Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9Y6N1 (COX11_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 118. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Cytochrome c oxidase assembly protein COX11, mitochondrial
Gene names
Name:COX11
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length276 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Exerts its effect at some terminal stage of cytochrome c oxidase synthesis, probably by being involved in the insertion of the copper B into subunit I By similarity. HAMAP-Rule MF_00155

Subunit structure

Interacts with CNNM4/ACDP4. Ref.7

Subcellular location

Mitochondrion inner membrane; Single-pass membrane protein; Intermembrane side Ref.1.

Tissue specificity

Ubiquitous. Ref.1

Sequence similarities

Belongs to the COX11/CtaG family.

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9Y6N1-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9Y6N1-2)

The sequence of this isoform differs from the canonical sequence as follows:
     217-276: CFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPRMIKVDLITLSYTFFEAKEGHKLPVPGYN → ASKLHRVYVLESWHL
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Transit peptide1 – ?Mitochondrion Potential
Chain? – 276Cytochrome c oxidase assembly protein COX11, mitochondrial HAMAP-Rule MF_00155PRO_0000006080

Regions

Topological domain? – 95Mitochondrial matrix Potential
Transmembrane96 – 11419Helical; Potential
Topological domain115 – 276162Mitochondrial intermembrane Potential

Natural variations

Alternative sequence217 – 27660CFCFE…VPGYN → ASKLHRVYVLESWHL in isoform 2.
VSP_046360
Natural variant741P → L.
Corresponds to variant rs34080917 [ dbSNP | Ensembl ].
VAR_048831

Experimental info

Sequence conflict1871A → V in AAH05895. Ref.5
Isoform 2:
Sequence conflict2231V → G in BI600359. Ref.4

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified March 1, 2005. Version 3.
Checksum: 1F2BD22E1E7DD52D

FASTA27631,430
        10         20         30         40         50         60 
MGGLWRPGWR CVPFCGWRWI HPGSPTRAAE RVEPFLRPEW SGTGGAERGL RWLGTWKRCS 

        70         80         90        100        110        120 
LRARHPALQP PRRPKSSNPF TRAQEEERRR QNKTTLTYVA AVAVGMLGAS YAAVPLYRLY 

       130        140        150        160        170        180 
CQTTGLGGSA VAGHASDKIE NMVPVKDRII KISFNADVHA SLQWNFRPQQ TEIYVVPGET 

       190        200        210        220        230        240 
ALAFYRAKNP TDKPVIGIST YNIVPFEAGQ YFNKIQCFCF EEQRLNPQEE VDMPVFFYID 

       250        260        270 
PEFAEDPRMI KVDLITLSYT FFEAKEGHKL PVPGYN 

« Hide

Isoform 2 [UniParc].

Checksum: 3A8BC28441A3D78B
Show »

FASTA23126,133

References

« Hide 'large scale' references
[1]"Identification and characterization of human cDNAs specific to BCS1, PET112, SCO1, COX15, and COX11, five genes involved in the formation and function of the mitochondrial respiratory chain."
Petruzzella V., Tiranti V., Fernandez P., Ianna P., Carrozzo R., Zeviani M.
Genomics 54:494-504(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
[2]"Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
[3]"DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L. expand/collapse author list , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
Tissue: Brain and Hypothalamus.
[6]"Large-scale concatenation cDNA sequencing."
Yu W., Andersson B., Worley K.C., Muzny D.M., Ding Y., Liu W., Ricafrente J.Y., Wentland M.A., Lennon G., Gibbs R.A.
Genome Res. 7:353-358(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 125-276 (ISOFORM 1).
Tissue: Brain.
[7]"Physical interaction and functional coupling between ACDP4 and the intracellular ion chaperone COX11, an implication of the role of ACDP4 in essential metal ion transport and homeostasis."
Guo D., Ling J., Wang M.-H., She J.-X., Gu J., Wang C.-Y.
Mol. Pain 1:15-15(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH CNNM4.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF044321 mRNA. Translation: AAD08645.1.
CR541837 mRNA. Translation: CAG46636.1.
AC007485 Genomic DNA. No translation available.
AC090824 Genomic DNA. No translation available.
CH471109 Genomic DNA. Translation: EAW94548.1.
CH471109 Genomic DNA. Translation: EAW94550.1.
BC005895 mRNA. Translation: AAH05895.1.
BI600359 mRNA. No translation available.
U79270 mRNA. Translation: AAB50214.1.
CCDSCCDS11583.1. [Q9Y6N1-1]
CCDS58579.1. [Q9Y6N1-2]
RefSeqNP_004366.1. NM_004375.3. [Q9Y6N1-1]
XP_006721767.1. XM_006721704.1. [Q9Y6N1-1]
XP_006721768.1. XM_006721705.1. [Q9Y6N1-1]
UniGeneHs.591171.

3D structure databases

ProteinModelPortalQ9Y6N1.
SMRQ9Y6N1. Positions 145-262.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid107746. 2 interactions.
IntActQ9Y6N1. 3 interactions.
STRING9606.ENSP00000299335.

PTM databases

PhosphoSiteQ9Y6N1.

Polymorphism databases

DMDM60416378.

Proteomic databases

MaxQBQ9Y6N1.
PaxDbQ9Y6N1.
PRIDEQ9Y6N1.

Protocols and materials databases

DNASU1353.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000299335; ENSP00000299335; ENSG00000166260. [Q9Y6N1-1]
ENST00000572558; ENSP00000459302; ENSG00000166260. [Q9Y6N1-2]
ENST00000576370; ENSP00000459901; ENSG00000166260. [Q9Y6N1-1]
GeneID1353.
KEGGhsa:1353.
UCSCuc010wng.1. human. [Q9Y6N1-1]

Organism-specific databases

CTD1353.
GeneCardsGC17M053029.
HGNCHGNC:2261. COX11.
HPAHPA044020.
MIM603648. gene.
neXtProtNX_Q9Y6N1.
PharmGKBPA26777.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG3175.
HOGENOMHOG000264965.
HOVERGENHBG051085.
InParanoidQ9Y6N1.
KOK02258.
OMAMARVDTI.
OrthoDBEOG7JMGFB.
PhylomeDBQ9Y6N1.
TreeFamTF105072.

Gene expression databases

ArrayExpressQ9Y6N1.
BgeeQ9Y6N1.
CleanExHS_COX11.
GenevestigatorQ9Y6N1.

Family and domain databases

Gene3D2.60.370.10. 1 hit.
HAMAPMF_00155. CtaG.
InterProIPR023471. CtaG/Cox11_dom.
IPR007533. Cyt_c_oxidase_assmbl_CtaG.
[Graphical view]
PANTHERPTHR21320. PTHR21320. 1 hit.
PfamPF04442. CtaG_Cox11. 1 hit.
[Graphical view]
SUPFAMSSF110111. SSF110111. 1 hit.
ProtoNetSearch...

Other

GenomeRNAi1353.
NextBio5483.
PROQ9Y6N1.
SOURCESearch...

Entry information

Entry nameCOX11_HUMAN
AccessionPrimary (citable) accession number: Q9Y6N1
Secondary accession number(s): D3DTY5 expand/collapse secondary AC list , I3L220, Q6FHB7, Q9BRX0, Q9UME8
Entry history
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: March 1, 2005
Last modified: July 9, 2014
This is version 118 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 17

Human chromosome 17: entries, gene names and cross-references to MIM