Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sodium bicarbonate cotransporter 3

Gene

SLC4A7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Electroneutral sodium- and bicarbonate-dependent cotransporter with a Na+:HCO3- 1:1 stoichiometry. Regulates intracellular pH and may play a role in bicarbonate salvage in secretory epithelia. May also have an associated sodium channel activity.2 Publications

Enzyme regulationi

Transporter activity is regulated by CA2/carbonic anhydrase 2, cAMP and PKA. Insensitive to stilbene derivatives. PubMed:10347222 states it is inhibited by 5-(N-ethyl-N-isopropyl)-amiloride (EIPA).

Kineticsi

  1. KM=24 mM for external sodium1 Publication

    GO - Molecular functioni

    • inorganic anion exchanger activity Source: InterPro
    • sodium:bicarbonate symporter activity Source: UniProtKB

    GO - Biological processi

    Complete GO annotation...

    Keywords - Biological processi

    Ion transport, Sodium transport, Symport, Transport

    Keywords - Ligandi

    Sodium

    Enzyme and pathway databases

    ReactomeiREACT_19298. Bicarbonate transporters.

    Protein family/group databases

    TCDBi2.A.31.2.11. the anion exchanger (ae) family.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Sodium bicarbonate cotransporter 3
    Alternative name(s):
    Electroneutral Na/HCO(3) cotransporter
    Sodium bicarbonate cotransporter 2
    Sodium bicarbonate cotransporter 2b
    Short name:
    Bicarbonate transporter
    Solute carrier family 4 member 7
    Gene namesi
    Name:SLC4A7
    Synonyms:BT, NBC2, NBC2B, NBC3, NBCn1, SBC2, SLC4A6
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640 Componenti: Chromosome 3

    Organism-specific databases

    HGNCiHGNC:11033. SLC4A7.

    Subcellular locationi

    Topology

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 608608ExtracellularSequence AnalysisAdd
    BLAST
    Transmembranei609 – 62921HelicalSequence AnalysisAdd
    BLAST
    Topological domaini630 – 6378CytoplasmicSequence Analysis
    Transmembranei638 – 65821HelicalSequence AnalysisAdd
    BLAST
    Topological domaini659 – 69537ExtracellularSequence AnalysisAdd
    BLAST
    Transmembranei696 – 71621HelicalSequence AnalysisAdd
    BLAST
    Topological domaini717 – 7259CytoplasmicSequence Analysis
    Transmembranei726 – 74621HelicalSequence AnalysisAdd
    BLAST
    Topological domaini747 – 81771ExtracellularSequence AnalysisAdd
    BLAST
    Transmembranei818 – 83821HelicalSequence AnalysisAdd
    BLAST
    Topological domaini839 – 86123CytoplasmicSequence AnalysisAdd
    BLAST
    Transmembranei862 – 88221HelicalSequence AnalysisAdd
    BLAST
    Topological domaini883 – 90826ExtracellularSequence AnalysisAdd
    BLAST
    Transmembranei909 – 92921HelicalSequence AnalysisAdd
    BLAST
    Topological domaini930 – 95425CytoplasmicSequence AnalysisAdd
    BLAST
    Transmembranei955 – 97521HelicalSequence AnalysisAdd
    BLAST
    Topological domaini976 – 101136ExtracellularSequence AnalysisAdd
    BLAST
    Transmembranei1012 – 103221HelicalSequence AnalysisAdd
    BLAST
    Topological domaini1033 – 10342CytoplasmicSequence Analysis
    Transmembranei1035 – 105521HelicalSequence AnalysisAdd
    BLAST
    Topological domaini1056 – 109237ExtracellularSequence AnalysisAdd
    BLAST
    Transmembranei1093 – 111321HelicalSequence AnalysisAdd
    BLAST
    Topological domaini1114 – 1214101CytoplasmicSequence AnalysisAdd
    BLAST

    GO - Cellular componenti

    Complete GO annotation...

    Keywords - Cellular componenti

    Cell membrane, Cell projection, Membrane

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi1135 – 11362DD → NN: Loss of interaction with CA2. Loss of regulation by CA2. 1 Publication
    Mutagenesisi1163 – 11653DDD → NNN: No effect on interaction with CA2. No effect on regulation by CA2. 1 Publication
    Mutagenesisi1214 – 12141L → G: Loss of interaction with ATP6V1B1. 1 Publication

    Organism-specific databases

    PharmGKBiPA35899.

    Chemistry

    DrugBankiDB01390. Sodium bicarbonate.

    Polymorphism and mutation databases

    BioMutaiSLC4A7.
    DMDMi229462789.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 12141214Sodium bicarbonate cotransporter 3PRO_0000079233Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei52 – 521PhosphoserineBy similarity
    Glycosylationi171 – 1711N-linked (GlcNAc...)Sequence Analysis
    Modified residuei233 – 2331PhosphoserineBy similarity
    Modified residuei242 – 2421Phosphoserine1 Publication
    Glycosylationi269 – 2691N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi398 – 3981N-linked (GlcNAc...)Sequence Analysis
    Modified residuei403 – 4031Phosphoserine2 Publications
    Glycosylationi406 – 4061N-linked (GlcNAc...)Sequence Analysis
    Modified residuei407 – 4071PhosphoserineBy similarity
    Disulfide bondi766 ↔ 768By similarity
    Glycosylationi776 – 7761N-linked (GlcNAc...)1 Publication
    Glycosylationi786 – 7861N-linked (GlcNAc...)1 Publication
    Glycosylationi791 – 7911N-linked (GlcNAc...)1 Publication
    Disulfide bondi802 ↔ 814By similarity
    Modified residuei1167 – 11671Phosphothreonine2 Publications
    Modified residuei1176 – 11761Phosphoserine3 Publications
    Modified residuei1213 – 12131Phosphoserine1 Publication
    Isoform 3 (identifier: Q9Y6M7-3)
    Modified residuei165 – 1651Phosphoserine4 Publications
    Modified residuei168 – 1681Phosphoserine4 Publications
    Modified residuei1007 – 10071Phosphoserine4 Publications
    Modified residuei1010 – 10101Phosphoserine4 Publications
    Modified residuei1016 – 10161Phosphoserine4 Publications
    Isoform 4 (identifier: Q9Y6M7-4)
    Modified residuei165 – 1651Phosphoserine4 Publications
    Modified residuei168 – 1681Phosphoserine4 Publications
    Isoform 2 (identifier: Q9Y6M7-2)
    Modified residuei255 – 2551Phosphoserine4 Publications
    Modified residuei258 – 2581Phosphoserine4 Publications
    Isoform 6 (identifier: Q9Y6M7-6)
    Modified residuei260 – 2601Phosphoserine4 Publications
    Modified residuei263 – 2631Phosphoserine4 Publications
    Modified residuei1073 – 10731Phosphoserine4 Publications
    Modified residuei1102 – 11021Phosphoserine4 Publications
    Modified residuei1105 – 11051Phosphoserine4 Publications
    Modified residuei1111 – 11111Phosphoserine4 Publications
    Isoform 9 (identifier: Q9Y6M7-9)
    Modified residuei260 – 2601Phosphoserine4 Publications
    Modified residuei263 – 2631Phosphoserine4 Publications
    Isoform 11 (identifier: Q9Y6M7-11)
    Modified residuei260 – 2601Phosphoserine4 Publications
    Modified residuei263 – 2631Phosphoserine4 Publications
    Isoform 13 (identifier: Q9Y6M7-13)
    Modified residuei264 – 2641Phosphoserine4 Publications
    Modified residuei267 – 2671Phosphoserine4 Publications
    Modified residuei1077 – 10771Phosphoserine4 Publications
    Modified residuei1106 – 11061Phosphoserine4 Publications
    Modified residuei1109 – 11091Phosphoserine4 Publications
    Modified residuei1115 – 11151Phosphoserine4 Publications
    Isoform 14 (identifier: Q9Y6M7-14)
    Modified residuei264 – 2641Phosphoserine4 Publications
    Modified residuei267 – 2671Phosphoserine4 Publications
    Isoform 5 (identifier: Q9Y6M7-5)
    Modified residuei742 – 7421Phosphoserine4 Publications
    Modified residuei771 – 7711Phosphoserine4 Publications
    Modified residuei774 – 7741Phosphoserine4 Publications
    Modified residuei780 – 7801Phosphoserine4 Publications
    Isoform 8 (identifier: Q9Y6M7-8)
    Modified residuei1188 – 11881Phosphoserine4 Publications
    Modified residuei1217 – 12171Phosphoserine4 Publications
    Modified residuei1220 – 12201Phosphoserine4 Publications
    Modified residuei1226 – 12261Phosphoserine4 Publications
    Isoform 7 (identifier: Q9Y6M7-7)
    Modified residuei1201 – 12011Phosphoserine4 Publications
    Modified residuei1230 – 12301Phosphoserine4 Publications
    Modified residuei1233 – 12331Phosphoserine4 Publications
    Modified residuei1239 – 12391Phosphoserine4 Publications

    Keywords - PTMi

    Disulfide bond, Glycoprotein, Phosphoprotein

    Proteomic databases

    MaxQBiQ9Y6M7.
    PaxDbiQ9Y6M7.
    PRIDEiQ9Y6M7.

    PTM databases

    PhosphoSiteiQ9Y6M7.

    Expressioni

    Tissue specificityi

    Highly expressed in testis and spleen. Also expressed in retina, colon, small intestine, ovary, thymus, prostate, muscle, heart and kidney. Isoform 1 is expressed in skeletal muscle and heart muscle.1 Publication

    Gene expression databases

    BgeeiQ9Y6M7.
    CleanExiHS_SLC4A7.
    ExpressionAtlasiQ9Y6M7. baseline and differential.
    GenevisibleiQ9Y6M7. HS.

    Organism-specific databases

    HPAiCAB022494.
    HPA035857.

    Interactioni

    Subunit structurei

    Interacts with CFTR through SLC9A3R1/EBP50. Interacts with USH1C. Forms a complex with ATP6V1B1 and SLC9A3R1/EBP50. Interacts in a pH dependent-manner with CA2/carbonic anhydrase 2.4 Publications

    Protein-protein interaction databases

    BioGridi114876. 13 interactions.
    MINTiMINT-1632023.
    STRINGi9606.ENSP00000295736.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9Y6M7.
    SMRiQ9Y6M7. Positions 112-221, 418-526, 592-632.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni1134 – 11363CA2-binding

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi1211 – 12144PDZ-binding

    Domaini

    The PDZ-binding motif mediates interaction with the CFTR, SLC9A3R1/EBP50 complex and probably with USH1C.1 Publication

    Sequence similaritiesi

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG268067.
    GeneTreeiENSGT00760000119021.
    HOGENOMiHOG000280684.
    HOVERGENiHBG004326.
    InParanoidiQ9Y6M7.
    KOiK13858.
    OMAiETYAFNM.
    PhylomeDBiQ9Y6M7.
    TreeFamiTF313630.

    Family and domain databases

    Gene3Di3.40.1100.10. 2 hits.
    InterProiIPR013769. Band3_cytoplasmic_dom.
    IPR011531. HCO3_transpt_C.
    IPR003020. HCO3_transpt_euk.
    IPR016152. PTrfase/Anion_transptr.
    [Graphical view]
    PANTHERiPTHR11453. PTHR11453. 1 hit.
    PfamiPF07565. Band_3_cyto. 1 hit.
    PF00955. HCO3_cotransp. 1 hit.
    [Graphical view]
    PRINTSiPR01231. HCO3TRNSPORT.
    SUPFAMiSSF55804. SSF55804. 2 hits.
    TIGRFAMsiTIGR00834. ae. 1 hit.

    Sequences (14)i

    Sequence statusi: Complete.

    This entry describes 14 isoformsi produced by alternative splicing. AlignAdd to basket

    Isoform 1 (identifier: Q9Y6M7-1) [UniParc]FASTAAdd to basket

    Also known as: mNBC3, NBCn1-A

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

            10         20         30         40         50
    MERFRLEKKL PGPDEEAVVD LGKTSSTVNT KFEKEELESH RAVYIGVHVP
    60 70 80 90 100
    FSKESRRRHR HRGHKHHHRR RKDKESDKED GRESPSYDTP SQRVQFILGT
    110 120 130 140 150
    EDDDEEHIPH DLFTEMDELC YRDGEEYEWK ETARWLKFEE DVEDGGDRWS
    160 170 180 190 200
    KPYVATLSLH SLFELRSCIL NGTVMLDMRA STLDEIADMV LDNMIASGQL
    210 220 230 240 250
    DESIRENVRE ALLKRHHHQN EKRFTSRIPL VRSFADIGKK HSDPHLLERN
    260 270 280 290 300
    GEGLSASRHS LRTGLSASNL SLRGESPLSL LLGHLLPSSR AGTPAGSRCT
    310 320 330 340 350
    TPVPTPQNSP PSSPSISRLT SRSSQESQRQ APELLVSPAS DDIPTVVIHP
    360 370 380 390 400
    PEEDLEAALK GEEQKNEENV DLTPGILASP QSAPGNLDNS KSGEIKGNGS
    410 420 430 440 450
    GGSRENSTVD FSKVDMNFMR KIPTGAEASN VLVGEVDFLE RPIIAFVRLA
    460 470 480 490 500
    PAVLLTGLTE VPVPTRFLFL LLGPAGKAPQ YHEIGRSIAT LMTDEIFHDV
    510 520 530 540 550
    AYKAKDRNDL LSGIDEFLDQ VTVLPPGEWD PSIRIEPPKS VPSQEKRKIP
    560 570 580 590 600
    VFHNGSTPTL GETPKEAAHH AGPELQRTGR LFGGLILDIK RKAPFFLSDF
    610 620 630 640 650
    KDALSLQCLA SILFLYCACM SPVITFGGLL GEATEGRISA IESLFGASLT
    660 670 680 690 700
    GIAYSLFAGQ PLTILGSTGP VLVFEKILYK FCRDYQLSYL SLRTSIGLWT
    710 720 730 740 750
    SFLCIVLVAT DASSLVCYIT RFTEEAFAAL ICIIFIYEAL EKLFDLGETY
    760 770 780 790 800
    AFNMHNNLDK LTSYSCVCTE PPNPSNETLA QWKKDNITAH NISWRNLTVS
    810 820 830 840 850
    ECKKLRGVFL GSACGHHGPY IPDVLFWCVI LFFTTFFLSS FLKQFKTKRY
    860 870 880 890 900
    FPTKVRSTIS DFAVFLTIVI MVTIDYLVGV PSPKLHVPEK FEPTHPERGW
    910 920 930 940 950
    IISPLGDNPW WTLLIAAIPA LLCTILIFMD QQITAVIINR KEHKLKKGAG
    960 970 980 990 1000
    YHLDLLMVGV MLGVCSVMGL PWFVAATVLS ISHVNSLKVE SECSAPGEQP
    1010 1020 1030 1040 1050
    KFLGIREQRV TGLMIFILMG LSVFMTSVLK FIPMPVLYGV FLYMGVSSLK
    1060 1070 1080 1090 1100
    GIQLFDRIKL FGMPAKHQPD LIYLRYVPLW KVHIFTVIQL TCLVLLWVIK
    1110 1120 1130 1140 1150
    VSAAAVVFPM MVLALVFVRK LMDLCFTKRE LSWLDDLMPE SKKKKEDDKK
    1160 1170 1180 1190 1200
    KKEKEEAERM LQDDDDTVHL PFEGGSLLQI PVKALKYSPD KPVSVKISFE
    1210
    DEPRKKYVDA ETSL
    Length:1,214
    Mass (Da):136,044
    Last modified:May 5, 2009 - v2
    Checksum:i7B4ADA1E3F26813C
    GO
    Isoform 2 (identifier: Q9Y6M7-2) [UniParc]FASTAAdd to basket

    Also known as: NBCn1-F

    The sequence of this isoform differs from the canonical sequence as follows:
         251-374: Missing.

    Show »
    Length:1,090
    Mass (Da):123,081
    Checksum:i541839CC9B565896
    GO
    Isoform 3 (identifier: Q9Y6M7-3) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-90: Missing.
         91-118: SQRVQFILGTEDDDEEHIPHDLFTEMDE → MAVTQFIHFREEIMGNMFFIIIFSTKDK
         251-374: Missing.
         1189-1214: PDKPVSVKISFEDEPRKKYVDAETSL → GDPSIGNISDEMAKTAQWKALSMNTENAKVTRSNMSPDKPVSVK

    Show »
    Length:1,018
    Mass (Da):114,205
    Checksum:iA37799D93A1E30BC
    GO
    Isoform 4 (identifier: Q9Y6M7-4) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-90: Missing.
         91-118: SQRVQFILGTEDDDEEHIPHDLFTEMDE → MAVTQFIHFREEIMGNMFFIIIFSTKDK
         251-374: Missing.

    Show »
    Length:1,000
    Mass (Da):112,448
    Checksum:i50FAA40A31468223
    GO
    Isoform 5 (identifier: Q9Y6M7-5) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-450: Missing.
         451-465: PAVLLTGLTEVPVPT → MEVVEAEKIVLLTSA
         1188-1188: S → SVDPSIVNISDEMAKTAQWKALSMNTENAKVTRSNMS

    Note: No experimental confirmation available.4 Publications
    Show »
    Length:800
    Mass (Da):89,745
    Checksum:iD7FB5D3479BB0935
    GO
    Isoform 6 (identifier: Q9Y6M7-6) [UniParc]FASTAAdd to basket

    Also known as: NBCn1-G

    The sequence of this isoform differs from the canonical sequence as follows:
         1-11: MERFRLEKKLP → MEADGAGEQMRPLLTR
         251-374: Missing.
         1188-1188: S → SVDPSIVNISDEMAKTAQWKALSMNTENAKVTRSNMS

    Show »
    Length:1,131
    Mass (Da):127,359
    Checksum:iD3DC49DE4DD7F133
    GO
    Isoform 7 (identifier: Q9Y6M7-7) [UniParc]FASTAAdd to basket

    Also known as: NBCn1-D

    The sequence of this isoform differs from the canonical sequence as follows:
         1-11: MERFRLEKKLP → MEADGAGEQMRPLLTRVTSR
         1188-1188: S → SVDPSIVNISDEMAKTAQWKALSMNTENAKVTRSNMS

    Show »
    Length:1,259
    Mass (Da):140,766
    Checksum:iDDE8C01EB6C6E00F
    GO
    Isoform 8 (identifier: Q9Y6M7-8) [UniParc]FASTAAdd to basket

    Also known as: NBCn1-C

    The sequence of this isoform differs from the canonical sequence as follows:
         1-11: MERFRLEKKLP → MEADGAGEQMRPLLTRVTSR
         238-250: Missing.
         1188-1188: S → SVDPSIVNISDEMAKTAQWKALSMNTENAKVTRSNMS

    Show »
    Length:1,246
    Mass (Da):139,254
    Checksum:iDEA67883267065E6
    GO
    Isoform 9 (identifier: Q9Y6M7-9) [UniParc]FASTAAdd to basket

    Also known as: NBCn1-E

    The sequence of this isoform differs from the canonical sequence as follows:
         1-11: MERFRLEKKLP → MEADGAGEQMRPLLTR
         251-374: Missing.

    Show »
    Length:1,095
    Mass (Da):123,409
    Checksum:iA3CD8C2972A7DFB3
    GO
    Isoform 10 (identifier: Q9Y6M7-10) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-11: MERFRLEKKLP → MEADGAGEQMRPLLTR
         238-250: Missing.
         581-582: LF → VQ
         583-1214: Missing.

    Show »
    Length:574
    Mass (Da):63,699
    Checksum:i57ECD93FDB48A158
    GO
    Isoform 11 (identifier: Q9Y6M7-11) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-11: MERFRLEKKLP → MEADGAGEQMRPLLTR
         251-374: Missing.
         581-582: LF → VQ
         583-1214: Missing.

    Show »
    Length:463
    Mass (Da):52,249
    Checksum:iBFD9ACB2B9362149
    GO
    Isoform 12 (identifier: Q9Y6M7-12) [UniParc]FASTAAdd to basket

    Also known as: NBCn1-H

    The sequence of this isoform differs from the canonical sequence as follows:
         1-11: MERFRLEKKLP → MEADGAGEQMRPLLTR
         238-250: Missing.

    Show »
    Length:1,206
    Mass (Da):134,860
    Checksum:i8A29DF5AD5ECE7E6
    GO
    Isoform 13 (identifier: Q9Y6M7-13) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-11: MERFRLEKKLP → MEADGAGEQMRPLLTRVTSR
         251-374: Missing.
         1188-1188: S → SVDPSIVNISDEMAKTAQWKALSMNTENAKVTRSNMS

    Show »
    Length:1,135
    Mass (Da):127,803
    Checksum:i77E065DA75256869
    GO
    Isoform 14 (identifier: Q9Y6M7-14) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-11: MERFRLEKKLP → MEADGAGEQMRPLLTRVTSR
         251-374: Missing.
         581-582: LF → VQ
         583-1214: Missing.

    Show »
    Length:467
    Mass (Da):52,692
    Checksum:i80F478ACDCBA905A
    GO

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti326 – 3261E → K.2 Publications
    Corresponds to variant rs3755652 [ dbSNP | Ensembl ].
    VAR_055317

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 450450Missing in isoform 5. 1 PublicationVSP_047838Add
    BLAST
    Alternative sequencei1 – 9090Missing in isoform 3 and isoform 4. 2 PublicationsVSP_047839Add
    BLAST
    Alternative sequencei1 – 1111MERFRLEKKLP → MEADGAGEQMRPLLTR in isoform 6, isoform 9, isoform 10, isoform 11 and isoform 12. 1 PublicationVSP_047840Add
    BLAST
    Alternative sequencei1 – 1111MERFRLEKKLP → MEADGAGEQMRPLLTRVTSR in isoform 7, isoform 8, isoform 13 and isoform 14. 2 PublicationsVSP_047841Add
    BLAST
    Alternative sequencei91 – 11828SQRVQ…TEMDE → MAVTQFIHFREEIMGNMFFI IIFSTKDK in isoform 3 and isoform 4. 2 PublicationsVSP_047842Add
    BLAST
    Alternative sequencei238 – 25013Missing in isoform 8, isoform 10 and isoform 12. 1 PublicationVSP_047843Add
    BLAST
    Alternative sequencei251 – 374124Missing in isoform 2, isoform 3, isoform 4, isoform 6, isoform 9, isoform 11, isoform 13 and isoform 14. 5 PublicationsVSP_047844Add
    BLAST
    Alternative sequencei451 – 46515PAVLL…VPVPT → MEVVEAEKIVLLTSA in isoform 5. 1 PublicationVSP_047845Add
    BLAST
    Alternative sequencei581 – 5822LF → VQ in isoform 10, isoform 11 and isoform 14. 2 PublicationsVSP_047846
    Alternative sequencei583 – 1214632Missing in isoform 10, isoform 11 and isoform 14. 2 PublicationsVSP_047847Add
    BLAST
    Alternative sequencei1188 – 11881S → SVDPSIVNISDEMAKTAQWK ALSMNTENAKVTRSNMS in isoform 5, isoform 6, isoform 7, isoform 8 and isoform 13. 3 PublicationsVSP_047848
    Alternative sequencei1189 – 121426PDKPV…AETSL → GDPSIGNISDEMAKTAQWKA LSMNTENAKVTRSNMSPDKP VSVK in isoform 3. 1 PublicationVSP_047849Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    AB012130 mRNA. Translation: BAA25898.1.
    AF047033 mRNA. Translation: AAD38322.1.
    AF089726 mRNA. Translation: AAG16773.1.
    AF053755 mRNA. Translation: AAF21720.1.
    EU499349 mRNA. Translation: ACB47400.1.
    EU934246 mRNA. Translation: ACH61958.1.
    EU934248 mRNA. Translation: ACH61960.1.
    EU934249 mRNA. Translation: ACH61961.1.
    EU934250 mRNA. Translation: ACH61962.1.
    FJ178574 mRNA. Translation: ACI24740.1.
    FJ178575 mRNA. Translation: ACI24741.1.
    FJ178576 mRNA. Translation: ACI24742.1.
    GU354307 mRNA. Translation: ADC32649.1.
    GU354308 mRNA. Translation: ADC32650.1.
    GU354309 mRNA. Translation: ADC32651.1.
    GU354310 mRNA. Translation: ADC32652.1.
    CR627428 mRNA. Translation: CAH10515.1.
    AC099535 Genomic DNA. No translation available.
    CH471055 Genomic DNA. Translation: EAW64382.1.
    CCDSiCCDS33721.1. [Q9Y6M7-1]
    CCDS58819.1. [Q9Y6M7-2]
    CCDS58820.1. [Q9Y6M7-6]
    PIRiJE0160.
    RefSeqiNP_001245308.1. NM_001258379.1. [Q9Y6M7-6]
    NP_001245309.1. NM_001258380.1. [Q9Y6M7-2]
    NP_003606.3. NM_003615.4. [Q9Y6M7-1]
    XP_005265658.1. XM_005265601.1. [Q9Y6M7-9]
    XP_011532557.1. XM_011534255.1. [Q9Y6M7-7]
    XP_011532559.1. XM_011534257.1. [Q9Y6M7-8]
    XP_011532562.1. XM_011534260.1. [Q9Y6M7-12]
    XP_011532564.1. XM_011534262.1. [Q9Y6M7-13]
    UniGeneiHs.250072.

    Genome annotation databases

    EnsembliENST00000295736; ENSP00000295736; ENSG00000033867.
    ENST00000428386; ENSP00000416368; ENSG00000033867. [Q9Y6M7-2]
    ENST00000437179; ENSP00000394252; ENSG00000033867. [Q9Y6M7-9]
    ENST00000437266; ENSP00000409418; ENSG00000033867. [Q9Y6M7-11]
    ENST00000438530; ENSP00000407304; ENSG00000033867. [Q9Y6M7-10]
    ENST00000440156; ENSP00000414797; ENSG00000033867. [Q9Y6M7-8]
    ENST00000446700; ENSP00000406605; ENSG00000033867. [Q9Y6M7-12]
    ENST00000454389; ENSP00000390394; ENSG00000033867. [Q9Y6M7-7]
    ENST00000455077; ENSP00000407382; ENSG00000033867. [Q9Y6M7-6]
    ENST00000457377; ENSP00000408323; ENSG00000033867. [Q9Y6M7-11]
    GeneIDi9497.
    KEGGihsa:9497.
    UCSCiuc003cdu.5. human.
    uc003cdv.4. human. [Q9Y6M7-1]
    uc003cdw.4. human. [Q9Y6M7-2]
    uc010hfm.3. human.
    uc011awx.3. human.
    uc011axa.3. human.
    uc021wun.2. human.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    AB012130 mRNA. Translation: BAA25898.1.
    AF047033 mRNA. Translation: AAD38322.1.
    AF089726 mRNA. Translation: AAG16773.1.
    AF053755 mRNA. Translation: AAF21720.1.
    EU499349 mRNA. Translation: ACB47400.1.
    EU934246 mRNA. Translation: ACH61958.1.
    EU934248 mRNA. Translation: ACH61960.1.
    EU934249 mRNA. Translation: ACH61961.1.
    EU934250 mRNA. Translation: ACH61962.1.
    FJ178574 mRNA. Translation: ACI24740.1.
    FJ178575 mRNA. Translation: ACI24741.1.
    FJ178576 mRNA. Translation: ACI24742.1.
    GU354307 mRNA. Translation: ADC32649.1.
    GU354308 mRNA. Translation: ADC32650.1.
    GU354309 mRNA. Translation: ADC32651.1.
    GU354310 mRNA. Translation: ADC32652.1.
    CR627428 mRNA. Translation: CAH10515.1.
    AC099535 Genomic DNA. No translation available.
    CH471055 Genomic DNA. Translation: EAW64382.1.
    CCDSiCCDS33721.1. [Q9Y6M7-1]
    CCDS58819.1. [Q9Y6M7-2]
    CCDS58820.1. [Q9Y6M7-6]
    PIRiJE0160.
    RefSeqiNP_001245308.1. NM_001258379.1. [Q9Y6M7-6]
    NP_001245309.1. NM_001258380.1. [Q9Y6M7-2]
    NP_003606.3. NM_003615.4. [Q9Y6M7-1]
    XP_005265658.1. XM_005265601.1. [Q9Y6M7-9]
    XP_011532557.1. XM_011534255.1. [Q9Y6M7-7]
    XP_011532559.1. XM_011534257.1. [Q9Y6M7-8]
    XP_011532562.1. XM_011534260.1. [Q9Y6M7-12]
    XP_011532564.1. XM_011534262.1. [Q9Y6M7-13]
    UniGeneiHs.250072.

    3D structure databases

    ProteinModelPortaliQ9Y6M7.
    SMRiQ9Y6M7. Positions 112-221, 418-526, 592-632.
    ModBaseiSearch...
    MobiDBiSearch...

    Protein-protein interaction databases

    BioGridi114876. 13 interactions.
    MINTiMINT-1632023.
    STRINGi9606.ENSP00000295736.

    Chemistry

    DrugBankiDB01390. Sodium bicarbonate.

    Protein family/group databases

    TCDBi2.A.31.2.11. the anion exchanger (ae) family.

    PTM databases

    PhosphoSiteiQ9Y6M7.

    Polymorphism and mutation databases

    BioMutaiSLC4A7.
    DMDMi229462789.

    Proteomic databases

    MaxQBiQ9Y6M7.
    PaxDbiQ9Y6M7.
    PRIDEiQ9Y6M7.

    Protocols and materials databases

    DNASUi9497.
    Structural Biology KnowledgebaseSearch...

    Genome annotation databases

    EnsembliENST00000295736; ENSP00000295736; ENSG00000033867.
    ENST00000428386; ENSP00000416368; ENSG00000033867. [Q9Y6M7-2]
    ENST00000437179; ENSP00000394252; ENSG00000033867. [Q9Y6M7-9]
    ENST00000437266; ENSP00000409418; ENSG00000033867. [Q9Y6M7-11]
    ENST00000438530; ENSP00000407304; ENSG00000033867. [Q9Y6M7-10]
    ENST00000440156; ENSP00000414797; ENSG00000033867. [Q9Y6M7-8]
    ENST00000446700; ENSP00000406605; ENSG00000033867. [Q9Y6M7-12]
    ENST00000454389; ENSP00000390394; ENSG00000033867. [Q9Y6M7-7]
    ENST00000455077; ENSP00000407382; ENSG00000033867. [Q9Y6M7-6]
    ENST00000457377; ENSP00000408323; ENSG00000033867. [Q9Y6M7-11]
    GeneIDi9497.
    KEGGihsa:9497.
    UCSCiuc003cdu.5. human.
    uc003cdv.4. human. [Q9Y6M7-1]
    uc003cdw.4. human. [Q9Y6M7-2]
    uc010hfm.3. human.
    uc011awx.3. human.
    uc011axa.3. human.
    uc021wun.2. human.

    Organism-specific databases

    CTDi9497.
    GeneCardsiGC03M027414.
    HGNCiHGNC:11033. SLC4A7.
    HPAiCAB022494.
    HPA035857.
    MIMi603353. gene.
    neXtProtiNX_Q9Y6M7.
    PharmGKBiPA35899.
    GenAtlasiSearch...

    Phylogenomic databases

    eggNOGiNOG268067.
    GeneTreeiENSGT00760000119021.
    HOGENOMiHOG000280684.
    HOVERGENiHBG004326.
    InParanoidiQ9Y6M7.
    KOiK13858.
    OMAiETYAFNM.
    PhylomeDBiQ9Y6M7.
    TreeFamiTF313630.

    Enzyme and pathway databases

    ReactomeiREACT_19298. Bicarbonate transporters.

    Miscellaneous databases

    ChiTaRSiSLC4A7. human.
    GeneWikiiSLC4A7.
    GenomeRNAii9497.
    NextBioi35478003.
    PROiQ9Y6M7.
    SOURCEiSearch...

    Gene expression databases

    BgeeiQ9Y6M7.
    CleanExiHS_SLC4A7.
    ExpressionAtlasiQ9Y6M7. baseline and differential.
    GenevisibleiQ9Y6M7. HS.

    Family and domain databases

    Gene3Di3.40.1100.10. 2 hits.
    InterProiIPR013769. Band3_cytoplasmic_dom.
    IPR011531. HCO3_transpt_C.
    IPR003020. HCO3_transpt_euk.
    IPR016152. PTrfase/Anion_transptr.
    [Graphical view]
    PANTHERiPTHR11453. PTHR11453. 1 hit.
    PfamiPF07565. Band_3_cyto. 1 hit.
    PF00955. HCO3_cotransp. 1 hit.
    [Graphical view]
    PRINTSiPR01231. HCO3TRNSPORT.
    SUPFAMiSSF55804. SSF55804. 2 hits.
    TIGRFAMsiTIGR00834. ae. 1 hit.
    ProtoNetiSearch...

    Publicationsi

    « Hide 'large scale' publications
    1. "Molecular cloning of a new sodium bicarbonate cotransporter cDNA from human retina."
      Ishibashi K., Sasaki S., Marumo F.
      Biochem. Biophys. Res. Commun. 246:535-538(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), TISSUE SPECIFICITY.
      Tissue: Retina.
    2. "Cloning, tissue distribution, genomic organization, and functional characterization of NBC3, a new member of the sodium bicarbonate cotransporter family."
      Pushkin A., Abuladze N., Lee I., Newman D., Hwang J., Kurtz I.
      J. Biol. Chem. 274:16569-16575(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), FUNCTION, BIOPHYSICOCHEMICAL PROPERTIES, REGULATION, VARIANT LYS-326.
      Tissue: Kidney and Skeletal muscle.
    3. "Cloning of a HCO3 transporter, NT2-NBC, from human brain, similar to both the Anion exchangers (AEs) and the Na/Bicarbonate Cotransporters (NBCs)."
      Romero M.F.
      Submitted (MAR-1998) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4).
      Tissue: Neuroepithelium.
    4. "Cloning and identification of novel human NBCn1 splice variants."
      Liu Y., Chen L.-M., Parker M.D., Boron W.F.
      Submitted (JUL-2008) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 6; 7; 8; 9; 10; 11 AND 12), ALTERNATIVE SPLICING, VARIANT LYS-326.
      Tissue: Brain, Heart, Liver and Skeletal muscle.
    5. "Cloning and identification of two novel human NBCn1 splice variants."
      Liu Y., Chen L., Parker M.D., Boron W.F.
      Submitted (DEC-2009) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 13 AND 14).
      Tissue: Brain.
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5).
      Tissue: Cervix.
    7. "The DNA sequence, annotation and analysis of human chromosome 3."
      Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J.
      , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
      Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    8. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    9. "The cystic fibrosis transmembrane conductance regulator interacts with and regulates the activity of the HCO3- salvage transporter human Na+-HCO3-cotransport isoform 3."
      Park M., Ko S.B.H., Choi J.Y., Muallem G., Thomas P.J., Pushkin A., Lee M.-S., Kim J.Y., Lee M.G., Muallem S., Kurtz I.
      J. Biol. Chem. 277:50503-50509(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH CFTR AND SLC9A3R1, DOMAIN.
    10. "The COOH termini of NBC3 and the 56-kDa H+-ATPase subunit are PDZ motifs involved in their interaction."
      Pushkin A., Abuladze N., Newman D., Muronets V., Sassani P., Tatishchev S., Kurtz I.
      Am. J. Physiol. 284:C667-C673(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH ATP6V1B1 AND SLC9A3R1, MUTAGENESIS OF LEU-1214.
    11. "Regulation of the human NBC3 Na+/HCO3- cotransporter by carbonic anhydrase II and PKA."
      Loiselle F.B., Morgan P.E., Alvarez B.V., Casey J.R.
      Am. J. Physiol. 286:C1423-C1433(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH CA2, REGULATION, MUTAGENESIS OF 1135-ASP-ASP-1136 AND 1163-ASP--ASP-1165.
    12. "Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry."
      Brill L.M., Salomon A.R., Ficarro S.B., Mukherji M., Stettler-Gill M., Peters E.C.
      Anal. Chem. 76:2763-2772(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    13. "Scaffold protein harmonin (USH1C) provides molecular links between Usher syndrome type 1 and type 2."
      Reiners J., van Wijk E., Maerker T., Zimmermann U., Juergens K., te Brinke H., Overlack N., Roepman R., Knipper M., Kremer H., Wolfrum U.
      Hum. Mol. Genet. 14:3933-3943(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH USH1C.
    14. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
      Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
      Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    15. "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis."
      Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III
      J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-1167 AND SER-1176, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    16. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-403 AND SER-1213, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-263 (ISOFORMS 11; 6 AND 9), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1109 AND SER-1115 (ISOFORM 13), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-267 (ISOFORMS 13 AND 14), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-258 (ISOFORM 2), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1010 AND SER-1016 (ISOFORM 3), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-168 (ISOFORMS 3 AND 4), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-774 AND SER-780 (ISOFORM 5), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1105 AND SER-1111 (ISOFORM 6), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1233 AND SER-1239 (ISOFORM 7), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1220 AND SER-1226 (ISOFORM 8), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    17. "Modular structure of sodium-coupled bicarbonate transporters."
      Boron W.F., Chen L., Parker M.D.
      J. Exp. Biol. 212:1697-1706(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: REVIEW, ALTERNATIVE SPLICING.
    18. "Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins."
      Wollscheid B., Bausch-Fluck D., Henderson C., O'Brien R., Bibel M., Schiess R., Aebersold R., Watts J.D.
      Nat. Biotechnol. 27:378-386(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-776; ASN-786 AND ASN-791.
      Tissue: Leukemic T-cell.
    19. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-1167 AND SER-1176, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-263 (ISOFORMS 11; 6 AND 9), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1077 (ISOFORM 13), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-267 (ISOFORMS 13 AND 14), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-258 (ISOFORM 2), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-168 (ISOFORMS 3 AND 4), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-742 (ISOFORM 5), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1073 (ISOFORM 6), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1201 (ISOFORM 7), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1188 (ISOFORM 8), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    20. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1176, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-260 AND SER-263 (ISOFORMS 11; 6 AND 9), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1106 AND SER-1109 (ISOFORM 13), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-264 AND SER-267 (ISOFORMS 13 AND 14), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-255 AND SER-258 (ISOFORM 2), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1007 AND SER-1010 (ISOFORM 3), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-165 AND SER-168 (ISOFORMS 3 AND 4), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-771 AND SER-774 (ISOFORM 5), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1102 AND SER-1105 (ISOFORM 6), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1230 AND SER-1233 (ISOFORM 7), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1217 AND SER-1220 (ISOFORM 8), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    21. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
      Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
      Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-242 AND SER-403, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-263 (ISOFORMS 11; 6 AND 9), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1106 (ISOFORM 13), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-267 (ISOFORMS 13 AND 14), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-258 (ISOFORM 2), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1007 (ISOFORM 3), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-168 (ISOFORMS 3 AND 4), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-771 (ISOFORM 5), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1102 (ISOFORM 6), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1230 (ISOFORM 7), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1217 (ISOFORM 8), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiS4A7_HUMAN
    AccessioniPrimary (citable) accession number: Q9Y6M7
    Secondary accession number(s): A6NIA8
    , B2CI53, B5M449, B5M451, B5M452, B5M453, B6DY52, B6DY53, C9JST9, D3K174, D3K175, O60350, Q6AHZ9, Q9HC88, Q9UIB9
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 7, 2006
    Last sequence update: May 5, 2009
    Last modified: July 22, 2015
    This is version 123 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 3
      Human chromosome 3: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3

    Similar proteinsi

    Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
    100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
    90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
    50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.