Q9Y6N1 (COX11_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 109.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Cytochrome c oxidase assembly protein COX11, mitochondrial | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 276 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Exerts its effect at some terminal stage of cytochrome c oxidase synthesis, probably by being involved in the insertion of the copper B into subunit I By similarity. |
| Subunit structure | Interacts with CNNM4/ACDP4. Ref.7 |
| Subcellular location | Mitochondrion inner membrane; Single-pass membrane protein; Intermembrane side Ref.1. |
| Tissue specificity | Ubiquitous. Ref.1 |
| Sequence similarities | Belongs to the COX11/CtaG family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Membrane Mitochondrion Mitochondrion inner membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Transit peptide Transmembrane Transmembrane helix |
| Ligand | Copper |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | respiratory chain complex IV assembly Traceable author statement Ref.1. Source: ProtInc respiratory gaseous exchangeTraceable author statement Ref.1. Source: ProtInc |
| Cellular_component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW mitochondrial inner membraneInferred from electronic annotation. Source: UniProtKB-SubCell mitochondrionTraceable author statement Ref.1. Source: ProtInc |
| Molecular_function | copper ion binding Inferred from electronic annotation. Source: InterPro cytochrome-c oxidase activityTraceable author statement Ref.1. Source: ProtInc electron carrier activityTraceable author statement Ref.1. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9Y6N1-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9Y6N1-2) The sequence of this isoform differs from the canonical sequence as follows: 217-276: CFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPRMIKVDLITLSYTFFEAKEGHKLPVPGYN → ASKLHRVYVLESWHL | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Transit peptide | 1 – ? | Mitochondrion Potential | |||||||
| Chain | ? – 276 | Cytochrome c oxidase assembly protein COX11, mitochondrial | PRO_0000006080 | ||||||
Regions | |||||||||
| Topological domain | ? – 95 | Mitochondrial matrix Potential | |||||||
| Transmembrane | 96 – 114 | 19 | Helical; Potential | ||||||
| Topological domain | 115 – 276 | 162 | Mitochondrial intermembrane Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 217 – 276 | 60 | CFCFE…VPGYN → ASKLHRVYVLESWHL in isoform 2. | VSP_046360 | |||||
| Natural variant | 74 | 1 | P → L. Corresponds to variant rs34080917 [ dbSNP | Ensembl ]. | VAR_048831 | |||||
Experimental info | |||||||||
| Sequence conflict | 187 | 1 | A → V in AAH05895. Ref.5 | ||||||
| Isoform 2: | |||||||||
| Sequence conflict | 223 | 1 | V → G in BI600359. Ref.4 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification and characterization of human cDNAs specific to BCS1, PET112, SCO1, COX15, and COX11, five genes involved in the formation and function of the mitochondrial respiratory chain." Petruzzella V., Tiranti V., Fernandez P., Ianna P., Carrozzo R., Zeviani M. Genomics 54:494-504(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| [2] | "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)." Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [3] | "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage." Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L. Nusbaum C.Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Brain and Hypothalamus. |
| [6] | "Large-scale concatenation cDNA sequencing." Yu W., Andersson B., Worley K.C., Muzny D.M., Ding Y., Liu W., Ricafrente J.Y., Wentland M.A., Lennon G., Gibbs R.A. Genome Res. 7:353-358(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 125-276 (ISOFORM 1). Tissue: Brain. |
| [7] | "Physical interaction and functional coupling between ACDP4 and the intracellular ion chaperone COX11, an implication of the role of ACDP4 in essential metal ion transport and homeostasis." Guo D., Ling J., Wang M.-H., She J.-X., Gu J., Wang C.-Y. Mol. Pain 1:15-15(2005) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH CNNM4. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF044321 mRNA. Translation: AAD08645.1. CR541837 mRNA. Translation: CAG46636.1. AC007485 Genomic DNA. No translation available. AC090824 Genomic DNA. No translation available. CH471109 Genomic DNA. Translation: EAW94548.1. CH471109 Genomic DNA. Translation: EAW94550.1. BC005895 mRNA. Translation: AAH05895.1. BI600359 mRNA. No translation available. U79270 mRNA. Translation: AAB50214.1. |
| IPI | IPI00295394. |
| RefSeq | NP_004366.1. NM_004375.3. |
| UniGene | Hs.591171. |
3D structure databases | |
| ProteinModelPortal | Q9Y6N1. |
| SMR | Q9Y6N1. Positions 145-262. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9Y6N1. 2 interactions. |
| STRING | 9606.ENSP00000299335. |
PTM databases | |
| PhosphoSite | Q9Y6N1. |
Polymorphism databases | |
| DMDM | 60416378. |
Proteomic databases | |
| PaxDb | Q9Y6N1. |
| PRIDE | Q9Y6N1. |
Protocols and materials databases | |
| DNASU | 1353. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000299335; ENSP00000299335; ENSG00000166260. ENST00000572558; ENSP00000459302; ENSG00000166260. ENST00000576370; ENSP00000459901; ENSG00000166260. |
| GeneID | 1353. |
| KEGG | hsa:1353. |
| UCSC | uc010wng.1. human. |
Organism-specific databases | |
| CTD | 1353. |
| GeneCards | GC17M053029. |
| HGNC | HGNC:2261. COX11. |
| HPA | HPA044020. |
| MIM | 603648. gene. |
| neXtProt | NX_Q9Y6N1. |
| PharmGKB | PA26777. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG3175. |
| HOGENOM | HOG000264965. |
| HOVERGEN | HBG051085. |
| InParanoid | Q9Y6N1. |
| KO | K02258. |
| OMA | CEITGIN. |
| OrthoDB | EOG4MGS7W. |
| PhylomeDB | Q9Y6N1. |
Gene expression databases | |
| ArrayExpress | Q9Y6N1. |
| Bgee | Q9Y6N1. |
| CleanEx | HS_COX11. |
| Genevestigator | Q9Y6N1. |
| GermOnline | ENSG00000166260. Homo sapiens. |
Family and domain databases | |
| Gene3D | 2.60.370.10. 1 hit. |
| InterPro | IPR023471. CtaG/Cox11_dom. IPR007533. Cyt_c_oxidase_assmbl_CtaG. [Graphical view] |
| PANTHER | PTHR21320. PTHR21320. 1 hit. |
| Pfam | PF04442. CtaG_Cox11. 1 hit. [Graphical view] |
| SUPFAM | SSF110111. CtaG_Cox11. 1 hit. |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 1353. |
| NextBio | 5483. |
| SOURCE | Search... |
Entry information
| Entry name | COX11_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9Y6N1 Secondary accession number(s): D3DTY5 Q9UME8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 17 Human chromosome 17: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
