 ]
    UniGenei Hs.744218.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2EO9 NMR - A 454-564 [» ]
    2V9Q X-ray 2.50 A 61-266 [» ]
    2V9R X-ray 2.00 A 61-266 [» ]
    2V9T X-ray 1.70 A 61-166 [» ]
    4HLJ X-ray 1.80 A 660-897 [» ]
    ProteinModelPortali Q9Y6N7.
    SMRi Q9Y6N7. Positions 61-266, 454-564.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 112018. 5 interactions.
    DIPi DIP-33034N.
    IntActi Q9Y6N7. 4 interactions.
    MINTi MINT-1392694.
    STRINGi 9606.ENSP00000381450.

    PTM databases

    PhosphoSitei Q9Y6N7.

    Polymorphism databases

    DMDMi 49036500.

    Proteomic databases

    MaxQBi Q9Y6N7.
    PaxDbi Q9Y6N7.
    PRIDEi Q9Y6N7.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000436010 ; ENSP00000406043 ; ENSG00000169855 . [Q9Y6N7-4 ]
    ENST00000464233 ; ENSP00000420321 ; ENSG00000169855 . [Q9Y6N7-1 ]
    ENST00000467549 ; ENSP00000417992 ; ENSG00000169855 . [Q9Y6N7-6 ]
    ENST00000495273 ; ENSP00000420637 ; ENSG00000169855 . [Q9Y6N7-5 ]
    GeneIDi 6091.
    KEGGi hsa:6091.
    UCSCi uc003dqb.2. human. [Q9Y6N7-4 ]
    uc003dqd.2. human. [Q9Y6N7-5 ]
    uc003dqe.2. human. [Q9Y6N7-1 ]

    Organism-specific databases

    CTDi 6091.
    GeneCardsi GC03M078729.
    HGNCi HGNC:10249. ROBO1.
    HPAi CAB013524.
    MIMi 602430. gene.
    neXtProti NX_Q9Y6N7.
    PharmGKBi PA34620.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG238978.
    HOGENOMi HOG000010267.
    HOVERGENi HBG073476.
    InParanoidi Q9Y6N7.
    KOi K06753.
    OMAi EDTQNGM.
    OrthoDBi EOG7KWSGP.
    PhylomeDBi Q9Y6N7.
    TreeFami TF351053.

    Enzyme and pathway databases

    Reactomei REACT_19226. Activation of Rac.
    REACT_19230. Role of Abl in Robo-Slit signaling.
    REACT_19342. Inactivation of Cdc42 and Rac.
    REACT_19351. Signaling by Robo receptor.
    REACT_19376. Regulation of Commissural axon pathfinding by Slit and Robo.
    REACT_22237. Netrin-1 signaling.

    Miscellaneous databases

    ChiTaRSi ROBO1. human.
    EvolutionaryTracei Q9Y6N7.
    GeneWikii ROBO1.
    GenomeRNAii 6091.
    NextBioi 23685.
    PROi Q9Y6N7.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9Y6N7.
    Bgeei Q9Y6N7.
    CleanExi HS_ROBO1.
    Genevestigatori Q9Y6N7.

    Family and domain databases

    Gene3Di 2.60.40.10. 9 hits.
    InterProi IPR003961. Fibronectin_type3.
    IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR013098. Ig_I-set.
    IPR003598. Ig_sub2.
    IPR003596. Ig_V-set_subgr.
    [Graphical view ]
    Pfami PF00041. fn3. 3 hits.
    PF07679. I-set. 5 hits.
    [Graphical view ]
    SMARTi SM00060. FN3. 3 hits.
    SM00408. IGc2. 4 hits.
    SM00406. IGv. 1 hit.
    [Graphical view ]
    SUPFAMi SSF49265. SSF49265. 2 hits.
    PROSITEi PS50853. FN3. 3 hits.
    PS50835. IG_LIKE. 5 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Roundabout controls axon crossing of the CNS midline and defines a novel subfamily of evolutionarily conserved guidance receptors."
      Kidd T., Brose K., Mitchell K.J., Fetter R.D., Tessier-Lavigne M., Goodman C.S., Tear G.
      Cell 92:205-215(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    2. "The DNA sequence, annotation and analysis of human chromosome 3."
      Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J.
      , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
      Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 5 AND 6), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1158-1651 (ISOFORMS 1/2/3/4).
      Tissue: Placenta.
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 366-1651 (ISOFORM 2).
      Tissue: Uterine endothelium.
    6. "Slit proteins bind Robo receptors and have an evolutionarily conserved role in repulsive axon guidance."
      Brose K., Bland K.S., Wang K.H., Arnott D., Henzel W., Goodman C.S., Tessier-Lavigne M., Kidd T.
      Cell 96:795-806(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH SLIT2.
      Tissue: Fetal brain.
    7. "The DUTT1 gene, a novel NCAM family member is expressed in developing murine neural tissues and has an unusually broad pattern of expression."
      Sundaresan V., Roberts I., Bateman A., Bankier A., Sheppard M., Hobbs C., Xiong J., Minna J., Latif F., Lerman M., Rabbitts P.
      Mol. Cell. Neurosci. 11:29-35(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY.
    8. Cited for: MAPPING, IDENTIFICATION (ISOFORM 3).
    9. "Repulsive axon guidance: Abelson and Enabled play opposing roles downstream of the roundabout receptor."
      Bashaw G.J., Kidd T., Murray D., Pawson T., Goodman C.S.
      Cell 101:703-715(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION AT TYR-1038; TYR-1073 AND TYR-1114.
    10. "Diversity and specificity of actions of Slit2 proteolytic fragments in axon guidance."
      Nguyen-Ba-Charvet K.T., Brose K., Ma L., Wang K.H., Marillat V., Sotelo C., Tessier-Lavigne M., Chedotal A.
      J. Neurosci. 21:4281-4289(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH SLIT2.
    11. "Tumour specific promoter region methylation of the human homologue of the Drosophila Roundabout gene DUTT1 (ROBO1) in human cancers."
      Dallol A., Forgacs E., Martinez A., Sekido Y., Walker R., Kishida T., Rabbitts P., Maher E.R., Minna J.D., Latif F.
      Oncogene 21:3020-3028(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: PROMOTER HYPERMETHYLATION, VARIANTS ASN-1055 AND ASP-1533.
    12. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
      Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
      Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    13. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-940; SER-1055; THR-1240 AND SER-1297, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    14. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-940, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    15. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    16. Cited for: X-RAY CRYSTALLOGRAPHY (1.7 ANGSTROMS) OF 61-166 IN COMPLEX WITH SLIT2, DISULFIDE BOND.
    17. "Solution structure of the fifth Ig-like domain from human roundabout homolog 1."
      RIKEN structural genomics initiative (RSGI)
      Submitted (OCT-2007) to the PDB data bank
      Cited for: STRUCTURE BY NMR OF 454-564.

    Entry informationi

    Entry nameiROBO1_HUMAN
    AccessioniPrimary (citable) accession number: Q9Y6N7
    Secondary accession number(s): B2RXI1
    , D3DU36, E9PD49, Q1RMC7, Q7Z300, Q9BUS7
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: June 21, 2004
    Last sequence update: November 1, 1999
    Last modified: October 1, 2014
    This is version 129 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Miscellaneous

    Maps within a region of overlapping homozygous deletions characterized in both small cell lung cancer cell lines (SCLC) and in a breast cancer cell line. The promoter region of ROBO1 shows complete hypermethylation of CpG sites in the BT-20 breast tumor cell lines, some primary invasive breast carcinomasa and some primary clear cell renal cell carcinomas (CC-RCC).

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 3
      Human chromosome 3: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3