Q9Y6N7 (ROBO1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 114.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Roundabout homolog 1 Alternative name(s): Deleted in U twenty twenty H-Robo-1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1651 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Receptor for SLIT1 and SLIT2 which are thought to act as molecular guidance cue in cellular migration, including axonal navigation at the ventral midline of the neural tube and projection of axons to different regions during neuronal development. In axon growth cones, the silencing of the attractive effect of NTN1 by SLIT2 may require the formation of a ROBO1-DCC complex. May be required for lung development. Ref.6 |
| Subunit structure | |
| Subcellular location | Membrane; Single-pass type I membrane protein Potential. |
| Tissue specificity | Widely expressed, with exception of kidney. Ref.7 |
| Post-translational modification | Ubiquitinated. May be deubiquitinated by USP33 By similarity. |
| Miscellaneous | Maps within a region of overlapping homozygous deletions characterized in both small cell lung cancer cell lines (SCLC) and in a breast cancer cell line. The promoter region of ROBO1 shows complete hypermethylation of CpG sites in the BT-20 breast tumor cell lines, some primary invasive breast carcinomasa and some primary clear cell renal cell carcinomas (CC-RCC). |
| Sequence similarities | Belongs to the immunoglobulin superfamily. ROBO family. Contains 3 fibronectin type-III domains. Contains 5 Ig-like C2-type (immunoglobulin-like) domains. |
Ontologies
Alternative products
| This entry describes 6 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9Y6N7-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9Y6N7-2) The sequence of this isoform differs from the canonical sequence as follows: 543-543: Q → QGKVN | ||||||
| Note: Incomplete. | ||||||
| Isoform 3 (identifier: Q9Y6N7-3) The sequence of this isoform differs from the canonical sequence as follows: 1-39: Missing. 40-57: HGTPIPTSDNDDNSLGYT → MIAEPAHFYLFGLICLCS 348-348: Q → QVGS | ||||||
| Isoform 4 (identifier: Q9Y6N7-4) The sequence of this isoform differs from the canonical sequence as follows: 1-39: Missing. 40-57: HGTPIPTSDNDDNSLGYT → MIAEPAHFYLFGLICLCS | ||||||
| Isoform 5 (identifier: Q9Y6N7-5) The sequence of this isoform differs from the canonical sequence as follows: 1-57: MKWKHVPFLVMISLLSLSPNHLFLAQLIPDPEDVERGNDHGTPIPTSDNDDNSLGYT → MIAEPAHFYLFGLICLCS 348-348: Q → QVGS 938-946: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 6 (identifier: Q9Y6N7-6) The sequence of this isoform differs from the canonical sequence as follows: 1-57: MKWKHVPFLVMISLLSLSPNHLFLAQLIPDPEDVERGNDHGTPIPTSDNDDNSLGYT → MIAEPAHFYLFGLICLCS 348-348: Q → QVGS 938-946: Missing. 1013-1067: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 25 | 25 | Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Chain | 26 – 1651 | 1626 | Roundabout homolog 1 | PRO_0000031033 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Topological domain | 26 – 897 | 872 | Extracellular Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Transmembrane | 898 – 918 | 21 | Helical; Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Topological domain | 919 – 1651 | 733 | Cytoplasmic Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 68 – 164 | 97 | Ig-like C2-type 1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 170 – 257 | 88 | Ig-like C2-type 2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 262 – 346 | 85 | Ig-like C2-type 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 351 – 446 | 96 | Ig-like C2-type 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 455 – 541 | 87 | Ig-like C2-type 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 561 – 646 | 86 | Fibronectin type-III 1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 673 – 763 | 91 | Fibronectin type-III 2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 775 – 864 | 90 | Fibronectin type-III 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 940 | 1 | Phosphoserine Ref.13 Ref.14 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1038 | 1 | Phosphotyrosine; by ABL; in vitro Ref.9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1055 | 1 | Phosphoserine Ref.13 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1073 | 1 | Phosphotyrosine; by ABL; in vitro Ref.9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1114 | 1 | Phosphotyrosine; by ABL; in vitro Ref.9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1240 | 1 | Phosphothreonine Ref.13 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1297 | 1 | Phosphoserine Ref.13 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 160 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 463 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 790 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 820 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 827 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 89 ↔ 147 | Ref.16 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 191 ↔ 240 | Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 283 ↔ 330 | Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 372 ↔ 428 | Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 476 ↔ 525 | Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 57 | 57 | MKWKH…SLGYT → MIAEPAHFYLFGLICLCS in isoform 5 and isoform 6. | VSP_043881 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 39 | 39 | Missing in isoform 3 and isoform 4. | VSP_010643 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 40 – 57 | 18 | HGTPI…SLGYT → MIAEPAHFYLFGLICLCS in isoform 3 and isoform 4. | VSP_010644 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 348 | 1 | Q → QVGS in isoform 3, isoform 5 and isoform 6. | VSP_010645 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 543 | 1 | Q → QGKVN in isoform 2. | VSP_010646 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 938 – 946 | 9 | Missing in isoform 5 and isoform 6. | VSP_043882 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1013 – 1067 | 55 | Missing in isoform 6. | VSP_046084 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 336 | 1 | V → A. Corresponds to variant rs9647397 [ dbSNP | Ensembl ]. | VAR_053640 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1055 | 1 | S → N in a breast cancer sample. Ref.11 | VAR_019071 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1091 | 1 | S → N. Corresponds to variant rs35456279 [ dbSNP | Ensembl ]. | VAR_053641 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1533 | 1 | E → D in a breast cancer sample. Ref.11 Corresponds to variant rs36055689 [ dbSNP | Ensembl ]. | VAR_019072 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 182 | 1 | A → V in AAI15023. Ref.4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 835 | 1 | F → L in AAI15023. Ref.4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1095 | 1 | G → S in CAD98093. Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1223 | 1 | M → T in Z95705. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1443 | 1 | P → L in CAD98093. Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1536 | 1 | D → G in Z95705. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 66 – 72 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 77 – 79 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 85 – 87 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 90 – 95 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 98 – 103 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 111 – 113 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 118 – 121 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 127 – 131 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 143 – 151 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 154 – 157 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 161 – 165 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 179 – 182 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 187 – 190 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 196 – 198 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 201 – 206 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 209 – 211 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 213 – 215 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 218 – 221 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 224 – 229 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 232 – 234 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 236 – 244 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 247 – 250 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 254 – 259 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 261 – 266 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 464 – 467 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 471 – 475 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 485 – 494 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 502 – 506 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 509 – 514 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 517 – 519 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 523 – 528 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 533 – 537 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 540 – 543 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Roundabout controls axon crossing of the CNS midline and defines a novel subfamily of evolutionarily conserved guidance receptors." Kidd T., Brose K., Mitchell K.J., Fetter R.D., Tessier-Lavigne M., Goodman C.S., Tear G. Cell 92:205-215(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "The DNA sequence, annotation and analysis of human chromosome 3." Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J. Gibbs R.A.Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 5 AND 6), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1158-1651 (ISOFORMS 1/2/3/4). Tissue: Placenta. |
| [5] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 366-1651 (ISOFORM 2). Tissue: Uterine endothelium. |
| [6] | "Slit proteins bind Robo receptors and have an evolutionarily conserved role in repulsive axon guidance." Brose K., Bland K.S., Wang K.H., Arnott D., Henzel W., Goodman C.S., Tessier-Lavigne M., Kidd T. Cell 96:795-806(1999) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH SLIT2. Tissue: Fetal brain. |
| [7] | "The DUTT1 gene, a novel NCAM family member is expressed in developing murine neural tissues and has an unusually broad pattern of expression." Sundaresan V., Roberts I., Bateman A., Bankier A., Sheppard M., Hobbs C., Xiong J., Minna J., Latif F., Lerman M., Rabbitts P. Mol. Cell. Neurosci. 11:29-35(1998) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY. |
| [8] | "Homozygous deletions at 3p12 in breast and lung cancer." Sundaresan V., Chung G., Heppell-Parton A., Xiong J., Grundy C., Roberts I., James L., Cahn A., Bench A., Douglas J., Minna J., Sekido Y., Lerman M., Latif F., Bergh J., Li H., Lowe N., Ogilvie D., Rabbitts P. Oncogene 17:1723-1729(1998) [PubMed] [Europe PMC] [Abstract] Cited for: MAPPING, IDENTIFICATION (ISOFORM 3). |
| [9] | "Repulsive axon guidance: Abelson and Enabled play opposing roles downstream of the roundabout receptor." Bashaw G.J., Kidd T., Murray D., Pawson T., Goodman C.S. Cell 101:703-715(2000) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT TYR-1038; TYR-1073 AND TYR-1114. |
| [10] | "Diversity and specificity of actions of Slit2 proteolytic fragments in axon guidance." Nguyen-Ba-Charvet K.T., Brose K., Ma L., Wang K.H., Marillat V., Sotelo C., Tessier-Lavigne M., Chedotal A. J. Neurosci. 21:4281-4289(2001) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH SLIT2. |
| [11] | "Tumour specific promoter region methylation of the human homologue of the Drosophila Roundabout gene DUTT1 (ROBO1) in human cancers." Dallol A., Forgacs E., Martinez A., Sekido Y., Walker R., Kishida T., Rabbitts P., Maher E.R., Minna J.D., Latif F. Oncogene 21:3020-3028(2002) [PubMed] [Europe PMC] [Abstract] Cited for: PROMOTER HYPERMETHYLATION, VARIANTS ASN-1055 AND ASP-1533. |
| [12] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [13] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-940; SER-1055; THR-1240 AND SER-1297, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [14] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-940, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [15] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [16] | "Structural insights into the Slit-Robo complex." Morlot C., Thielens N.M., Ravelli R.B., Hemrika W., Romijn R.A., Gros P., Cusack S., McCarthy A.A. Proc. Natl. Acad. Sci. U.S.A. 104:14923-14928(2007) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.7 ANGSTROMS) OF 61-166 IN COMPLEX WITH SLIT2, DISULFIDE BOND. |
| [17] | "Solution structure of the fifth Ig-like domain from human roundabout homolog 1." RIKEN structural genomics initiative (RSGI) Submitted (OCT-2007) to the PDB data bank Cited for: STRUCTURE BY NMR OF 454-564. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF040990 mRNA. Translation: AAC39575.1. Z95705 Genomic DNA. No translation available. AC016946 Genomic DNA. No translation available. AC055731 Genomic DNA. No translation available. AC106718 Genomic DNA. No translation available. AC106720 Genomic DNA. No translation available. AC108719 Genomic DNA. No translation available. AC117461 Genomic DNA. No translation available. AC117479 Genomic DNA. No translation available. AC119035 Genomic DNA. No translation available. AC123565 Genomic DNA. No translation available. AC125624 Genomic DNA. No translation available. AC125766 Genomic DNA. No translation available. AC125815 Genomic DNA. No translation available. AC131008 Genomic DNA. No translation available. CH471110 Genomic DNA. Translation: EAW68884.1. CH471110 Genomic DNA. Translation: EAW68885.1. BC001969 mRNA. Translation: AAH01969.1. BC115022 mRNA. Translation: AAI15023.1. BC157861 mRNA. Translation: AAI57862.1. BC171855 mRNA. Translation: AAI71855.1. BX538319 mRNA. Translation: CAD98093.1. | ||||||||||||||||||||||||||||||
| IPI | IPI00219798. IPI00418121. IPI00418122. IPI00829739. IPI00946477. IPI00980964. | ||||||||||||||||||||||||||||||
| RefSeq | NP_001139317.1. NM_001145845.1. NP_002932.1. NM_002941.3. NP_598334.2. NM_133631.3. | ||||||||||||||||||||||||||||||
| UniGene | Hs.13640. | ||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||
| ProteinModelPortal | Q9Y6N7. | ||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||
| DIP | DIP-33034N. | ||||||||||||||||||||||||||||||
| IntAct | Q9Y6N7. 2 interactions. | ||||||||||||||||||||||||||||||
| MINT | MINT-1392694. | ||||||||||||||||||||||||||||||
| STRING | 9606.ENSP00000381450. | ||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||
| PhosphoSite | Q9Y6N7. | ||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||
| DMDM | 49036500. | ||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||
| PaxDb | Q9Y6N7. | ||||||||||||||||||||||||||||||
| PRIDE | Q9Y6N7. | ||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||
| Ensembl | ENST00000436010; ENSP00000406043; ENSG00000169855. ENST00000464233; ENSP00000420321; ENSG00000169855. ENST00000467549; ENSP00000417992; ENSG00000169855. ENST00000495273; ENSP00000420637; ENSG00000169855. | ||||||||||||||||||||||||||||||
| GeneID | 6091. | ||||||||||||||||||||||||||||||
| KEGG | hsa:6091. | ||||||||||||||||||||||||||||||
| UCSC | uc003dqb.2. human. uc003dqe.2. human. | ||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||
| CTD | 6091. | ||||||||||||||||||||||||||||||
| GeneCards | GC03M078729. | ||||||||||||||||||||||||||||||
| HGNC | HGNC:10249. ROBO1. | ||||||||||||||||||||||||||||||
| HPA | CAB013524. | ||||||||||||||||||||||||||||||
| MIM | 602430. gene. | ||||||||||||||||||||||||||||||
| neXtProt | NX_Q9Y6N7. | ||||||||||||||||||||||||||||||
| PharmGKB | PA34620. | ||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||
| eggNOG | NOG238978. | ||||||||||||||||||||||||||||||
| HOGENOM | HOG000010267. | ||||||||||||||||||||||||||||||
| HOVERGEN | HBG073476. | ||||||||||||||||||||||||||||||
| InParanoid | Q9Y6N7. | ||||||||||||||||||||||||||||||
| KO | K06753. | ||||||||||||||||||||||||||||||
| OrthoDB | EOG44QT01. | ||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||
| Reactome | REACT_111045. Developmental Biology. | ||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||
| ArrayExpress | Q9Y6N7. | ||||||||||||||||||||||||||||||
| Bgee | Q9Y6N7. | ||||||||||||||||||||||||||||||
| CleanEx | HS_ROBO1. | ||||||||||||||||||||||||||||||
| Genevestigator | Q9Y6N7. | ||||||||||||||||||||||||||||||
| GermOnline | ENSG00000169855. Homo sapiens. | ||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||
| Gene3D | 2.60.40.10. 9 hits. | ||||||||||||||||||||||||||||||
| InterPro | IPR003961. Fibronectin_type3. IPR007110. Ig-like_dom. IPR013783. Ig-like_fold. IPR013098. Ig_I-set. IPR003598. Ig_sub2. IPR003596. Ig_V-set_subgr. [Graphical view] | ||||||||||||||||||||||||||||||
| Pfam | PF00041. fn3. 3 hits. PF07679. I-set. 5 hits. [Graphical view] | ||||||||||||||||||||||||||||||
| SMART | SM00060. FN3. 3 hits. SM00408. IGc2. 4 hits. SM00406. IGv. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||
| SUPFAM | SSF49265. FN_III-like. 3 hits. | ||||||||||||||||||||||||||||||
| PROSITE | PS50853. FN3. 3 hits. PS50835. IG_LIKE. 5 hits. [Graphical view] | ||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||
| ChiTaRS | ROBO1. human. | ||||||||||||||||||||||||||||||
| EvolutionaryTrace | Q9Y6N7. | ||||||||||||||||||||||||||||||
| GenomeRNAi | 6091. | ||||||||||||||||||||||||||||||
| NextBio | 23685. | ||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||
Entry information
| Entry name | ROBO1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9Y6N7 Secondary accession number(s): B2RXI1 Q9BUS7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
