Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cytochrome c oxidase assembly protein COX11, mitochondrial

Gene

COX11

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Exerts its effect at some terminal stage of cytochrome c oxidase synthesis, probably by being involved in the insertion of the copper B into subunit I.By similarity

GO - Molecular functioni

  • copper ion binding Source: InterPro
  • cytochrome-c oxidase activity Source: ProtInc
  • electron transfer activity Source: UniProtKB

GO - Biological processi

  • metal ion homeostasis Source: UniProtKB
  • negative regulation of glucokinase activity Source: Ensembl
  • respiratory chain complex IV assembly Source: ProtInc
  • respiratory gaseous exchange Source: ProtInc

Keywordsi

LigandCopper

Enzyme and pathway databases

ReactomeiR-HSA-5628897 TP53 Regulates Metabolic Genes
R-HSA-611105 Respiratory electron transport

Names & Taxonomyi

Protein namesi
Recommended name:
Cytochrome c oxidase assembly protein COX11, mitochondrial
Gene namesi
Name:COX11
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

EuPathDBiHostDB:ENSG00000166260.10
HGNCiHGNC:2261 COX11
MIMi603648 gene
neXtProtiNX_Q9Y6N1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini? – 95Mitochondrial matrix1 Publication
Transmembranei96 – 114HelicalSequence analysisAdd BLAST19
Topological domaini115 – 276Mitochondrial intermembrane1 PublicationAdd BLAST162

Keywords - Cellular componenti

Membrane, Mitochondrion, Mitochondrion inner membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi1353
OpenTargetsiENSG00000166260
PharmGKBiPA26777

Polymorphism and mutation databases

BioMutaiCOX11
DMDMi60416378

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_0000006080? – 276Cytochrome c oxidase assembly protein COX11, mitochondrial
Transit peptidei1 – ?MitochondrionSequence analysis

Proteomic databases

EPDiQ9Y6N1
PaxDbiQ9Y6N1
PeptideAtlasiQ9Y6N1
PRIDEiQ9Y6N1

PTM databases

iPTMnetiQ9Y6N1
PhosphoSitePlusiQ9Y6N1

Expressioni

Tissue specificityi

Ubiquitous.1 Publication

Gene expression databases

BgeeiENSG00000166260
CleanExiHS_COX11
ExpressionAtlasiQ9Y6N1 baseline and differential
GenevisibleiQ9Y6N1 HS

Organism-specific databases

HPAiHPA044020

Interactioni

Subunit structurei

Interacts with CNNM4/ACDP4.1 Publication

Protein-protein interaction databases

BioGridi107746, 13 interactors
IntActiQ9Y6N1, 12 interactors
STRINGi9606.ENSP00000299335

Structurei

3D structure databases

ProteinModelPortaliQ9Y6N1
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the COX11/CtaG family.Curated

Keywords - Domaini

Transit peptide, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG2540 Eukaryota
COG3175 LUCA
GeneTreeiENSGT00390000007512
HOGENOMiHOG000264965
HOVERGENiHBG051085
InParanoidiQ9Y6N1
KOiK02258
OMAiNKLECFC
OrthoDBiEOG091G0J14
PhylomeDBiQ9Y6N1
TreeFamiTF105072

Family and domain databases

Gene3Di2.60.370.10, 1 hit
HAMAPiMF_00155 CtaG, 1 hit
InterProiView protein in InterPro
IPR023471 CtaG/Cox11_dom_sf
IPR007533 Cyt_c_oxidase_assmbl_CtaG
PfamiView protein in Pfam
PF04442 CtaG_Cox11, 1 hit
SUPFAMiSSF110111 SSF110111, 1 hit

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9Y6N1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGGLWRPGWR CVPFCGWRWI HPGSPTRAAE RVEPFLRPEW SGTGGAERGL
60 70 80 90 100
RWLGTWKRCS LRARHPALQP PRRPKSSNPF TRAQEEERRR QNKTTLTYVA
110 120 130 140 150
AVAVGMLGAS YAAVPLYRLY CQTTGLGGSA VAGHASDKIE NMVPVKDRII
160 170 180 190 200
KISFNADVHA SLQWNFRPQQ TEIYVVPGET ALAFYRAKNP TDKPVIGIST
210 220 230 240 250
YNIVPFEAGQ YFNKIQCFCF EEQRLNPQEE VDMPVFFYID PEFAEDPRMI
260 270
KVDLITLSYT FFEAKEGHKL PVPGYN
Length:276
Mass (Da):31,430
Last modified:March 1, 2005 - v3
Checksum:i1F2BD22E1E7DD52D
GO
Isoform 2 (identifier: Q9Y6N1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     217-276: CFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPRMIKVDLITLSYTFFEAKEGHKLPVPGYN → ASKLHRVYVLESWHL

Note: No experimental confirmation available.Curated
Show »
Length:231
Mass (Da):26,133
Checksum:i3A8BC28441A3D78B
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti187A → V in AAH05895 (PubMed:15489334).Curated1
Isoform 2 (identifier: Q9Y6N1-2)
Sequence conflicti223V → G in BI600359 (Ref. 4) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_04883174P → L. Corresponds to variant dbSNP:rs34080917Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_046360217 – 276CFCFE…VPGYN → ASKLHRVYVLESWHL in isoform 2. 1 PublicationAdd BLAST60

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF044321 mRNA Translation: AAD08645.1
CR541837 mRNA Translation: CAG46636.1
AC007485 Genomic DNA No translation available.
AC090824 Genomic DNA No translation available.
CH471109 Genomic DNA Translation: EAW94548.1
CH471109 Genomic DNA Translation: EAW94550.1
BC005895 mRNA Translation: AAH05895.1
BI600359 mRNA No translation available.
U79270 mRNA Translation: AAB50214.1
CCDSiCCDS11583.1 [Q9Y6N1-1]
CCDS58579.1 [Q9Y6N1-2]
RefSeqiNP_004366.1, NM_004375.4 [Q9Y6N1-1]
XP_011522644.1, XM_011524342.2 [Q9Y6N1-1]
XP_016879681.1, XM_017024192.1 [Q9Y6N1-1]
XP_016879682.1, XM_017024193.1 [Q9Y6N1-1]
XP_016879683.1, XM_017024194.1 [Q9Y6N1-2]
XP_016879684.1, XM_017024195.1 [Q9Y6N1-2]
XP_016879685.1, XM_017024196.1 [Q9Y6N1-2]
UniGeneiHs.591171
Hs.657992

Genome annotation databases

EnsembliENST00000299335; ENSP00000299335; ENSG00000166260 [Q9Y6N1-1]
ENST00000572558; ENSP00000459302; ENSG00000166260 [Q9Y6N1-2]
ENST00000576370; ENSP00000459901; ENSG00000166260 [Q9Y6N1-1]
ENST00000639671; ENSP00000492488; ENSG00000166260 [Q9Y6N1-2]
GeneIDi1353
KEGGihsa:1353
UCSCiuc010wng.2 human [Q9Y6N1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiCOX11_HUMAN
AccessioniPrimary (citable) accession number: Q9Y6N1
Secondary accession number(s): D3DTY5
, I3L220, Q6FHB7, Q9BRX0, Q9UME8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: March 1, 2005
Last modified: May 23, 2018
This is version 152 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health