Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9Y6M7

- S4A7_HUMAN

UniProt

Q9Y6M7 - S4A7_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Sodium bicarbonate cotransporter 3

Gene

SLC4A7

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Electroneutral sodium- and bicarbonate-dependent cotransporter with a Na+:HCO3- 1:1 stoichiometry. Regulates intracellular pH and may play a role in bicarbonate salvage in secretory epithelia. May also have an associated sodium channel activity.2 Publications

Enzyme regulationi

Transporter activity is regulated by CA2/carbonic anhydrase 2, cAMP and PKA. Insensitive to stilbene derivatives. PubMed:10347222 states it is inhibited by 5-(N-ethyl-N-isopropyl)-amiloride (EIPA).

Kineticsi

  1. KM=24 mM for external sodium1 Publication

GO - Molecular functioni

  1. inorganic anion exchanger activity Source: InterPro
  2. sodium:bicarbonate symporter activity Source: UniProtKB

GO - Biological processi

  1. auditory receptor cell development Source: Ensembl
  2. bicarbonate transport Source: UniProtKB
  3. cochlear nucleus development Source: Ensembl
  4. ion transport Source: Reactome
  5. retinal cell programmed cell death Source: Ensembl
  6. retina vasculature morphogenesis in camera-type eye Source: Ensembl
  7. sodium ion transmembrane transport Source: GOC
  8. transmembrane transport Source: Reactome
Complete GO annotation...

Keywords - Biological processi

Ion transport, Sodium transport, Symport, Transport

Keywords - Ligandi

Sodium

Enzyme and pathway databases

ReactomeiREACT_19298. Bicarbonate transporters.

Protein family/group databases

TCDBi2.A.31.2.11. the anion exchanger (ae) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Sodium bicarbonate cotransporter 3
Alternative name(s):
Electroneutral Na/HCO(3) cotransporter
Sodium bicarbonate cotransporter 2
Sodium bicarbonate cotransporter 2b
Short name:
Bicarbonate transporter
Solute carrier family 4 member 7
Gene namesi
Name:SLC4A7
Synonyms:BT, NBC2, NBC2B, NBC3, NBCn1, SBC2, SLC4A6
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 3

Organism-specific databases

HGNCiHGNC:11033. SLC4A7.

Subcellular locationi

Basolateral cell membrane; Multi-pass membrane protein. Apical cell membrane By similarity; Multi-pass membrane protein By similarity. Cell projectionstereocilium By similarity
Note: Also described at the apical cell membrane. Localizes to the stereocilia of cochlear outer hair cells and to the lateral membrane of cochlear inner hair cells (By similarity).By similarity

GO - Cellular componenti

  1. apical plasma membrane Source: Ensembl
  2. cell projection Source: UniProtKB-KW
  3. integral component of membrane Source: UniProtKB
  4. plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cell projection, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi1135 – 11362DD → NN: Loss of interaction with CA2. Loss of regulation by CA2. 1 Publication
Mutagenesisi1163 – 11653DDD → NNN: No effect on interaction with CA2. No effect on regulation by CA2. 1 Publication
Mutagenesisi1214 – 12141L → G: Loss of interaction with ATP6V1B1. 1 Publication

Organism-specific databases

PharmGKBiPA35899.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 12141214Sodium bicarbonate cotransporter 3PRO_0000079233Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei52 – 521PhosphoserineBy similarity
Glycosylationi171 – 1711N-linked (GlcNAc...)Sequence Analysis
Modified residuei233 – 2331PhosphoserineBy similarity
Modified residuei242 – 2421Phosphoserine1 Publication
Glycosylationi269 – 2691N-linked (GlcNAc...)Sequence Analysis
Glycosylationi398 – 3981N-linked (GlcNAc...)Sequence Analysis
Modified residuei403 – 4031Phosphoserine2 Publications
Glycosylationi406 – 4061N-linked (GlcNAc...)Sequence Analysis
Modified residuei407 – 4071PhosphoserineBy similarity
Glycosylationi776 – 7761N-linked (GlcNAc...)1 Publication
Glycosylationi786 – 7861N-linked (GlcNAc...)1 Publication
Glycosylationi791 – 7911N-linked (GlcNAc...)1 Publication
Modified residuei1167 – 11671Phosphothreonine2 Publications
Modified residuei1176 – 11761Phosphoserine3 Publications
Modified residuei1213 – 12131Phosphoserine1 Publication

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

MaxQBiQ9Y6M7.
PaxDbiQ9Y6M7.
PRIDEiQ9Y6M7.

PTM databases

PhosphoSiteiQ9Y6M7.

Expressioni

Tissue specificityi

Highly expressed in testis and spleen. Also expressed in retina, colon, small intestine, ovary, thymus, prostate, muscle, heart and kidney. Isoform 1 is expressed in skeletal muscle and heart muscle.1 Publication

Gene expression databases

BgeeiQ9Y6M7.
CleanExiHS_SLC4A7.
ExpressionAtlasiQ9Y6M7. baseline and differential.
GenevestigatoriQ9Y6M7.

Organism-specific databases

HPAiCAB022494.
HPA035857.

Interactioni

Subunit structurei

Interacts with CFTR through SLC9A3R1/EBP50. Interacts with USH1C. Forms a complex with ATP6V1B1 and SLC9A3R1/EBP50. Interacts in a pH dependent-manner with CA2/carbonic anhydrase 2.4 Publications

Protein-protein interaction databases

BioGridi114876. 10 interactions.
MINTiMINT-1632023.
STRINGi9606.ENSP00000295736.

Structurei

3D structure databases

ProteinModelPortaliQ9Y6M7.
SMRiQ9Y6M7. Positions 112-221, 418-526, 592-632.
ModBaseiSearch...
MobiDBiSearch...

Topological domain

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 608608ExtracellularSequence AnalysisAdd
BLAST
Topological domaini630 – 6378CytoplasmicSequence Analysis
Topological domaini659 – 69537ExtracellularSequence AnalysisAdd
BLAST
Topological domaini717 – 7259CytoplasmicSequence Analysis
Topological domaini747 – 81771ExtracellularSequence AnalysisAdd
BLAST
Topological domaini839 – 86123CytoplasmicSequence AnalysisAdd
BLAST
Topological domaini883 – 90826ExtracellularSequence AnalysisAdd
BLAST
Topological domaini930 – 95425CytoplasmicSequence AnalysisAdd
BLAST
Topological domaini976 – 101136ExtracellularSequence AnalysisAdd
BLAST
Topological domaini1033 – 10342CytoplasmicSequence Analysis
Topological domaini1056 – 109237ExtracellularSequence AnalysisAdd
BLAST
Topological domaini1114 – 1214101CytoplasmicSequence AnalysisAdd
BLAST

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei609 – 62921HelicalSequence AnalysisAdd
BLAST
Transmembranei638 – 65821HelicalSequence AnalysisAdd
BLAST
Transmembranei696 – 71621HelicalSequence AnalysisAdd
BLAST
Transmembranei726 – 74621HelicalSequence AnalysisAdd
BLAST
Transmembranei818 – 83821HelicalSequence AnalysisAdd
BLAST
Transmembranei862 – 88221HelicalSequence AnalysisAdd
BLAST
Transmembranei909 – 92921HelicalSequence AnalysisAdd
BLAST
Transmembranei955 – 97521HelicalSequence AnalysisAdd
BLAST
Transmembranei1012 – 103221HelicalSequence AnalysisAdd
BLAST
Transmembranei1035 – 105521HelicalSequence AnalysisAdd
BLAST
Transmembranei1093 – 111321HelicalSequence AnalysisAdd
BLAST

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1134 – 11363CA2-binding

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi1211 – 12144PDZ-binding

Domaini

The PDZ-binding motif mediates interaction with the CFTR, SLC9A3R1/EBP50 complex and probably with USH1C.1 Publication

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG268067.
GeneTreeiENSGT00760000119021.
HOGENOMiHOG000280684.
HOVERGENiHBG004326.
InParanoidiQ9Y6M7.
KOiK13858.
OMAiETYAFNM.
PhylomeDBiQ9Y6M7.
TreeFamiTF313630.

Family and domain databases

Gene3Di3.40.1100.10. 2 hits.
InterProiIPR013769. Band3_cytoplasmic_dom.
IPR011531. HCO3_transpt_C.
IPR003020. HCO3_transpt_euk.
IPR016152. PTrfase/Anion_transptr.
[Graphical view]
PANTHERiPTHR11453. PTHR11453. 1 hit.
PfamiPF07565. Band_3_cyto. 1 hit.
PF00955. HCO3_cotransp. 1 hit.
[Graphical view]
PRINTSiPR01231. HCO3TRNSPORT.
SUPFAMiSSF55804. SSF55804. 2 hits.
TIGRFAMsiTIGR00834. ae. 1 hit.

Sequences (14)i

Sequence statusi: Complete.

This entry describes 14 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9Y6M7) [UniParc]FASTAAdd to Basket

Also known as: mNBC3, NBCn1-A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MERFRLEKKL PGPDEEAVVD LGKTSSTVNT KFEKEELESH RAVYIGVHVP
60 70 80 90 100
FSKESRRRHR HRGHKHHHRR RKDKESDKED GRESPSYDTP SQRVQFILGT
110 120 130 140 150
EDDDEEHIPH DLFTEMDELC YRDGEEYEWK ETARWLKFEE DVEDGGDRWS
160 170 180 190 200
KPYVATLSLH SLFELRSCIL NGTVMLDMRA STLDEIADMV LDNMIASGQL
210 220 230 240 250
DESIRENVRE ALLKRHHHQN EKRFTSRIPL VRSFADIGKK HSDPHLLERN
260 270 280 290 300
GEGLSASRHS LRTGLSASNL SLRGESPLSL LLGHLLPSSR AGTPAGSRCT
310 320 330 340 350
TPVPTPQNSP PSSPSISRLT SRSSQESQRQ APELLVSPAS DDIPTVVIHP
360 370 380 390 400
PEEDLEAALK GEEQKNEENV DLTPGILASP QSAPGNLDNS KSGEIKGNGS
410 420 430 440 450
GGSRENSTVD FSKVDMNFMR KIPTGAEASN VLVGEVDFLE RPIIAFVRLA
460 470 480 490 500
PAVLLTGLTE VPVPTRFLFL LLGPAGKAPQ YHEIGRSIAT LMTDEIFHDV
510 520 530 540 550
AYKAKDRNDL LSGIDEFLDQ VTVLPPGEWD PSIRIEPPKS VPSQEKRKIP
560 570 580 590 600
VFHNGSTPTL GETPKEAAHH AGPELQRTGR LFGGLILDIK RKAPFFLSDF
610 620 630 640 650
KDALSLQCLA SILFLYCACM SPVITFGGLL GEATEGRISA IESLFGASLT
660 670 680 690 700
GIAYSLFAGQ PLTILGSTGP VLVFEKILYK FCRDYQLSYL SLRTSIGLWT
710 720 730 740 750
SFLCIVLVAT DASSLVCYIT RFTEEAFAAL ICIIFIYEAL EKLFDLGETY
760 770 780 790 800
AFNMHNNLDK LTSYSCVCTE PPNPSNETLA QWKKDNITAH NISWRNLTVS
810 820 830 840 850
ECKKLRGVFL GSACGHHGPY IPDVLFWCVI LFFTTFFLSS FLKQFKTKRY
860 870 880 890 900
FPTKVRSTIS DFAVFLTIVI MVTIDYLVGV PSPKLHVPEK FEPTHPERGW
910 920 930 940 950
IISPLGDNPW WTLLIAAIPA LLCTILIFMD QQITAVIINR KEHKLKKGAG
960 970 980 990 1000
YHLDLLMVGV MLGVCSVMGL PWFVAATVLS ISHVNSLKVE SECSAPGEQP
1010 1020 1030 1040 1050
KFLGIREQRV TGLMIFILMG LSVFMTSVLK FIPMPVLYGV FLYMGVSSLK
1060 1070 1080 1090 1100
GIQLFDRIKL FGMPAKHQPD LIYLRYVPLW KVHIFTVIQL TCLVLLWVIK
1110 1120 1130 1140 1150
VSAAAVVFPM MVLALVFVRK LMDLCFTKRE LSWLDDLMPE SKKKKEDDKK
1160 1170 1180 1190 1200
KKEKEEAERM LQDDDDTVHL PFEGGSLLQI PVKALKYSPD KPVSVKISFE
1210
DEPRKKYVDA ETSL
Length:1,214
Mass (Da):136,044
Last modified:May 5, 2009 - v2
Checksum:i7B4ADA1E3F26813C
GO
Isoform 2 (identifier: Q9Y6M7-2) [UniParc]FASTAAdd to Basket

Also known as: NBCn1-F

The sequence of this isoform differs from the canonical sequence as follows:
     251-374: Missing.

Note: Contains a phosphoserine at position 258. Contains a phosphoserine at position 255.

Show »
Length:1,090
Mass (Da):123,081
Checksum:i541839CC9B565896
GO
Isoform 3 (identifier: Q9Y6M7-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-90: Missing.
     91-118: SQRVQFILGTEDDDEEHIPHDLFTEMDE → MAVTQFIHFREEIMGNMFFIIIFSTKDK
     251-374: Missing.
     1189-1214: PDKPVSVKISFEDEPRKKYVDAETSL → GDPSIGNISDEMAKTAQWKALSMNTENAKVTRSNMSPDKPVSVK

Note: Contains a phosphoserine at position 168. Contains a phosphoserine at position 1010. Contains a phosphoserine at position 1016. Contains a phosphoserine at position 165. Contains a phosphoserine at position 1007.

Show »
Length:1,018
Mass (Da):114,205
Checksum:iA37799D93A1E30BC
GO
Isoform 4 (identifier: Q9Y6M7-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-90: Missing.
     91-118: SQRVQFILGTEDDDEEHIPHDLFTEMDE → MAVTQFIHFREEIMGNMFFIIIFSTKDK
     251-374: Missing.

Note: Contains a phosphoserine at position 168. Contains a phosphoserine at position 165.

Show »
Length:1,000
Mass (Da):112,448
Checksum:i50FAA40A31468223
GO
Isoform 5 (identifier: Q9Y6M7-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-450: Missing.
     451-465: PAVLLTGLTEVPVPT → MEVVEAEKIVLLTSA
     1188-1188: S → SVDPSIVNISDEMAKTAQWKALSMNTENAKVTRSNMS

Note: No experimental confirmation available. Contains a phosphoserine at position 774. Contains a phosphoserine at position 780. Contains a phosphoserine at position 742. Contains a phosphoserine at position 771.

Show »
Length:800
Mass (Da):89,745
Checksum:iD7FB5D3479BB0935
GO
Isoform 6 (identifier: Q9Y6M7-6) [UniParc]FASTAAdd to Basket

Also known as: NBCn1-G

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: MERFRLEKKLP → MEADGAGEQMRPLLTR
     251-374: Missing.
     1188-1188: S → SVDPSIVNISDEMAKTAQWKALSMNTENAKVTRSNMS

Note: Contains a phosphoserine at position 263. Contains a phosphoserine at position 1105. Contains a phosphoserine at position 1111. Contains a phosphoserine at position 1073. Contains a phosphoserine at position 260. Contains a phosphoserine at position 1102.

Show »
Length:1,131
Mass (Da):127,359
Checksum:iD3DC49DE4DD7F133
GO
Isoform 7 (identifier: Q9Y6M7-7) [UniParc]FASTAAdd to Basket

Also known as: NBCn1-D

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: MERFRLEKKLP → MEADGAGEQMRPLLTRVTSR
     1188-1188: S → SVDPSIVNISDEMAKTAQWKALSMNTENAKVTRSNMS

Note: Contains a phosphoserine at position 1233. Contains a phosphoserine at position 1239. Contains a phosphoserine at position 1201. Contains a phosphoserine at position 1230.

Show »
Length:1,259
Mass (Da):140,766
Checksum:iDDE8C01EB6C6E00F
GO
Isoform 8 (identifier: Q9Y6M7-8) [UniParc]FASTAAdd to Basket

Also known as: NBCn1-C

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: MERFRLEKKLP → MEADGAGEQMRPLLTRVTSR
     238-250: Missing.
     1188-1188: S → SVDPSIVNISDEMAKTAQWKALSMNTENAKVTRSNMS

Note: Contains a phosphoserine at position 1220. Contains a phosphoserine at position 1226. Contains a phosphoserine at position 1188. Contains a phosphoserine at position 1217.

Show »
Length:1,246
Mass (Da):139,254
Checksum:iDEA67883267065E6
GO
Isoform 9 (identifier: Q9Y6M7-9) [UniParc]FASTAAdd to Basket

Also known as: NBCn1-E

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: MERFRLEKKLP → MEADGAGEQMRPLLTR
     251-374: Missing.

Note: Contains a phosphoserine at position 263. Contains a phosphoserine at position 260.

Show »
Length:1,095
Mass (Da):123,409
Checksum:iA3CD8C2972A7DFB3
GO
Isoform 10 (identifier: Q9Y6M7-10) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: MERFRLEKKLP → MEADGAGEQMRPLLTR
     238-250: Missing.
     581-582: LF → VQ
     583-1214: Missing.

Show »
Length:574
Mass (Da):63,699
Checksum:i57ECD93FDB48A158
GO
Isoform 11 (identifier: Q9Y6M7-11) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: MERFRLEKKLP → MEADGAGEQMRPLLTR
     251-374: Missing.
     581-582: LF → VQ
     583-1214: Missing.

Note: Contains a phosphoserine at position 263. Contains a phosphoserine at position 260.

Show »
Length:463
Mass (Da):52,249
Checksum:iBFD9ACB2B9362149
GO
Isoform 12 (identifier: Q9Y6M7-12) [UniParc]FASTAAdd to Basket

Also known as: NBCn1-H

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: MERFRLEKKLP → MEADGAGEQMRPLLTR
     238-250: Missing.

Show »
Length:1,206
Mass (Da):134,860
Checksum:i8A29DF5AD5ECE7E6
GO
Isoform 13 (identifier: Q9Y6M7-13) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: MERFRLEKKLP → MEADGAGEQMRPLLTRVTSR
     251-374: Missing.
     1188-1188: S → SVDPSIVNISDEMAKTAQWKALSMNTENAKVTRSNMS

Note: Contains a phosphoserine at position 267. Contains a phosphoserine at position 1109. Contains a phosphoserine at position 1115. Contains a phosphoserine at position 1077. Contains a phosphoserine at position 264. Contains a phosphoserine at position 1106.

Show »
Length:1,135
Mass (Da):127,803
Checksum:i77E065DA75256869
GO
Isoform 14 (identifier: Q9Y6M7-14) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: MERFRLEKKLP → MEADGAGEQMRPLLTRVTSR
     251-374: Missing.
     581-582: LF → VQ
     583-1214: Missing.

Note: Contains a phosphoserine at position 267. Contains a phosphoserine at position 264.

Show »
Length:467
Mass (Da):52,692
Checksum:i80F478ACDCBA905A
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti326 – 3261E → K.2 Publications
Corresponds to variant rs3755652 [ dbSNP | Ensembl ].
VAR_055317

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 450450Missing in isoform 5. 1 PublicationVSP_047838Add
BLAST
Alternative sequencei1 – 9090Missing in isoform 3 and isoform 4. 2 PublicationsVSP_047839Add
BLAST
Alternative sequencei1 – 1111MERFRLEKKLP → MEADGAGEQMRPLLTR in isoform 6, isoform 9, isoform 10, isoform 11 and isoform 12. 1 PublicationVSP_047840Add
BLAST
Alternative sequencei1 – 1111MERFRLEKKLP → MEADGAGEQMRPLLTRVTSR in isoform 7, isoform 8, isoform 13 and isoform 14. 2 PublicationsVSP_047841Add
BLAST
Alternative sequencei91 – 11828SQRVQ…TEMDE → MAVTQFIHFREEIMGNMFFI IIFSTKDK in isoform 3 and isoform 4. 2 PublicationsVSP_047842Add
BLAST
Alternative sequencei238 – 25013Missing in isoform 8, isoform 10 and isoform 12. 1 PublicationVSP_047843Add
BLAST
Alternative sequencei251 – 374124Missing in isoform 2, isoform 3, isoform 4, isoform 6, isoform 9, isoform 11, isoform 13 and isoform 14. 5 PublicationsVSP_047844Add
BLAST
Alternative sequencei451 – 46515PAVLL…VPVPT → MEVVEAEKIVLLTSA in isoform 5. 1 PublicationVSP_047845Add
BLAST
Alternative sequencei581 – 5822LF → VQ in isoform 10, isoform 11 and isoform 14. 2 PublicationsVSP_047846
Alternative sequencei583 – 1214632Missing in isoform 10, isoform 11 and isoform 14. 2 PublicationsVSP_047847Add
BLAST
Alternative sequencei1188 – 11881S → SVDPSIVNISDEMAKTAQWK ALSMNTENAKVTRSNMS in isoform 5, isoform 6, isoform 7, isoform 8 and isoform 13. 3 PublicationsVSP_047848
Alternative sequencei1189 – 121426PDKPV…AETSL → GDPSIGNISDEMAKTAQWKA LSMNTENAKVTRSNMSPDKP VSVK in isoform 3. 1 PublicationVSP_047849Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB012130 mRNA. Translation: BAA25898.1.
AF047033 mRNA. Translation: AAD38322.1.
AF089726 mRNA. Translation: AAG16773.1.
AF053755 mRNA. Translation: AAF21720.1.
EU499349 mRNA. Translation: ACB47400.1.
EU934246 mRNA. Translation: ACH61958.1.
EU934248 mRNA. Translation: ACH61960.1.
EU934249 mRNA. Translation: ACH61961.1.
EU934250 mRNA. Translation: ACH61962.1.
FJ178574 mRNA. Translation: ACI24740.1.
FJ178575 mRNA. Translation: ACI24741.1.
FJ178576 mRNA. Translation: ACI24742.1.
GU354307 mRNA. Translation: ADC32649.1.
GU354308 mRNA. Translation: ADC32650.1.
GU354309 mRNA. Translation: ADC32651.1.
GU354310 mRNA. Translation: ADC32652.1.
CR627428 mRNA. Translation: CAH10515.1.
AC099535 Genomic DNA. No translation available.
CH471055 Genomic DNA. Translation: EAW64382.1.
CCDSiCCDS33721.1. [Q9Y6M7-1]
CCDS58819.1. [Q9Y6M7-2]
CCDS58820.1. [Q9Y6M7-6]
PIRiJE0160.
RefSeqiNP_001245308.1. NM_001258379.1. [Q9Y6M7-6]
NP_001245309.1. NM_001258380.1. [Q9Y6M7-2]
NP_003606.3. NM_003615.4. [Q9Y6M7-1]
XP_005265658.1. XM_005265601.1. [Q9Y6M7-9]
UniGeneiHs.250072.

Genome annotation databases

EnsembliENST00000295736; ENSP00000295736; ENSG00000033867. [Q9Y6M7-1]
ENST00000428386; ENSP00000416368; ENSG00000033867. [Q9Y6M7-2]
ENST00000437179; ENSP00000394252; ENSG00000033867. [Q9Y6M7-9]
ENST00000437266; ENSP00000409418; ENSG00000033867. [Q9Y6M7-11]
ENST00000438530; ENSP00000407304; ENSG00000033867. [Q9Y6M7-10]
ENST00000440156; ENSP00000414797; ENSG00000033867. [Q9Y6M7-8]
ENST00000446700; ENSP00000406605; ENSG00000033867. [Q9Y6M7-12]
ENST00000454389; ENSP00000390394; ENSG00000033867. [Q9Y6M7-7]
ENST00000455077; ENSP00000407382; ENSG00000033867. [Q9Y6M7-6]
ENST00000457377; ENSP00000408323; ENSG00000033867. [Q9Y6M7-11]
GeneIDi9497.
KEGGihsa:9497.
UCSCiuc003cdu.5. human.
uc003cdv.4. human. [Q9Y6M7-1]
uc003cdw.4. human. [Q9Y6M7-2]
uc010hfm.3. human.
uc011awx.3. human.
uc011axa.3. human.
uc021wun.2. human.

Polymorphism databases

DMDMi229462789.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB012130 mRNA. Translation: BAA25898.1 .
AF047033 mRNA. Translation: AAD38322.1 .
AF089726 mRNA. Translation: AAG16773.1 .
AF053755 mRNA. Translation: AAF21720.1 .
EU499349 mRNA. Translation: ACB47400.1 .
EU934246 mRNA. Translation: ACH61958.1 .
EU934248 mRNA. Translation: ACH61960.1 .
EU934249 mRNA. Translation: ACH61961.1 .
EU934250 mRNA. Translation: ACH61962.1 .
FJ178574 mRNA. Translation: ACI24740.1 .
FJ178575 mRNA. Translation: ACI24741.1 .
FJ178576 mRNA. Translation: ACI24742.1 .
GU354307 mRNA. Translation: ADC32649.1 .
GU354308 mRNA. Translation: ADC32650.1 .
GU354309 mRNA. Translation: ADC32651.1 .
GU354310 mRNA. Translation: ADC32652.1 .
CR627428 mRNA. Translation: CAH10515.1 .
AC099535 Genomic DNA. No translation available.
CH471055 Genomic DNA. Translation: EAW64382.1 .
CCDSi CCDS33721.1. [Q9Y6M7-1 ]
CCDS58819.1. [Q9Y6M7-2 ]
CCDS58820.1. [Q9Y6M7-6 ]
PIRi JE0160.
RefSeqi NP_001245308.1. NM_001258379.1. [Q9Y6M7-6 ]
NP_001245309.1. NM_001258380.1. [Q9Y6M7-2 ]
NP_003606.3. NM_003615.4. [Q9Y6M7-1 ]
XP_005265658.1. XM_005265601.1. [Q9Y6M7-9 ]
UniGenei Hs.250072.

3D structure databases

ProteinModelPortali Q9Y6M7.
SMRi Q9Y6M7. Positions 112-221, 418-526, 592-632.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 114876. 10 interactions.
MINTi MINT-1632023.
STRINGi 9606.ENSP00000295736.

Chemistry

DrugBanki DB01390. Sodium bicarbonate.

Protein family/group databases

TCDBi 2.A.31.2.11. the anion exchanger (ae) family.

PTM databases

PhosphoSitei Q9Y6M7.

Polymorphism databases

DMDMi 229462789.

Proteomic databases

MaxQBi Q9Y6M7.
PaxDbi Q9Y6M7.
PRIDEi Q9Y6M7.

Protocols and materials databases

DNASUi 9497.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000295736 ; ENSP00000295736 ; ENSG00000033867 . [Q9Y6M7-1 ]
ENST00000428386 ; ENSP00000416368 ; ENSG00000033867 . [Q9Y6M7-2 ]
ENST00000437179 ; ENSP00000394252 ; ENSG00000033867 . [Q9Y6M7-9 ]
ENST00000437266 ; ENSP00000409418 ; ENSG00000033867 . [Q9Y6M7-11 ]
ENST00000438530 ; ENSP00000407304 ; ENSG00000033867 . [Q9Y6M7-10 ]
ENST00000440156 ; ENSP00000414797 ; ENSG00000033867 . [Q9Y6M7-8 ]
ENST00000446700 ; ENSP00000406605 ; ENSG00000033867 . [Q9Y6M7-12 ]
ENST00000454389 ; ENSP00000390394 ; ENSG00000033867 . [Q9Y6M7-7 ]
ENST00000455077 ; ENSP00000407382 ; ENSG00000033867 . [Q9Y6M7-6 ]
ENST00000457377 ; ENSP00000408323 ; ENSG00000033867 . [Q9Y6M7-11 ]
GeneIDi 9497.
KEGGi hsa:9497.
UCSCi uc003cdu.5. human.
uc003cdv.4. human. [Q9Y6M7-1 ]
uc003cdw.4. human. [Q9Y6M7-2 ]
uc010hfm.3. human.
uc011awx.3. human.
uc011axa.3. human.
uc021wun.2. human.

Organism-specific databases

CTDi 9497.
GeneCardsi GC03M027414.
HGNCi HGNC:11033. SLC4A7.
HPAi CAB022494.
HPA035857.
MIMi 603353. gene.
neXtProti NX_Q9Y6M7.
PharmGKBi PA35899.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG268067.
GeneTreei ENSGT00760000119021.
HOGENOMi HOG000280684.
HOVERGENi HBG004326.
InParanoidi Q9Y6M7.
KOi K13858.
OMAi ETYAFNM.
PhylomeDBi Q9Y6M7.
TreeFami TF313630.

Enzyme and pathway databases

Reactomei REACT_19298. Bicarbonate transporters.

Miscellaneous databases

ChiTaRSi SLC4A7. human.
GeneWikii SLC4A7.
GenomeRNAii 9497.
NextBioi 35478003.
PROi Q9Y6M7.
SOURCEi Search...

Gene expression databases

Bgeei Q9Y6M7.
CleanExi HS_SLC4A7.
ExpressionAtlasi Q9Y6M7. baseline and differential.
Genevestigatori Q9Y6M7.

Family and domain databases

Gene3Di 3.40.1100.10. 2 hits.
InterProi IPR013769. Band3_cytoplasmic_dom.
IPR011531. HCO3_transpt_C.
IPR003020. HCO3_transpt_euk.
IPR016152. PTrfase/Anion_transptr.
[Graphical view ]
PANTHERi PTHR11453. PTHR11453. 1 hit.
Pfami PF07565. Band_3_cyto. 1 hit.
PF00955. HCO3_cotransp. 1 hit.
[Graphical view ]
PRINTSi PR01231. HCO3TRNSPORT.
SUPFAMi SSF55804. SSF55804. 2 hits.
TIGRFAMsi TIGR00834. ae. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular cloning of a new sodium bicarbonate cotransporter cDNA from human retina."
    Ishibashi K., Sasaki S., Marumo F.
    Biochem. Biophys. Res. Commun. 246:535-538(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), TISSUE SPECIFICITY.
    Tissue: Retina.
  2. "Cloning, tissue distribution, genomic organization, and functional characterization of NBC3, a new member of the sodium bicarbonate cotransporter family."
    Pushkin A., Abuladze N., Lee I., Newman D., Hwang J., Kurtz I.
    J. Biol. Chem. 274:16569-16575(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), FUNCTION, BIOPHYSICOCHEMICAL PROPERTIES, REGULATION, VARIANT LYS-326.
    Tissue: Kidney and Skeletal muscle.
  3. "Cloning of a HCO3 transporter, NT2-NBC, from human brain, similar to both the Anion exchangers (AEs) and the Na/Bicarbonate Cotransporters (NBCs)."
    Romero M.F.
    Submitted (MAR-1998) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4).
    Tissue: Neuroepithelium.
  4. "Cloning and identification of novel human NBCn1 splice variants."
    Liu Y., Chen L.-M., Parker M.D., Boron W.F.
    Submitted (JUL-2008) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 6; 7; 8; 9; 10; 11 AND 12), ALTERNATIVE SPLICING, VARIANT LYS-326.
    Tissue: Brain, Heart, Liver and Skeletal muscle.
  5. "Cloning and identification of two novel human NBCn1 splice variants."
    Liu Y., Chen L., Parker M.D., Boron W.F.
    Submitted (DEC-2009) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 13 AND 14).
    Tissue: Brain.
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5).
    Tissue: Cervix.
  7. "The DNA sequence, annotation and analysis of human chromosome 3."
    Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J.
    , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
    Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  9. "The cystic fibrosis transmembrane conductance regulator interacts with and regulates the activity of the HCO3- salvage transporter human Na+-HCO3-cotransport isoform 3."
    Park M., Ko S.B.H., Choi J.Y., Muallem G., Thomas P.J., Pushkin A., Lee M.-S., Kim J.Y., Lee M.G., Muallem S., Kurtz I.
    J. Biol. Chem. 277:50503-50509(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH CFTR AND SLC9A3R1, DOMAIN.
  10. "The COOH termini of NBC3 and the 56-kDa H+-ATPase subunit are PDZ motifs involved in their interaction."
    Pushkin A., Abuladze N., Newman D., Muronets V., Sassani P., Tatishchev S., Kurtz I.
    Am. J. Physiol. 284:C667-C673(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH ATP6V1B1 AND SLC9A3R1, MUTAGENESIS OF LEU-1214.
  11. "Regulation of the human NBC3 Na+/HCO3- cotransporter by carbonic anhydrase II and PKA."
    Loiselle F.B., Morgan P.E., Alvarez B.V., Casey J.R.
    Am. J. Physiol. 286:C1423-C1433(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH CA2, REGULATION, MUTAGENESIS OF 1135-ASP-ASP-1136 AND 1163-ASP--ASP-1165.
  12. "Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry."
    Brill L.M., Salomon A.R., Ficarro S.B., Mukherji M., Stettler-Gill M., Peters E.C.
    Anal. Chem. 76:2763-2772(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  13. "Scaffold protein harmonin (USH1C) provides molecular links between Usher syndrome type 1 and type 2."
    Reiners J., van Wijk E., Maerker T., Zimmermann U., Juergens K., te Brinke H., Overlack N., Roepman R., Knipper M., Kremer H., Wolfrum U.
    Hum. Mol. Genet. 14:3933-3943(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH USH1C.
  14. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
    Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
    Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  15. "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis."
    Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III
    J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-1167 AND SER-1176, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  16. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-403 AND SER-1213, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-263 (ISOFORMS 11; 6 AND 9), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1109 AND SER-1115 (ISOFORM 13), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-267 (ISOFORMS 13 AND 14), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-258 (ISOFORM 2), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1010 AND SER-1016 (ISOFORM 3), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-168 (ISOFORMS 3 AND 4), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-774 AND SER-780 (ISOFORM 5), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1105 AND SER-1111 (ISOFORM 6), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1233 AND SER-1239 (ISOFORM 7), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1220 AND SER-1226 (ISOFORM 8), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  17. "Modular structure of sodium-coupled bicarbonate transporters."
    Boron W.F., Chen L., Parker M.D.
    J. Exp. Biol. 212:1697-1706(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: REVIEW, ALTERNATIVE SPLICING.
  18. "Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins."
    Wollscheid B., Bausch-Fluck D., Henderson C., O'Brien R., Bibel M., Schiess R., Aebersold R., Watts J.D.
    Nat. Biotechnol. 27:378-386(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-776; ASN-786 AND ASN-791.
    Tissue: Leukemic T-cell.
  19. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-1167 AND SER-1176, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-263 (ISOFORMS 11; 6 AND 9), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1077 (ISOFORM 13), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-267 (ISOFORMS 13 AND 14), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-258 (ISOFORM 2), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-168 (ISOFORMS 3 AND 4), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-742 (ISOFORM 5), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1073 (ISOFORM 6), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1201 (ISOFORM 7), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1188 (ISOFORM 8), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  20. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1176, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-260 AND SER-263 (ISOFORMS 11; 6 AND 9), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1106 AND SER-1109 (ISOFORM 13), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-264 AND SER-267 (ISOFORMS 13 AND 14), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-255 AND SER-258 (ISOFORM 2), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1007 AND SER-1010 (ISOFORM 3), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-165 AND SER-168 (ISOFORMS 3 AND 4), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-771 AND SER-774 (ISOFORM 5), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1102 AND SER-1105 (ISOFORM 6), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1230 AND SER-1233 (ISOFORM 7), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1217 AND SER-1220 (ISOFORM 8), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  21. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-242 AND SER-403, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-263 (ISOFORMS 11; 6 AND 9), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1106 (ISOFORM 13), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-267 (ISOFORMS 13 AND 14), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-258 (ISOFORM 2), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1007 (ISOFORM 3), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-168 (ISOFORMS 3 AND 4), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-771 (ISOFORM 5), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1102 (ISOFORM 6), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1230 (ISOFORM 7), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1217 (ISOFORM 8), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiS4A7_HUMAN
AccessioniPrimary (citable) accession number: Q9Y6M7
Secondary accession number(s): A6NIA8
, B2CI53, B5M449, B5M451, B5M452, B5M453, B6DY52, B6DY53, C9JST9, D3K174, D3K175, O60350, Q6AHZ9, Q9HC88, Q9UIB9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 7, 2006
Last sequence update: May 5, 2009
Last modified: October 29, 2014
This is version 118 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3