Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Roundabout homolog 1

Gene

ROBO1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Receptor for SLIT1 and SLIT2 that mediates cellular responses to molecular guidance cues in cellular migration, including axonal navigation at the ventral midline of the neural tube and projection of axons to different regions during neuronal development (PubMed:10102268, PubMed:24560577). Interaction with the intracellular domain of FLRT3 mediates axon attraction towards cells expressing NTN1 (PubMed:24560577). In axon growth cones, the silencing of the attractive effect of NTN1 by SLIT2 may require the formation of a ROBO1-DCC complex (By similarity). Plays a role in the regulation of cell migration via its interaction with MYO9B; inhibits MYO9B-mediated stimulation of RHOA GTPase activity, and thereby leads to increased levels of active, GTP-bound RHOA (PubMed:26529257). May be required for lung development (By similarity).By similarityCurated3 Publications

GO - Molecular functioni

  • axon guidance receptor activity Source: ProtInc
  • identical protein binding Source: UniProtKB
  • LRR domain binding Source: UniProtKB

GO - Biological processi

  • activation of cysteine-type endopeptidase activity involved in apoptotic process Source: UniProtKB
  • axon guidance Source: Reactome
  • axon midline choice point recognition Source: UniProtKB
  • cell adhesion Source: ProtInc
  • cell migration involved in sprouting angiogenesis Source: BHF-UCL
  • chemorepulsion involved in postnatal olfactory bulb interneuron migration Source: UniProtKB
  • heart development Source: InterPro
  • homophilic cell adhesion via plasma membrane adhesion molecules Source: UniProtKB
  • negative regulation of cell migration Source: UniProtKB
  • negative regulation of chemokine-mediated signaling pathway Source: BHF-UCL
  • negative regulation of mammary gland epithelial cell proliferation Source: BHF-UCL
  • negative regulation of negative chemotaxis Source: UniProtKB
  • nervous system development Source: ProtInc
  • positive regulation of axonogenesis Source: UniProtKB
  • positive regulation of Rho protein signal transduction Source: UniProtKB
  • Roundabout signaling pathway Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein, Receptor

Keywords - Biological processi

Chemotaxis, Differentiation, Neurogenesis

Enzyme and pathway databases

BioCyciZFISH:ENSG00000169855-MONOMER.
ReactomeiR-HSA-373752. Netrin-1 signaling.
R-HSA-376176. Signaling by Robo receptor.
R-HSA-428540. Activation of Rac.
R-HSA-428542. Regulation of Commissural axon pathfinding by Slit and Robo.
R-HSA-428543. Inactivation of Cdc42 and Rac.
R-HSA-428890. Role of Abl in Robo-Slit signaling.
SIGNORiQ9Y6N7.

Names & Taxonomyi

Protein namesi
Recommended name:
Roundabout homolog 1
Alternative name(s):
Deleted in U twenty twenty
H-Robo-1
Gene namesi
Name:ROBO1
Synonyms:DUTT1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

HGNCiHGNC:10249. ROBO1.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini26 – 897ExtracellularSequence analysisAdd BLAST872
Transmembranei898 – 918HelicalSequence analysisAdd BLAST21
Topological domaini919 – 1651CytoplasmicSequence analysisAdd BLAST733

GO - Cellular componenti

  • axon Source: UniProtKB-SubCell
  • cell surface Source: UniProtKB
  • cytoplasm Source: UniProtKB
  • integral component of plasma membrane Source: ProtInc
  • plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cell projection, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi6091.
OpenTargetsiENSG00000169855.
PharmGKBiPA34620.

Polymorphism and mutation databases

BioMutaiROBO1.
DMDMi49036500.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 25Sequence analysisAdd BLAST25
ChainiPRO_000003103326 – 1651Roundabout homolog 1Add BLAST1626

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi89 ↔ 147PROSITE-ProRule annotationCombined sources1 Publication
Glycosylationi160N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi191 ↔ 240PROSITE-ProRule annotationCombined sources1 Publication
Disulfide bondi283 ↔ 330PROSITE-ProRule annotation
Disulfide bondi372 ↔ 428PROSITE-ProRule annotation
Glycosylationi463N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi476 ↔ 525PROSITE-ProRule annotationCombined sources1 Publication
Glycosylationi790N-linked (GlcNAc...)Sequence analysis1
Glycosylationi820N-linked (GlcNAc...)Sequence analysis1
Glycosylationi827N-linked (GlcNAc...)Sequence analysis1
Modified residuei940PhosphoserineCombined sources1
Modified residuei948PhosphothreonineCombined sources1
Modified residuei1038Phosphotyrosine; by ABL; in vitro1 Publication1
Modified residuei1055PhosphoserineCombined sources1
Modified residuei1073Phosphotyrosine; by ABL; in vitro1 Publication1
Modified residuei1114Phosphotyrosine; by ABL; in vitro1 Publication1
Modified residuei1240PhosphothreonineCombined sources1
Modified residuei1297PhosphoserineCombined sources1

Post-translational modificationi

Ubiquitinated. May be deubiquitinated by USP33.By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiQ9Y6N7.
PaxDbiQ9Y6N7.
PeptideAtlasiQ9Y6N7.
PRIDEiQ9Y6N7.

PTM databases

iPTMnetiQ9Y6N7.
PhosphoSitePlusiQ9Y6N7.

Expressioni

Tissue specificityi

Widely expressed, with exception of kidney.1 Publication

Gene expression databases

BgeeiENSG00000169855.
CleanExiHS_ROBO1.
ExpressionAtlasiQ9Y6N7. baseline and differential.
GenevisibleiQ9Y6N7. HS.

Organism-specific databases

HPAiCAB013524.
HPA052968.

Interactioni

Subunit structurei

Homodimer. Dimerization is mediated by the extracellular domain and is independent of SLIT liganding (PubMed:24673457). Interacts with SLIT1 (By similarity). Interacts with SLIT2 (PubMed:10102268, PubMed:11404413, PubMed:17848514). Interacts with FLRT3 (PubMed:24560577). Interacts with MYO9B (via Rho-GAP domain) (PubMed:26529257).By similarity6 Publications

GO - Molecular functioni

  • identical protein binding Source: UniProtKB
  • LRR domain binding Source: UniProtKB

Protein-protein interaction databases

BioGridi112018. 8 interactors.
DIPiDIP-33034N.
IntActiQ9Y6N7. 7 interactors.
MINTiMINT-1392694.
STRINGi9606.ENSP00000420321.

Structurei

Secondary structure

11651
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi66 – 72Combined sources7
Beta strandi77 – 79Combined sources3
Beta strandi85 – 87Combined sources3
Beta strandi90 – 95Combined sources6
Beta strandi98 – 103Combined sources6
Turni111 – 113Combined sources3
Beta strandi118 – 121Combined sources4
Beta strandi127 – 131Combined sources5
Beta strandi143 – 151Combined sources9
Beta strandi154 – 157Combined sources4
Beta strandi161 – 165Combined sources5
Beta strandi179 – 182Combined sources4
Beta strandi187 – 190Combined sources4
Beta strandi196 – 198Combined sources3
Beta strandi201 – 206Combined sources6
Beta strandi209 – 211Combined sources3
Beta strandi213 – 215Combined sources3
Beta strandi218 – 221Combined sources4
Beta strandi224 – 229Combined sources6
Helixi232 – 234Combined sources3
Beta strandi236 – 244Combined sources9
Beta strandi247 – 250Combined sources4
Beta strandi254 – 259Combined sources6
Helixi261 – 266Combined sources6
Beta strandi464 – 467Combined sources4
Beta strandi471 – 475Combined sources5
Beta strandi485 – 494Combined sources10
Beta strandi502 – 506Combined sources5
Beta strandi509 – 514Combined sources6
Helixi517 – 519Combined sources3
Beta strandi523 – 528Combined sources6
Beta strandi533 – 537Combined sources5
Beta strandi540 – 543Combined sources4
Helixi666 – 675Combined sources10
Beta strandi676 – 680Combined sources5
Beta strandi687 – 689Combined sources3
Beta strandi691 – 699Combined sources9
Beta strandi706 – 715Combined sources10
Helixi719 – 721Combined sources3
Beta strandi724 – 728Combined sources5
Beta strandi735 – 738Combined sources4
Beta strandi746 – 755Combined sources10
Beta strandi766 – 769Combined sources4
Beta strandi780 – 786Combined sources7
Beta strandi794 – 799Combined sources6
Helixi803 – 805Combined sources3
Beta strandi812 – 821Combined sources10
Beta strandi825 – 831Combined sources7
Beta strandi836 – 839Combined sources4
Beta strandi848 – 856Combined sources9
Beta strandi867 – 869Combined sources3
Helixi880 – 883Combined sources4

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2EO9NMR-A454-564[»]
2V9QX-ray2.50A61-266[»]
2V9RX-ray2.00A61-266[»]
2V9TX-ray1.70A61-166[»]
3WIHX-ray1.70A/B777-873[»]
4HLJX-ray1.80A660-897[»]
ProteinModelPortaliQ9Y6N7.
SMRiQ9Y6N7.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9Y6N7.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini68 – 164Ig-like C2-type 1Add BLAST97
Domaini170 – 257Ig-like C2-type 2Add BLAST88
Domaini262 – 346Ig-like C2-type 3Add BLAST85
Domaini351 – 446Ig-like C2-type 4Add BLAST96
Domaini455 – 541Ig-like C2-type 5Add BLAST87
Domaini563 – 657Fibronectin type-III 1PROSITE-ProRule annotationAdd BLAST95
Domaini676 – 773Fibronectin type-III 2PROSITE-ProRule annotationAdd BLAST98
Domaini778 – 874Fibronectin type-III 3PROSITE-ProRule annotationAdd BLAST97

Sequence similaritiesi

Belongs to the immunoglobulin superfamily. ROBO family.Curated
Contains 3 fibronectin type-III domains.PROSITE-ProRule annotation

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG4222. Eukaryota.
ENOG410XPQS. LUCA.
GeneTreeiENSGT00840000129688.
HOGENOMiHOG000010267.
HOVERGENiHBG073476.
InParanoidiQ9Y6N7.
KOiK06753.
OMAiSQCPRPT.
OrthoDBiEOG091G00CG.
PhylomeDBiQ9Y6N7.
TreeFamiTF351053.

Family and domain databases

CDDicd00063. FN3. 3 hits.
Gene3Di2.60.40.10. 9 hits.
InterProiIPR003961. FN3_dom.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR013106. Ig_V-set.
IPR032986. Robo1.
[Graphical view]
PANTHERiPTHR10489:SF107. PTHR10489:SF107. 4 hits.
PfamiPF00041. fn3. 3 hits.
PF07679. I-set. 2 hits.
[Graphical view]
SMARTiSM00060. FN3. 3 hits.
SM00409. IG. 5 hits.
SM00408. IGc2. 5 hits.
SM00406. IGv. 2 hits.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 5 hits.
SSF49265. SSF49265. 2 hits.
PROSITEiPS50853. FN3. 3 hits.
PS50835. IG_LIKE. 5 hits.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9Y6N7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKWKHVPFLV MISLLSLSPN HLFLAQLIPD PEDVERGNDH GTPIPTSDND
60 70 80 90 100
DNSLGYTGSR LRQEDFPPRI VEHPSDLIVS KGEPATLNCK AEGRPTPTIE
110 120 130 140 150
WYKGGERVET DKDDPRSHRM LLPSGSLFFL RIVHGRKSRP DEGVYVCVAR
160 170 180 190 200
NYLGEAVSHN ASLEVAILRD DFRQNPSDVM VAVGEPAVME CQPPRGHPEP
210 220 230 240 250
TISWKKDGSP LDDKDERITI RGGKLMITYT RKSDAGKYVC VGTNMVGERE
260 270 280 290 300
SEVAELTVLE RPSFVKRPSN LAVTVDDSAE FKCEARGDPV PTVRWRKDDG
310 320 330 340 350
ELPKSRYEIR DDHTLKIRKV TAGDMGSYTC VAENMVGKAE ASATLTVQEP
360 370 380 390 400
PHFVVKPRDQ VVALGRTVTF QCEATGNPQP AIFWRREGSQ NLLFSYQPPQ
410 420 430 440 450
SSSRFSVSQT GDLTITNVQR SDVGYYICQT LNVAGSIITK AYLEVTDVIA
460 470 480 490 500
DRPPPVIRQG PVNQTVAVDG TFVLSCVATG SPVPTILWRK DGVLVSTQDS
510 520 530 540 550
RIKQLENGVL QIRYAKLGDT GRYTCIASTP SGEATWSAYI EVQEFGVPVQ
560 570 580 590 600
PPRPTDPNLI PSAPSKPEVT DVSRNTVTLS WQPNLNSGAT PTSYIIEAFS
610 620 630 640 650
HASGSSWQTV AENVKTETSA IKGLKPNAIY LFLVRAANAY GISDPSQISD
660 670 680 690 700
PVKTQDVLPT SQGVDHKQVQ RELGNAVLHL HNPTVLSSSS IEVHWTVDQQ
710 720 730 740 750
SQYIQGYKIL YRPSGANHGE SDWLVFEVRT PAKNSVVIPD LRKGVNYEIK
760 770 780 790 800
ARPFFNEFQG ADSEIKFAKT LEEAPSAPPQ GVTVSKNDGN GTAILVSWQP
810 820 830 840 850
PPEDTQNGMV QEYKVWCLGN ETRYHINKTV DGSTFSVVIP FLVPGIRYSV
860 870 880 890 900
EVAASTGAGS GVKSEPQFIQ LDAHGNPVSP EDQVSLAQQI SDVVKQPAFI
910 920 930 940 950
AGIGAACWII LMVFSIWLYR HRKKRNGLTS TYAGIRKVPS FTFTPTVTYQ
960 970 980 990 1000
RGGEAVSSGG RPGLLNISEP AAQPWLADTW PNTGNNHNDC SISCCTAGNG
1010 1020 1030 1040 1050
NSDSNLTTYS RPADCIANYN NQLDNKQTNL MLPESTVYGD VDLSNKINEM
1060 1070 1080 1090 1100
KTFNSPNLKD GRFVNPSGQP TPYATTQLIQ SNLSNNMNNG SGDSGEKHWK
1110 1120 1130 1140 1150
PLGQQKQEVA PVQYNIVEQN KLNKDYRAND TVPPTIPYNQ SYDQNTGGSY
1160 1170 1180 1190 1200
NSSDRGSSTS GSQGHKKGAR TPKVPKQGGM NWADLLPPPP AHPPPHSNSE
1210 1220 1230 1240 1250
EYNISVDESY DQEMPCPVPP ARMYLQQDEL EEEEDERGPT PPVRGAASSP
1260 1270 1280 1290 1300
AAVSYSHQST ATLTPSPQEE LQPMLQDCPE ETGHMQHQPD RRRQPVSPPP
1310 1320 1330 1340 1350
PPRPISPPHT YGYISGPLVS DMDTDAPEEE EDEADMEVAK MQTRRLLLRG
1360 1370 1380 1390 1400
LEQTPASSVG DLESSVTGSM INGWGSASEE DNISSGRSSV SSSDGSFFTD
1410 1420 1430 1440 1450
ADFAQAVAAA AEYAGLKVAR RQMQDAAGRR HFHASQCPRP TSPVSTDSNM
1460 1470 1480 1490 1500
SAAVMQKTRP AKKLKHQPGH LRRETYTDDL PPPPVPPPAI KSPTAQSKTQ
1510 1520 1530 1540 1550
LEVRPVVVPK LPSMDARTDR SSDRKGSSYK GREVLDGRQV VDMRTNPGDP
1560 1570 1580 1590 1600
REAQEQQNDG KGRGNKAAKR DLPPAKTHLI QEDILPYCRP TFPTSNNPRD
1610 1620 1630 1640 1650
PSSSSSMSSR GSGSRQREQA NVGRRNIAEM QVLGGYERGE DNNEELEETE

S
Length:1,651
Mass (Da):180,930
Last modified:November 1, 1999 - v1
Checksum:i9D98CD7CAB73074D
GO
Isoform 2 (identifier: Q9Y6N7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     543-543: Q → QGKVN

Note: Incomplete.
Show »
Length:1,655
Mass (Da):181,328
Checksum:iEB2C3DFF6013A30F
GO
Isoform 3 (identifier: Q9Y6N7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-39: Missing.
     40-57: HGTPIPTSDNDDNSLGYT → MIAEPAHFYLFGLICLCS
     348-348: Q → QVGS

Show »
Length:1,615
Mass (Da):176,814
Checksum:i66D6413527161E25
GO
Isoform 4 (identifier: Q9Y6N7-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-39: Missing.
     40-57: HGTPIPTSDNDDNSLGYT → MIAEPAHFYLFGLICLCS

Show »
Length:1,612
Mass (Da):176,571
Checksum:i4625E96485E88C34
GO
Isoform 5 (identifier: Q9Y6N7-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-57: MKWKHVPFLVMISLLSLSPNHLFLAQLIPDPEDVERGNDHGTPIPTSDNDDNSLGYT → MIAEPAHFYLFGLICLCS
     348-348: Q → QVGS
     938-946: Missing.

Note: No experimental confirmation available.
Show »
Length:1,606
Mass (Da):175,836
Checksum:i79FA0AA96275B1A2
GO
Isoform 6 (identifier: Q9Y6N7-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-57: MKWKHVPFLVMISLLSLSPNHLFLAQLIPDPEDVERGNDHGTPIPTSDNDDNSLGYT → MIAEPAHFYLFGLICLCS
     348-348: Q → QVGS
     938-946: Missing.
     1013-1067: Missing.

Note: No experimental confirmation available.
Show »
Length:1,551
Mass (Da):169,661
Checksum:i89F1C62C15B8C9A2
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti182A → V in AAI15023 (PubMed:15489334).Curated1
Sequence conflicti835F → L in AAI15023 (PubMed:15489334).Curated1
Sequence conflicti1095G → S in CAD98093 (PubMed:17974005).Curated1
Sequence conflicti1223M → T in Z95705 (PubMed:16641997).Curated1
Sequence conflicti1443P → L in CAD98093 (PubMed:17974005).Curated1
Sequence conflicti1536D → G in Z95705 (PubMed:16641997).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_053640336V → A.Corresponds to variant rs9647397dbSNPEnsembl.1
Natural variantiVAR_0190711055S → N in a breast cancer sample. 1 Publication1
Natural variantiVAR_0536411091S → N.Corresponds to variant rs35456279dbSNPEnsembl.1
Natural variantiVAR_0190721533E → D in a breast cancer sample. 1 PublicationCorresponds to variant rs36055689dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0438811 – 57MKWKH…SLGYT → MIAEPAHFYLFGLICLCS in isoform 5 and isoform 6. 1 PublicationAdd BLAST57
Alternative sequenceiVSP_0106431 – 39Missing in isoform 3 and isoform 4. CuratedAdd BLAST39
Alternative sequenceiVSP_01064440 – 57HGTPI…SLGYT → MIAEPAHFYLFGLICLCS in isoform 3 and isoform 4. CuratedAdd BLAST18
Alternative sequenceiVSP_010645348Q → QVGS in isoform 3, isoform 5 and isoform 6. 1 Publication1
Alternative sequenceiVSP_010646543Q → QGKVN in isoform 2. 1 Publication1
Alternative sequenceiVSP_043882938 – 946Missing in isoform 5 and isoform 6. 1 Publication9
Alternative sequenceiVSP_0460841013 – 1067Missing in isoform 6. 1 PublicationAdd BLAST55

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF040990 mRNA. Translation: AAC39575.1.
Z95705 Genomic DNA. No translation available.
AC016946 Genomic DNA. No translation available.
AC055731 Genomic DNA. No translation available.
AC106718 Genomic DNA. No translation available.
AC106720 Genomic DNA. No translation available.
AC108719 Genomic DNA. No translation available.
AC117461 Genomic DNA. No translation available.
AC117479 Genomic DNA. No translation available.
AC119035 Genomic DNA. No translation available.
AC123565 Genomic DNA. No translation available.
AC125624 Genomic DNA. No translation available.
AC125766 Genomic DNA. No translation available.
AC125815 Genomic DNA. No translation available.
AC131008 Genomic DNA. No translation available.
CH471110 Genomic DNA. Translation: EAW68884.1.
CH471110 Genomic DNA. Translation: EAW68885.1.
BC001969 mRNA. Translation: AAH01969.1.
BC115022 mRNA. Translation: AAI15023.1.
BC157861 mRNA. Translation: AAI57862.1.
BC171855 mRNA. Translation: AAI71855.1.
BX538319 mRNA. Translation: CAD98093.1.
CCDSiCCDS46872.2. [Q9Y6N7-5]
CCDS54610.1. [Q9Y6N7-6]
CCDS54611.1. [Q9Y6N7-1]
RefSeqiNP_001139317.1. NM_001145845.1. [Q9Y6N7-6]
NP_002932.1. NM_002941.3. [Q9Y6N7-1]
NP_598334.2. NM_133631.3. [Q9Y6N7-5]
XP_006713340.1. XM_006713277.2. [Q9Y6N7-3]
XP_016862472.1. XM_017006983.1. [Q9Y6N7-4]
UniGeneiHs.744218.

Genome annotation databases

EnsembliENST00000464233; ENSP00000420321; ENSG00000169855. [Q9Y6N7-1]
ENST00000467549; ENSP00000417992; ENSG00000169855. [Q9Y6N7-6]
ENST00000495273; ENSP00000420637; ENSG00000169855. [Q9Y6N7-5]
GeneIDi6091.
KEGGihsa:6091.
UCSCiuc003dqc.3. human. [Q9Y6N7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF040990 mRNA. Translation: AAC39575.1.
Z95705 Genomic DNA. No translation available.
AC016946 Genomic DNA. No translation available.
AC055731 Genomic DNA. No translation available.
AC106718 Genomic DNA. No translation available.
AC106720 Genomic DNA. No translation available.
AC108719 Genomic DNA. No translation available.
AC117461 Genomic DNA. No translation available.
AC117479 Genomic DNA. No translation available.
AC119035 Genomic DNA. No translation available.
AC123565 Genomic DNA. No translation available.
AC125624 Genomic DNA. No translation available.
AC125766 Genomic DNA. No translation available.
AC125815 Genomic DNA. No translation available.
AC131008 Genomic DNA. No translation available.
CH471110 Genomic DNA. Translation: EAW68884.1.
CH471110 Genomic DNA. Translation: EAW68885.1.
BC001969 mRNA. Translation: AAH01969.1.
BC115022 mRNA. Translation: AAI15023.1.
BC157861 mRNA. Translation: AAI57862.1.
BC171855 mRNA. Translation: AAI71855.1.
BX538319 mRNA. Translation: CAD98093.1.
CCDSiCCDS46872.2. [Q9Y6N7-5]
CCDS54610.1. [Q9Y6N7-6]
CCDS54611.1. [Q9Y6N7-1]
RefSeqiNP_001139317.1. NM_001145845.1. [Q9Y6N7-6]
NP_002932.1. NM_002941.3. [Q9Y6N7-1]
NP_598334.2. NM_133631.3. [Q9Y6N7-5]
XP_006713340.1. XM_006713277.2. [Q9Y6N7-3]
XP_016862472.1. XM_017006983.1. [Q9Y6N7-4]
UniGeneiHs.744218.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2EO9NMR-A454-564[»]
2V9QX-ray2.50A61-266[»]
2V9RX-ray2.00A61-266[»]
2V9TX-ray1.70A61-166[»]
3WIHX-ray1.70A/B777-873[»]
4HLJX-ray1.80A660-897[»]
ProteinModelPortaliQ9Y6N7.
SMRiQ9Y6N7.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112018. 8 interactors.
DIPiDIP-33034N.
IntActiQ9Y6N7. 7 interactors.
MINTiMINT-1392694.
STRINGi9606.ENSP00000420321.

PTM databases

iPTMnetiQ9Y6N7.
PhosphoSitePlusiQ9Y6N7.

Polymorphism and mutation databases

BioMutaiROBO1.
DMDMi49036500.

Proteomic databases

EPDiQ9Y6N7.
PaxDbiQ9Y6N7.
PeptideAtlasiQ9Y6N7.
PRIDEiQ9Y6N7.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000464233; ENSP00000420321; ENSG00000169855. [Q9Y6N7-1]
ENST00000467549; ENSP00000417992; ENSG00000169855. [Q9Y6N7-6]
ENST00000495273; ENSP00000420637; ENSG00000169855. [Q9Y6N7-5]
GeneIDi6091.
KEGGihsa:6091.
UCSCiuc003dqc.3. human. [Q9Y6N7-1]

Organism-specific databases

CTDi6091.
DisGeNETi6091.
GeneCardsiROBO1.
HGNCiHGNC:10249. ROBO1.
HPAiCAB013524.
HPA052968.
MIMi602430. gene.
neXtProtiNX_Q9Y6N7.
OpenTargetsiENSG00000169855.
PharmGKBiPA34620.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4222. Eukaryota.
ENOG410XPQS. LUCA.
GeneTreeiENSGT00840000129688.
HOGENOMiHOG000010267.
HOVERGENiHBG073476.
InParanoidiQ9Y6N7.
KOiK06753.
OMAiSQCPRPT.
OrthoDBiEOG091G00CG.
PhylomeDBiQ9Y6N7.
TreeFamiTF351053.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000169855-MONOMER.
ReactomeiR-HSA-373752. Netrin-1 signaling.
R-HSA-376176. Signaling by Robo receptor.
R-HSA-428540. Activation of Rac.
R-HSA-428542. Regulation of Commissural axon pathfinding by Slit and Robo.
R-HSA-428543. Inactivation of Cdc42 and Rac.
R-HSA-428890. Role of Abl in Robo-Slit signaling.
SIGNORiQ9Y6N7.

Miscellaneous databases

ChiTaRSiROBO1. human.
EvolutionaryTraceiQ9Y6N7.
GeneWikiiROBO1.
GenomeRNAii6091.
PROiQ9Y6N7.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000169855.
CleanExiHS_ROBO1.
ExpressionAtlasiQ9Y6N7. baseline and differential.
GenevisibleiQ9Y6N7. HS.

Family and domain databases

CDDicd00063. FN3. 3 hits.
Gene3Di2.60.40.10. 9 hits.
InterProiIPR003961. FN3_dom.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR013106. Ig_V-set.
IPR032986. Robo1.
[Graphical view]
PANTHERiPTHR10489:SF107. PTHR10489:SF107. 4 hits.
PfamiPF00041. fn3. 3 hits.
PF07679. I-set. 2 hits.
[Graphical view]
SMARTiSM00060. FN3. 3 hits.
SM00409. IG. 5 hits.
SM00408. IGc2. 5 hits.
SM00406. IGv. 2 hits.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 5 hits.
SSF49265. SSF49265. 2 hits.
PROSITEiPS50853. FN3. 3 hits.
PS50835. IG_LIKE. 5 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiROBO1_HUMAN
AccessioniPrimary (citable) accession number: Q9Y6N7
Secondary accession number(s): B2RXI1
, D3DU36, E9PD49, Q1RMC7, Q7Z300, Q9BUS7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 21, 2004
Last sequence update: November 1, 1999
Last modified: November 30, 2016
This is version 154 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

Maps within a region of overlapping homozygous deletions characterized in both small cell lung cancer cell lines (SCLC) and in a breast cancer cell line. The promoter region of ROBO1 shows complete hypermethylation of CpG sites in the BT-20 breast tumor cell lines, some primary invasive breast carcinomasa and some primary clear cell renal cell carcinomas (CC-RCC).

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.