Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9Y6N1

- COX11_HUMAN

UniProt

Q9Y6N1 - COX11_HUMAN

Protein

Cytochrome c oxidase assembly protein COX11, mitochondrial

Gene

COX11

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 119 (01 Oct 2014)
      Sequence version 3 (01 Mar 2005)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Exerts its effect at some terminal stage of cytochrome c oxidase synthesis, probably by being involved in the insertion of the copper B into subunit I.By similarity

    GO - Molecular functioni

    1. copper ion binding Source: InterPro
    2. cytochrome-c oxidase activity Source: ProtInc
    3. electron carrier activity Source: UniProtKB

    GO - Biological processi

    1. hydrogen ion transmembrane transport Source: GOC
    2. negative regulation of glucokinase activity Source: Ensembl
    3. respiratory chain complex IV assembly Source: ProtInc
    4. respiratory gaseous exchange Source: ProtInc

    Keywords - Ligandi

    Copper

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Cytochrome c oxidase assembly protein COX11, mitochondrial
    Gene namesi
    Name:COX11
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 17

    Organism-specific databases

    HGNCiHGNC:2261. COX11.

    Subcellular locationi

    Mitochondrion inner membrane 1 Publication; Single-pass membrane protein 1 Publication; Intermembrane side 1 Publication

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW
    2. mitochondrial inner membrane Source: UniProtKB-SubCell
    3. mitochondrion Source: ProtInc

    Keywords - Cellular componenti

    Membrane, Mitochondrion, Mitochondrion inner membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA26777.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini? – 276Cytochrome c oxidase assembly protein COX11, mitochondrialPRO_0000006080
    Transit peptidei1 – ?MitochondrionSequence Analysis

    Proteomic databases

    MaxQBiQ9Y6N1.
    PaxDbiQ9Y6N1.
    PRIDEiQ9Y6N1.

    PTM databases

    PhosphoSiteiQ9Y6N1.

    Expressioni

    Tissue specificityi

    Ubiquitous.1 Publication

    Gene expression databases

    ArrayExpressiQ9Y6N1.
    BgeeiQ9Y6N1.
    CleanExiHS_COX11.
    GenevestigatoriQ9Y6N1.

    Organism-specific databases

    HPAiHPA044020.

    Interactioni

    Subunit structurei

    Interacts with CNNM4/ACDP4.1 Publication

    Protein-protein interaction databases

    BioGridi107746. 2 interactions.
    IntActiQ9Y6N1. 3 interactions.
    STRINGi9606.ENSP00000299335.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9Y6N1.
    SMRiQ9Y6N1. Positions 145-262.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini? – 95Mitochondrial matrixSequence Analysis
    Topological domaini115 – 276162Mitochondrial intermembraneSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei96 – 11419HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the COX11/CtaG family.Curated

    Keywords - Domaini

    Transit peptide, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiCOG3175.
    HOGENOMiHOG000264965.
    HOVERGENiHBG051085.
    InParanoidiQ9Y6N1.
    KOiK02258.
    OMAiMARVDTI.
    OrthoDBiEOG7JMGFB.
    PhylomeDBiQ9Y6N1.
    TreeFamiTF105072.

    Family and domain databases

    Gene3Di2.60.370.10. 1 hit.
    HAMAPiMF_00155. CtaG.
    InterProiIPR023471. CtaG/Cox11_dom.
    IPR007533. Cyt_c_oxidase_assmbl_CtaG.
    [Graphical view]
    PANTHERiPTHR21320. PTHR21320. 1 hit.
    PfamiPF04442. CtaG_Cox11. 1 hit.
    [Graphical view]
    SUPFAMiSSF110111. SSF110111. 1 hit.

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9Y6N1-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGGLWRPGWR CVPFCGWRWI HPGSPTRAAE RVEPFLRPEW SGTGGAERGL    50
    RWLGTWKRCS LRARHPALQP PRRPKSSNPF TRAQEEERRR QNKTTLTYVA 100
    AVAVGMLGAS YAAVPLYRLY CQTTGLGGSA VAGHASDKIE NMVPVKDRII 150
    KISFNADVHA SLQWNFRPQQ TEIYVVPGET ALAFYRAKNP TDKPVIGIST 200
    YNIVPFEAGQ YFNKIQCFCF EEQRLNPQEE VDMPVFFYID PEFAEDPRMI 250
    KVDLITLSYT FFEAKEGHKL PVPGYN 276
    Length:276
    Mass (Da):31,430
    Last modified:March 1, 2005 - v3
    Checksum:i1F2BD22E1E7DD52D
    GO
    Isoform 2 (identifier: Q9Y6N1-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         217-276: CFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPRMIKVDLITLSYTFFEAKEGHKLPVPGYN → ASKLHRVYVLESWHL

    Note: No experimental confirmation available.Curated

    Show »
    Length:231
    Mass (Da):26,133
    Checksum:i3A8BC28441A3D78B
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti187 – 1871A → V in AAH05895. (PubMed:15489334)Curated
    Isoform 2 (identifier: Q9Y6N1-2)
    Sequence conflicti223 – 2231V → G in BI600359. 1 PublicationCurated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti74 – 741P → L.
    Corresponds to variant rs34080917 [ dbSNP | Ensembl ].
    VAR_048831

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei217 – 27660CFCFE…VPGYN → ASKLHRVYVLESWHL in isoform 2. 1 PublicationVSP_046360Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF044321 mRNA. Translation: AAD08645.1.
    CR541837 mRNA. Translation: CAG46636.1.
    AC007485 Genomic DNA. No translation available.
    AC090824 Genomic DNA. No translation available.
    CH471109 Genomic DNA. Translation: EAW94548.1.
    CH471109 Genomic DNA. Translation: EAW94550.1.
    BC005895 mRNA. Translation: AAH05895.1.
    BI600359 mRNA. No translation available.
    U79270 mRNA. Translation: AAB50214.1.
    CCDSiCCDS11583.1. [Q9Y6N1-1]
    CCDS58579.1. [Q9Y6N1-2]
    RefSeqiNP_004366.1. NM_004375.3. [Q9Y6N1-1]
    XP_006721767.1. XM_006721704.1. [Q9Y6N1-1]
    XP_006721768.1. XM_006721705.1. [Q9Y6N1-1]
    UniGeneiHs.591171.

    Genome annotation databases

    EnsembliENST00000299335; ENSP00000299335; ENSG00000166260. [Q9Y6N1-1]
    ENST00000572558; ENSP00000459302; ENSG00000166260. [Q9Y6N1-2]
    ENST00000576370; ENSP00000459901; ENSG00000166260. [Q9Y6N1-1]
    GeneIDi1353.
    KEGGihsa:1353.
    UCSCiuc010wng.1. human. [Q9Y6N1-1]

    Polymorphism databases

    DMDMi60416378.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF044321 mRNA. Translation: AAD08645.1 .
    CR541837 mRNA. Translation: CAG46636.1 .
    AC007485 Genomic DNA. No translation available.
    AC090824 Genomic DNA. No translation available.
    CH471109 Genomic DNA. Translation: EAW94548.1 .
    CH471109 Genomic DNA. Translation: EAW94550.1 .
    BC005895 mRNA. Translation: AAH05895.1 .
    BI600359 mRNA. No translation available.
    U79270 mRNA. Translation: AAB50214.1 .
    CCDSi CCDS11583.1. [Q9Y6N1-1 ]
    CCDS58579.1. [Q9Y6N1-2 ]
    RefSeqi NP_004366.1. NM_004375.3. [Q9Y6N1-1 ]
    XP_006721767.1. XM_006721704.1. [Q9Y6N1-1 ]
    XP_006721768.1. XM_006721705.1. [Q9Y6N1-1 ]
    UniGenei Hs.591171.

    3D structure databases

    ProteinModelPortali Q9Y6N1.
    SMRi Q9Y6N1. Positions 145-262.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 107746. 2 interactions.
    IntActi Q9Y6N1. 3 interactions.
    STRINGi 9606.ENSP00000299335.

    PTM databases

    PhosphoSitei Q9Y6N1.

    Polymorphism databases

    DMDMi 60416378.

    Proteomic databases

    MaxQBi Q9Y6N1.
    PaxDbi Q9Y6N1.
    PRIDEi Q9Y6N1.

    Protocols and materials databases

    DNASUi 1353.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000299335 ; ENSP00000299335 ; ENSG00000166260 . [Q9Y6N1-1 ]
    ENST00000572558 ; ENSP00000459302 ; ENSG00000166260 . [Q9Y6N1-2 ]
    ENST00000576370 ; ENSP00000459901 ; ENSG00000166260 . [Q9Y6N1-1 ]
    GeneIDi 1353.
    KEGGi hsa:1353.
    UCSCi uc010wng.1. human. [Q9Y6N1-1 ]

    Organism-specific databases

    CTDi 1353.
    GeneCardsi GC17M053029.
    HGNCi HGNC:2261. COX11.
    HPAi HPA044020.
    MIMi 603648. gene.
    neXtProti NX_Q9Y6N1.
    PharmGKBi PA26777.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG3175.
    HOGENOMi HOG000264965.
    HOVERGENi HBG051085.
    InParanoidi Q9Y6N1.
    KOi K02258.
    OMAi MARVDTI.
    OrthoDBi EOG7JMGFB.
    PhylomeDBi Q9Y6N1.
    TreeFami TF105072.

    Miscellaneous databases

    GenomeRNAii 1353.
    NextBioi 5483.
    PROi Q9Y6N1.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9Y6N1.
    Bgeei Q9Y6N1.
    CleanExi HS_COX11.
    Genevestigatori Q9Y6N1.

    Family and domain databases

    Gene3Di 2.60.370.10. 1 hit.
    HAMAPi MF_00155. CtaG.
    InterProi IPR023471. CtaG/Cox11_dom.
    IPR007533. Cyt_c_oxidase_assmbl_CtaG.
    [Graphical view ]
    PANTHERi PTHR21320. PTHR21320. 1 hit.
    Pfami PF04442. CtaG_Cox11. 1 hit.
    [Graphical view ]
    SUPFAMi SSF110111. SSF110111. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Identification and characterization of human cDNAs specific to BCS1, PET112, SCO1, COX15, and COX11, five genes involved in the formation and function of the mitochondrial respiratory chain."
      Petruzzella V., Tiranti V., Fernandez P., Ianna P., Carrozzo R., Zeviani M.
      Genomics 54:494-504(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    2. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
      Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
      Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    3. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
      Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
      , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
      Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Brain and Hypothalamus.
    6. "Large-scale concatenation cDNA sequencing."
      Yu W., Andersson B., Worley K.C., Muzny D.M., Ding Y., Liu W., Ricafrente J.Y., Wentland M.A., Lennon G., Gibbs R.A.
      Genome Res. 7:353-358(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 125-276 (ISOFORM 1).
      Tissue: Brain.
    7. "Physical interaction and functional coupling between ACDP4 and the intracellular ion chaperone COX11, an implication of the role of ACDP4 in essential metal ion transport and homeostasis."
      Guo D., Ling J., Wang M.-H., She J.-X., Gu J., Wang C.-Y.
      Mol. Pain 1:15-15(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH CNNM4.

    Entry informationi

    Entry nameiCOX11_HUMAN
    AccessioniPrimary (citable) accession number: Q9Y6N1
    Secondary accession number(s): D3DTY5
    , I3L220, Q6FHB7, Q9BRX0, Q9UME8
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 30, 2000
    Last sequence update: March 1, 2005
    Last modified: October 1, 2014
    This is version 119 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 17
      Human chromosome 17: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3