SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9Y6N1

- COX11_HUMAN

UniProt

Q9Y6N1 - COX11_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Cytochrome c oxidase assembly protein COX11, mitochondrial
Gene
COX11
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Exerts its effect at some terminal stage of cytochrome c oxidase synthesis, probably by being involved in the insertion of the copper B into subunit I By similarity.UniRule annotation

GO - Molecular functioni

  1. copper ion binding Source: InterPro
  2. cytochrome-c oxidase activity Source: ProtInc
  3. electron carrier activity Source: UniProtKB

GO - Biological processi

  1. hydrogen ion transmembrane transport Source: GOC
  2. negative regulation of glucokinase activity Source: Ensembl
  3. respiratory chain complex IV assembly Source: ProtInc
  4. respiratory gaseous exchange Source: ProtInc
Complete GO annotation...

Keywords - Ligandi

Copper

Names & Taxonomyi

Protein namesi
Recommended name:
Cytochrome c oxidase assembly protein COX11, mitochondrial
Gene namesi
Name:COX11
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 17

Organism-specific databases

HGNCiHGNC:2261. COX11.

Subcellular locationi

Mitochondrion inner membrane; Single-pass membrane protein; Intermembrane side 1 Publication

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini? – 95Mitochondrial matrix Reviewed prediction
Transmembranei96 – 11419Helical; Reviewed prediction
Add
BLAST
Topological domaini115 – 276162Mitochondrial intermembrane Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
  2. mitochondrial inner membrane Source: UniProtKB-SubCell
  3. mitochondrion Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Membrane, Mitochondrion, Mitochondrion inner membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA26777.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini? – 276Cytochrome c oxidase assembly protein COX11, mitochondrialUniRule annotationPRO_0000006080
Transit peptidei1 – ?Mitochondrion Reviewed prediction

Proteomic databases

MaxQBiQ9Y6N1.
PaxDbiQ9Y6N1.
PRIDEiQ9Y6N1.

PTM databases

PhosphoSiteiQ9Y6N1.

Expressioni

Tissue specificityi

Ubiquitous.1 Publication

Gene expression databases

ArrayExpressiQ9Y6N1.
BgeeiQ9Y6N1.
CleanExiHS_COX11.
GenevestigatoriQ9Y6N1.

Organism-specific databases

HPAiHPA044020.

Interactioni

Subunit structurei

Interacts with CNNM4/ACDP4.1 Publication

Protein-protein interaction databases

BioGridi107746. 2 interactions.
IntActiQ9Y6N1. 3 interactions.
STRINGi9606.ENSP00000299335.

Structurei

3D structure databases

ProteinModelPortaliQ9Y6N1.
SMRiQ9Y6N1. Positions 145-262.

Family & Domainsi

Sequence similaritiesi

Belongs to the COX11/CtaG family.

Keywords - Domaini

Transit peptide, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG3175.
HOGENOMiHOG000264965.
HOVERGENiHBG051085.
InParanoidiQ9Y6N1.
KOiK02258.
OMAiMARVDTI.
OrthoDBiEOG7JMGFB.
PhylomeDBiQ9Y6N1.
TreeFamiTF105072.

Family and domain databases

Gene3Di2.60.370.10. 1 hit.
HAMAPiMF_00155. CtaG.
InterProiIPR023471. CtaG/Cox11_dom.
IPR007533. Cyt_c_oxidase_assmbl_CtaG.
[Graphical view]
PANTHERiPTHR21320. PTHR21320. 1 hit.
PfamiPF04442. CtaG_Cox11. 1 hit.
[Graphical view]
SUPFAMiSSF110111. SSF110111. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9Y6N1-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MGGLWRPGWR CVPFCGWRWI HPGSPTRAAE RVEPFLRPEW SGTGGAERGL    50
RWLGTWKRCS LRARHPALQP PRRPKSSNPF TRAQEEERRR QNKTTLTYVA 100
AVAVGMLGAS YAAVPLYRLY CQTTGLGGSA VAGHASDKIE NMVPVKDRII 150
KISFNADVHA SLQWNFRPQQ TEIYVVPGET ALAFYRAKNP TDKPVIGIST 200
YNIVPFEAGQ YFNKIQCFCF EEQRLNPQEE VDMPVFFYID PEFAEDPRMI 250
KVDLITLSYT FFEAKEGHKL PVPGYN 276
Length:276
Mass (Da):31,430
Last modified:March 1, 2005 - v3
Checksum:i1F2BD22E1E7DD52D
GO
Isoform 2 (identifier: Q9Y6N1-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     217-276: CFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPRMIKVDLITLSYTFFEAKEGHKLPVPGYN → ASKLHRVYVLESWHL

Note: No experimental confirmation available.

Show »
Length:231
Mass (Da):26,133
Checksum:i3A8BC28441A3D78B
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti74 – 741P → L.
Corresponds to variant rs34080917 [ dbSNP | Ensembl ].
VAR_048831

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei217 – 27660CFCFE…VPGYN → ASKLHRVYVLESWHL in isoform 2.
VSP_046360Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti187 – 1871A → V in AAH05895. 1 Publication
Isoform 2 (identifier: Q9Y6N1-2)
Sequence conflicti223 – 2231V → G in BI600359. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF044321 mRNA. Translation: AAD08645.1.
CR541837 mRNA. Translation: CAG46636.1.
AC007485 Genomic DNA. No translation available.
AC090824 Genomic DNA. No translation available.
CH471109 Genomic DNA. Translation: EAW94548.1.
CH471109 Genomic DNA. Translation: EAW94550.1.
BC005895 mRNA. Translation: AAH05895.1.
BI600359 mRNA. No translation available.
U79270 mRNA. Translation: AAB50214.1.
CCDSiCCDS11583.1. [Q9Y6N1-1]
CCDS58579.1. [Q9Y6N1-2]
RefSeqiNP_004366.1. NM_004375.3. [Q9Y6N1-1]
XP_006721767.1. XM_006721704.1. [Q9Y6N1-1]
XP_006721768.1. XM_006721705.1. [Q9Y6N1-1]
UniGeneiHs.591171.

Genome annotation databases

EnsembliENST00000299335; ENSP00000299335; ENSG00000166260. [Q9Y6N1-1]
ENST00000572558; ENSP00000459302; ENSG00000166260. [Q9Y6N1-2]
ENST00000576370; ENSP00000459901; ENSG00000166260. [Q9Y6N1-1]
GeneIDi1353.
KEGGihsa:1353.
UCSCiuc010wng.1. human. [Q9Y6N1-1]

Polymorphism databases

DMDMi60416378.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF044321 mRNA. Translation: AAD08645.1 .
CR541837 mRNA. Translation: CAG46636.1 .
AC007485 Genomic DNA. No translation available.
AC090824 Genomic DNA. No translation available.
CH471109 Genomic DNA. Translation: EAW94548.1 .
CH471109 Genomic DNA. Translation: EAW94550.1 .
BC005895 mRNA. Translation: AAH05895.1 .
BI600359 mRNA. No translation available.
U79270 mRNA. Translation: AAB50214.1 .
CCDSi CCDS11583.1. [Q9Y6N1-1 ]
CCDS58579.1. [Q9Y6N1-2 ]
RefSeqi NP_004366.1. NM_004375.3. [Q9Y6N1-1 ]
XP_006721767.1. XM_006721704.1. [Q9Y6N1-1 ]
XP_006721768.1. XM_006721705.1. [Q9Y6N1-1 ]
UniGenei Hs.591171.

3D structure databases

ProteinModelPortali Q9Y6N1.
SMRi Q9Y6N1. Positions 145-262.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 107746. 2 interactions.
IntActi Q9Y6N1. 3 interactions.
STRINGi 9606.ENSP00000299335.

PTM databases

PhosphoSitei Q9Y6N1.

Polymorphism databases

DMDMi 60416378.

Proteomic databases

MaxQBi Q9Y6N1.
PaxDbi Q9Y6N1.
PRIDEi Q9Y6N1.

Protocols and materials databases

DNASUi 1353.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000299335 ; ENSP00000299335 ; ENSG00000166260 . [Q9Y6N1-1 ]
ENST00000572558 ; ENSP00000459302 ; ENSG00000166260 . [Q9Y6N1-2 ]
ENST00000576370 ; ENSP00000459901 ; ENSG00000166260 . [Q9Y6N1-1 ]
GeneIDi 1353.
KEGGi hsa:1353.
UCSCi uc010wng.1. human. [Q9Y6N1-1 ]

Organism-specific databases

CTDi 1353.
GeneCardsi GC17M053029.
HGNCi HGNC:2261. COX11.
HPAi HPA044020.
MIMi 603648. gene.
neXtProti NX_Q9Y6N1.
PharmGKBi PA26777.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG3175.
HOGENOMi HOG000264965.
HOVERGENi HBG051085.
InParanoidi Q9Y6N1.
KOi K02258.
OMAi MARVDTI.
OrthoDBi EOG7JMGFB.
PhylomeDBi Q9Y6N1.
TreeFami TF105072.

Miscellaneous databases

GenomeRNAii 1353.
NextBioi 5483.
PROi Q9Y6N1.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q9Y6N1.
Bgeei Q9Y6N1.
CleanExi HS_COX11.
Genevestigatori Q9Y6N1.

Family and domain databases

Gene3Di 2.60.370.10. 1 hit.
HAMAPi MF_00155. CtaG.
InterProi IPR023471. CtaG/Cox11_dom.
IPR007533. Cyt_c_oxidase_assmbl_CtaG.
[Graphical view ]
PANTHERi PTHR21320. PTHR21320. 1 hit.
Pfami PF04442. CtaG_Cox11. 1 hit.
[Graphical view ]
SUPFAMi SSF110111. SSF110111. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Identification and characterization of human cDNAs specific to BCS1, PET112, SCO1, COX15, and COX11, five genes involved in the formation and function of the mitochondrial respiratory chain."
    Petruzzella V., Tiranti V., Fernandez P., Ianna P., Carrozzo R., Zeviani M.
    Genomics 54:494-504(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
  2. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
    Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
    Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  3. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
    Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
    , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
    Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Brain and Hypothalamus.
  6. "Large-scale concatenation cDNA sequencing."
    Yu W., Andersson B., Worley K.C., Muzny D.M., Ding Y., Liu W., Ricafrente J.Y., Wentland M.A., Lennon G., Gibbs R.A.
    Genome Res. 7:353-358(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 125-276 (ISOFORM 1).
    Tissue: Brain.
  7. "Physical interaction and functional coupling between ACDP4 and the intracellular ion chaperone COX11, an implication of the role of ACDP4 in essential metal ion transport and homeostasis."
    Guo D., Ling J., Wang M.-H., She J.-X., Gu J., Wang C.-Y.
    Mol. Pain 1:15-15(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH CNNM4.

Entry informationi

Entry nameiCOX11_HUMAN
AccessioniPrimary (citable) accession number: Q9Y6N1
Secondary accession number(s): D3DTY5
, I3L220, Q6FHB7, Q9BRX0, Q9UME8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: March 1, 2005
Last modified: July 9, 2014
This is version 118 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi