Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sodium bicarbonate cotransporter 3

Gene

SLC4A7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Electroneutral sodium- and bicarbonate-dependent cotransporter with a Na+:HCO3- 1:1 stoichiometry. Regulates intracellular pH and may play a role in bicarbonate salvage in secretory epithelia. May also have an associated sodium channel activity.2 Publications

Enzyme regulationi

Transporter activity is regulated by CA2/carbonic anhydrase 2, cAMP and PKA. Insensitive to stilbene derivatives. PubMed:10347222 states it is inhibited by 5-(N-ethyl-N-isopropyl)-amiloride (EIPA).

Kineticsi

  1. KM=24 mM for external sodium1 Publication

    GO - Molecular functioni

    GO - Biological processi

    Complete GO annotation...

    Keywords - Biological processi

    Ion transport, Sodium transport, Symport, Transport

    Keywords - Ligandi

    Sodium

    Enzyme and pathway databases

    ReactomeiR-HSA-425381. Bicarbonate transporters.

    Protein family/group databases

    TCDBi2.A.31.2.11. the anion exchanger (ae) family.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Sodium bicarbonate cotransporter 3
    Alternative name(s):
    Electroneutral Na/HCO(3) cotransporter
    Sodium bicarbonate cotransporter 2
    Sodium bicarbonate cotransporter 2b
    Short name:
    Bicarbonate transporter
    Solute carrier family 4 member 7
    Gene namesi
    Name:SLC4A7
    Synonyms:BT, NBC2, NBC2B, NBC3, NBCn1, SBC2, SLC4A6
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    Proteomesi
    • UP000005640 Componenti: Chromosome 3

    Organism-specific databases

    HGNCiHGNC:11033. SLC4A7.

    Subcellular locationi

    Topology

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Topological domaini1 – 608ExtracellularSequence analysisAdd BLAST608
    Transmembranei609 – 629HelicalSequence analysisAdd BLAST21
    Topological domaini630 – 637CytoplasmicSequence analysis8
    Transmembranei638 – 658HelicalSequence analysisAdd BLAST21
    Topological domaini659 – 695ExtracellularSequence analysisAdd BLAST37
    Transmembranei696 – 716HelicalSequence analysisAdd BLAST21
    Topological domaini717 – 725CytoplasmicSequence analysis9
    Transmembranei726 – 746HelicalSequence analysisAdd BLAST21
    Topological domaini747 – 817ExtracellularSequence analysisAdd BLAST71
    Transmembranei818 – 838HelicalSequence analysisAdd BLAST21
    Topological domaini839 – 861CytoplasmicSequence analysisAdd BLAST23
    Transmembranei862 – 882HelicalSequence analysisAdd BLAST21
    Topological domaini883 – 908ExtracellularSequence analysisAdd BLAST26
    Transmembranei909 – 929HelicalSequence analysisAdd BLAST21
    Topological domaini930 – 954CytoplasmicSequence analysisAdd BLAST25
    Transmembranei955 – 975HelicalSequence analysisAdd BLAST21
    Topological domaini976 – 1011ExtracellularSequence analysisAdd BLAST36
    Transmembranei1012 – 1032HelicalSequence analysisAdd BLAST21
    Topological domaini1033 – 1034CytoplasmicSequence analysis2
    Transmembranei1035 – 1055HelicalSequence analysisAdd BLAST21
    Topological domaini1056 – 1092ExtracellularSequence analysisAdd BLAST37
    Transmembranei1093 – 1113HelicalSequence analysisAdd BLAST21
    Topological domaini1114 – 1214CytoplasmicSequence analysisAdd BLAST101

    GO - Cellular componenti

    Complete GO annotation...

    Keywords - Cellular componenti

    Cell membrane, Cell projection, Membrane

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Mutagenesisi1135 – 1136DD → NN: Loss of interaction with CA2. Loss of regulation by CA2. 1 Publication2
    Mutagenesisi1163 – 1165DDD → NNN: No effect on interaction with CA2. No effect on regulation by CA2. 1 Publication3
    Mutagenesisi1214L → G: Loss of interaction with ATP6V1B1. 1 Publication1

    Organism-specific databases

    DisGeNETi9497.
    OpenTargetsiENSG00000033867.
    PharmGKBiPA35899.

    Chemistry databases

    DrugBankiDB01390. Sodium bicarbonate.

    Polymorphism and mutation databases

    BioMutaiSLC4A7.
    DMDMi229462789.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    ChainiPRO_00000792331 – 1214Sodium bicarbonate cotransporter 3Add BLAST1214

    Amino acid modifications

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Modified residuei52PhosphoserineBy similarity1
    Modified residuei55PhosphoserineCombined sources1
    Modified residuei84PhosphoserineBy similarity1
    Modified residuei150PhosphoserineBy similarity1
    Glycosylationi171N-linked (GlcNAc...)Sequence analysis1
    Modified residuei233PhosphoserineBy similarity1
    Modified residuei242PhosphoserineCombined sources1
    Glycosylationi269N-linked (GlcNAc...)Sequence analysis1
    Modified residuei382PhosphoserineBy similarity1
    Glycosylationi398N-linked (GlcNAc...)Sequence analysis1
    Modified residuei400PhosphoserineBy similarity1
    Modified residuei403PhosphoserineCombined sources1
    Glycosylationi406N-linked (GlcNAc...)Sequence analysis1
    Modified residuei407PhosphoserineCombined sources1
    Modified residuei556PhosphoserineCombined sources1
    Modified residuei557PhosphothreonineCombined sources1
    Disulfide bondi766 ↔ 768By similarity
    Glycosylationi776N-linked (GlcNAc...)1 Publication1
    Glycosylationi786N-linked (GlcNAc...)1 Publication1
    Glycosylationi791N-linked (GlcNAc...)1 Publication1
    Disulfide bondi802 ↔ 814By similarity
    Modified residuei1167PhosphothreonineCombined sources1
    Modified residuei1176PhosphoserineCombined sources1
    Modified residuei1213PhosphoserineCombined sources1
    Isoform 3 (identifier: Q9Y6M7-3)
    Modified residuei165PhosphoserineCombined sources1
    Modified residuei168PhosphoserineCombined sources1
    Modified residuei1007PhosphoserineCombined sources1
    Modified residuei1010PhosphoserineCombined sources1
    Modified residuei1016PhosphoserineCombined sources1
    Isoform 4 (identifier: Q9Y6M7-4)
    Modified residuei165PhosphoserineCombined sources1
    Modified residuei168PhosphoserineCombined sources1
    Isoform 2 (identifier: Q9Y6M7-2)
    Modified residuei255PhosphoserineCombined sources1
    Modified residuei258PhosphoserineCombined sources1
    Isoform 6 (identifier: Q9Y6M7-6)
    Modified residuei260PhosphoserineCombined sources1
    Modified residuei263PhosphoserineCombined sources1
    Modified residuei1073PhosphoserineCombined sources1
    Modified residuei1102PhosphoserineCombined sources1
    Modified residuei1105PhosphoserineCombined sources1
    Modified residuei1111PhosphoserineCombined sources1
    Isoform 9 (identifier: Q9Y6M7-9)
    Modified residuei260PhosphoserineCombined sources1
    Modified residuei263PhosphoserineCombined sources1
    Isoform 11 (identifier: Q9Y6M7-11)
    Modified residuei260PhosphoserineCombined sources1
    Modified residuei263PhosphoserineCombined sources1
    Isoform 13 (identifier: Q9Y6M7-13)
    Modified residuei264PhosphoserineCombined sources1
    Modified residuei267PhosphoserineCombined sources1
    Modified residuei1077PhosphoserineCombined sources1
    Modified residuei1106PhosphoserineCombined sources1
    Modified residuei1109PhosphoserineCombined sources1
    Modified residuei1115PhosphoserineCombined sources1
    Isoform 14 (identifier: Q9Y6M7-14)
    Modified residuei264PhosphoserineCombined sources1
    Modified residuei267PhosphoserineCombined sources1
    Isoform 5 (identifier: Q9Y6M7-5)
    Modified residuei742PhosphoserineCombined sources1
    Modified residuei771PhosphoserineCombined sources1
    Modified residuei774PhosphoserineCombined sources1
    Modified residuei780PhosphoserineCombined sources1
    Isoform 8 (identifier: Q9Y6M7-8)
    Modified residuei1188PhosphoserineCombined sources1
    Modified residuei1217PhosphoserineCombined sources1
    Modified residuei1220PhosphoserineCombined sources1
    Modified residuei1226PhosphoserineCombined sources1
    Isoform 7 (identifier: Q9Y6M7-7)
    Modified residuei1201PhosphoserineCombined sources1
    Modified residuei1230PhosphoserineCombined sources1
    Modified residuei1233PhosphoserineCombined sources1
    Modified residuei1239PhosphoserineCombined sources1

    Keywords - PTMi

    Disulfide bond, Glycoprotein, Phosphoprotein

    Proteomic databases

    EPDiQ9Y6M7.
    PaxDbiQ9Y6M7.
    PeptideAtlasiQ9Y6M7.
    PRIDEiQ9Y6M7.

    PTM databases

    iPTMnetiQ9Y6M7.
    PhosphoSitePlusiQ9Y6M7.

    Expressioni

    Tissue specificityi

    Highly expressed in testis and spleen. Also expressed in retina, colon, small intestine, ovary, thymus, prostate, muscle, heart and kidney. Isoform 1 is expressed in skeletal muscle and heart muscle.1 Publication

    Gene expression databases

    BgeeiENSG00000033867.
    CleanExiHS_SLC4A7.
    ExpressionAtlasiQ9Y6M7. baseline and differential.
    GenevisibleiQ9Y6M7. HS.

    Organism-specific databases

    HPAiCAB022494.
    HPA035857.

    Interactioni

    Subunit structurei

    Interacts with CFTR through SLC9A3R1/EBP50. Interacts with USH1C. Forms a complex with ATP6V1B1 and SLC9A3R1/EBP50. Interacts in a pH dependent-manner with CA2/carbonic anhydrase 2.4 Publications

    Protein-protein interaction databases

    BioGridi114876. 28 interactors.
    IntActiQ9Y6M7. 6 interactors.
    MINTiMINT-1632023.
    STRINGi9606.ENSP00000295736.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9Y6M7.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Region

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Regioni1134 – 1136CA2-binding3

    Motif

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Motifi1211 – 1214PDZ-binding4

    Domaini

    The PDZ-binding motif mediates interaction with the CFTR, SLC9A3R1/EBP50 complex and probably with USH1C.1 Publication

    Sequence similaritiesi

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiKOG1172. Eukaryota.
    ENOG410XPHD. LUCA.
    GeneTreeiENSGT00760000119021.
    HOGENOMiHOG000280684.
    HOVERGENiHBG004326.
    InParanoidiQ9Y6M7.
    KOiK13858.
    OMAiETYAFNM.
    OrthoDBiEOG091G01FT.
    PhylomeDBiQ9Y6M7.
    TreeFamiTF313630.

    Family and domain databases

    Gene3Di3.40.1100.10. 2 hits.
    InterProiIPR013769. Band3_cytoplasmic_dom.
    IPR011531. HCO3_transpt_C.
    IPR003020. HCO3_transpt_euk.
    IPR016152. PTrfase/Anion_transptr.
    [Graphical view]
    PANTHERiPTHR11453. PTHR11453. 2 hits.
    PfamiPF07565. Band_3_cyto. 1 hit.
    PF00955. HCO3_cotransp. 1 hit.
    [Graphical view]
    PRINTSiPR01231. HCO3TRNSPORT.
    SUPFAMiSSF55804. SSF55804. 2 hits.
    TIGRFAMsiTIGR00834. ae. 1 hit.

    Sequences (14)i

    Sequence statusi: Complete.

    This entry describes 14 isoformsi produced by alternative splicing. AlignAdd to basket

    Isoform 1 (identifier: Q9Y6M7-1) [UniParc]FASTAAdd to basket
    Also known as: mNBC3, NBCn1-A

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

            10         20         30         40         50
    MERFRLEKKL PGPDEEAVVD LGKTSSTVNT KFEKEELESH RAVYIGVHVP
    60 70 80 90 100
    FSKESRRRHR HRGHKHHHRR RKDKESDKED GRESPSYDTP SQRVQFILGT
    110 120 130 140 150
    EDDDEEHIPH DLFTEMDELC YRDGEEYEWK ETARWLKFEE DVEDGGDRWS
    160 170 180 190 200
    KPYVATLSLH SLFELRSCIL NGTVMLDMRA STLDEIADMV LDNMIASGQL
    210 220 230 240 250
    DESIRENVRE ALLKRHHHQN EKRFTSRIPL VRSFADIGKK HSDPHLLERN
    260 270 280 290 300
    GEGLSASRHS LRTGLSASNL SLRGESPLSL LLGHLLPSSR AGTPAGSRCT
    310 320 330 340 350
    TPVPTPQNSP PSSPSISRLT SRSSQESQRQ APELLVSPAS DDIPTVVIHP
    360 370 380 390 400
    PEEDLEAALK GEEQKNEENV DLTPGILASP QSAPGNLDNS KSGEIKGNGS
    410 420 430 440 450
    GGSRENSTVD FSKVDMNFMR KIPTGAEASN VLVGEVDFLE RPIIAFVRLA
    460 470 480 490 500
    PAVLLTGLTE VPVPTRFLFL LLGPAGKAPQ YHEIGRSIAT LMTDEIFHDV
    510 520 530 540 550
    AYKAKDRNDL LSGIDEFLDQ VTVLPPGEWD PSIRIEPPKS VPSQEKRKIP
    560 570 580 590 600
    VFHNGSTPTL GETPKEAAHH AGPELQRTGR LFGGLILDIK RKAPFFLSDF
    610 620 630 640 650
    KDALSLQCLA SILFLYCACM SPVITFGGLL GEATEGRISA IESLFGASLT
    660 670 680 690 700
    GIAYSLFAGQ PLTILGSTGP VLVFEKILYK FCRDYQLSYL SLRTSIGLWT
    710 720 730 740 750
    SFLCIVLVAT DASSLVCYIT RFTEEAFAAL ICIIFIYEAL EKLFDLGETY
    760 770 780 790 800
    AFNMHNNLDK LTSYSCVCTE PPNPSNETLA QWKKDNITAH NISWRNLTVS
    810 820 830 840 850
    ECKKLRGVFL GSACGHHGPY IPDVLFWCVI LFFTTFFLSS FLKQFKTKRY
    860 870 880 890 900
    FPTKVRSTIS DFAVFLTIVI MVTIDYLVGV PSPKLHVPEK FEPTHPERGW
    910 920 930 940 950
    IISPLGDNPW WTLLIAAIPA LLCTILIFMD QQITAVIINR KEHKLKKGAG
    960 970 980 990 1000
    YHLDLLMVGV MLGVCSVMGL PWFVAATVLS ISHVNSLKVE SECSAPGEQP
    1010 1020 1030 1040 1050
    KFLGIREQRV TGLMIFILMG LSVFMTSVLK FIPMPVLYGV FLYMGVSSLK
    1060 1070 1080 1090 1100
    GIQLFDRIKL FGMPAKHQPD LIYLRYVPLW KVHIFTVIQL TCLVLLWVIK
    1110 1120 1130 1140 1150
    VSAAAVVFPM MVLALVFVRK LMDLCFTKRE LSWLDDLMPE SKKKKEDDKK
    1160 1170 1180 1190 1200
    KKEKEEAERM LQDDDDTVHL PFEGGSLLQI PVKALKYSPD KPVSVKISFE
    1210
    DEPRKKYVDA ETSL
    Length:1,214
    Mass (Da):136,044
    Last modified:May 5, 2009 - v2
    Checksum:i7B4ADA1E3F26813C
    GO
    Isoform 2 (identifier: Q9Y6M7-2) [UniParc]FASTAAdd to basket
    Also known as: NBCn1-F

    The sequence of this isoform differs from the canonical sequence as follows:
         251-374: Missing.

    Show »
    Length:1,090
    Mass (Da):123,081
    Checksum:i541839CC9B565896
    GO
    Isoform 3 (identifier: Q9Y6M7-3) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-90: Missing.
         91-118: SQRVQFILGTEDDDEEHIPHDLFTEMDE → MAVTQFIHFREEIMGNMFFIIIFSTKDK
         251-374: Missing.
         1189-1214: PDKPVSVKISFEDEPRKKYVDAETSL → GDPSIGNISDEMAKTAQWKALSMNTENAKVTRSNMSPDKPVSVK

    Show »
    Length:1,018
    Mass (Da):114,205
    Checksum:iA37799D93A1E30BC
    GO
    Isoform 4 (identifier: Q9Y6M7-4) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-90: Missing.
         91-118: SQRVQFILGTEDDDEEHIPHDLFTEMDE → MAVTQFIHFREEIMGNMFFIIIFSTKDK
         251-374: Missing.

    Show »
    Length:1,000
    Mass (Da):112,448
    Checksum:i50FAA40A31468223
    GO
    Isoform 5 (identifier: Q9Y6M7-5) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-450: Missing.
         451-465: PAVLLTGLTEVPVPT → MEVVEAEKIVLLTSA
         1188-1188: S → SVDPSIVNISDEMAKTAQWKALSMNTENAKVTRSNMS

    Note: No experimental confirmation available.Combined sources
    Show »
    Length:800
    Mass (Da):89,745
    Checksum:iD7FB5D3479BB0935
    GO
    Isoform 6 (identifier: Q9Y6M7-6) [UniParc]FASTAAdd to basket
    Also known as: NBCn1-G

    The sequence of this isoform differs from the canonical sequence as follows:
         1-11: MERFRLEKKLP → MEADGAGEQMRPLLTR
         251-374: Missing.
         1188-1188: S → SVDPSIVNISDEMAKTAQWKALSMNTENAKVTRSNMS

    Show »
    Length:1,131
    Mass (Da):127,359
    Checksum:iD3DC49DE4DD7F133
    GO
    Isoform 7 (identifier: Q9Y6M7-7) [UniParc]FASTAAdd to basket
    Also known as: NBCn1-D

    The sequence of this isoform differs from the canonical sequence as follows:
         1-11: MERFRLEKKLP → MEADGAGEQMRPLLTRVTSR
         1188-1188: S → SVDPSIVNISDEMAKTAQWKALSMNTENAKVTRSNMS

    Show »
    Length:1,259
    Mass (Da):140,766
    Checksum:iDDE8C01EB6C6E00F
    GO
    Isoform 8 (identifier: Q9Y6M7-8) [UniParc]FASTAAdd to basket
    Also known as: NBCn1-C

    The sequence of this isoform differs from the canonical sequence as follows:
         1-11: MERFRLEKKLP → MEADGAGEQMRPLLTRVTSR
         238-250: Missing.
         1188-1188: S → SVDPSIVNISDEMAKTAQWKALSMNTENAKVTRSNMS

    Show »
    Length:1,246
    Mass (Da):139,254
    Checksum:iDEA67883267065E6
    GO
    Isoform 9 (identifier: Q9Y6M7-9) [UniParc]FASTAAdd to basket
    Also known as: NBCn1-E

    The sequence of this isoform differs from the canonical sequence as follows:
         1-11: MERFRLEKKLP → MEADGAGEQMRPLLTR
         251-374: Missing.

    Show »
    Length:1,095
    Mass (Da):123,409
    Checksum:iA3CD8C2972A7DFB3
    GO
    Isoform 10 (identifier: Q9Y6M7-10) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-11: MERFRLEKKLP → MEADGAGEQMRPLLTR
         238-250: Missing.
         581-582: LF → VQ
         583-1214: Missing.

    Show »
    Length:574
    Mass (Da):63,699
    Checksum:i57ECD93FDB48A158
    GO
    Isoform 11 (identifier: Q9Y6M7-11) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-11: MERFRLEKKLP → MEADGAGEQMRPLLTR
         251-374: Missing.
         581-582: LF → VQ
         583-1214: Missing.

    Show »
    Length:463
    Mass (Da):52,249
    Checksum:iBFD9ACB2B9362149
    GO
    Isoform 12 (identifier: Q9Y6M7-12) [UniParc]FASTAAdd to basket
    Also known as: NBCn1-H

    The sequence of this isoform differs from the canonical sequence as follows:
         1-11: MERFRLEKKLP → MEADGAGEQMRPLLTR
         238-250: Missing.

    Show »
    Length:1,206
    Mass (Da):134,860
    Checksum:i8A29DF5AD5ECE7E6
    GO
    Isoform 13 (identifier: Q9Y6M7-13) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-11: MERFRLEKKLP → MEADGAGEQMRPLLTRVTSR
         251-374: Missing.
         1188-1188: S → SVDPSIVNISDEMAKTAQWKALSMNTENAKVTRSNMS

    Show »
    Length:1,135
    Mass (Da):127,803
    Checksum:i77E065DA75256869
    GO
    Isoform 14 (identifier: Q9Y6M7-14) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-11: MERFRLEKKLP → MEADGAGEQMRPLLTRVTSR
         251-374: Missing.
         581-582: LF → VQ
         583-1214: Missing.

    Show »
    Length:467
    Mass (Da):52,692
    Checksum:i80F478ACDCBA905A
    GO

    Natural variant

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Natural variantiVAR_055317326E → K.2 PublicationsCorresponds to variant rs3755652dbSNPEnsembl.1

    Alternative sequence

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Alternative sequenceiVSP_0478381 – 450Missing in isoform 5. 1 PublicationAdd BLAST450
    Alternative sequenceiVSP_0478391 – 90Missing in isoform 3 and isoform 4. 2 PublicationsAdd BLAST90
    Alternative sequenceiVSP_0478401 – 11MERFRLEKKLP → MEADGAGEQMRPLLTR in isoform 6, isoform 9, isoform 10, isoform 11 and isoform 12. 1 PublicationAdd BLAST11
    Alternative sequenceiVSP_0478411 – 11MERFRLEKKLP → MEADGAGEQMRPLLTRVTSR in isoform 7, isoform 8, isoform 13 and isoform 14. 2 PublicationsAdd BLAST11
    Alternative sequenceiVSP_04784291 – 118SQRVQ…TEMDE → MAVTQFIHFREEIMGNMFFI IIFSTKDK in isoform 3 and isoform 4. 2 PublicationsAdd BLAST28
    Alternative sequenceiVSP_047843238 – 250Missing in isoform 8, isoform 10 and isoform 12. 1 PublicationAdd BLAST13
    Alternative sequenceiVSP_047844251 – 374Missing in isoform 2, isoform 3, isoform 4, isoform 6, isoform 9, isoform 11, isoform 13 and isoform 14. 5 PublicationsAdd BLAST124
    Alternative sequenceiVSP_047845451 – 465PAVLL…VPVPT → MEVVEAEKIVLLTSA in isoform 5. 1 PublicationAdd BLAST15
    Alternative sequenceiVSP_047846581 – 582LF → VQ in isoform 10, isoform 11 and isoform 14. 2 Publications2
    Alternative sequenceiVSP_047847583 – 1214Missing in isoform 10, isoform 11 and isoform 14. 2 PublicationsAdd BLAST632
    Alternative sequenceiVSP_0478481188S → SVDPSIVNISDEMAKTAQWK ALSMNTENAKVTRSNMS in isoform 5, isoform 6, isoform 7, isoform 8 and isoform 13. 3 Publications1
    Alternative sequenceiVSP_0478491189 – 1214PDKPV…AETSL → GDPSIGNISDEMAKTAQWKA LSMNTENAKVTRSNMSPDKP VSVK in isoform 3. 1 PublicationAdd BLAST26

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    AB012130 mRNA. Translation: BAA25898.1.
    AF047033 mRNA. Translation: AAD38322.1.
    AF089726 mRNA. Translation: AAG16773.1.
    AF053755 mRNA. Translation: AAF21720.1.
    EU499349 mRNA. Translation: ACB47400.1.
    EU934246 mRNA. Translation: ACH61958.1.
    EU934248 mRNA. Translation: ACH61960.1.
    EU934249 mRNA. Translation: ACH61961.1.
    EU934250 mRNA. Translation: ACH61962.1.
    FJ178574 mRNA. Translation: ACI24740.1.
    FJ178575 mRNA. Translation: ACI24741.1.
    FJ178576 mRNA. Translation: ACI24742.1.
    GU354307 mRNA. Translation: ADC32649.1.
    GU354308 mRNA. Translation: ADC32650.1.
    GU354309 mRNA. Translation: ADC32651.1.
    GU354310 mRNA. Translation: ADC32652.1.
    CR627428 mRNA. Translation: CAH10515.1.
    AC099535 Genomic DNA. No translation available.
    CH471055 Genomic DNA. Translation: EAW64382.1.
    CCDSiCCDS33721.1. [Q9Y6M7-1]
    CCDS58819.1. [Q9Y6M7-2]
    CCDS58820.1. [Q9Y6M7-6]
    CCDS82747.1. [Q9Y6M7-7]
    CCDS82749.1. [Q9Y6M7-8]
    CCDS82750.1. [Q9Y6M7-9]
    CCDS82751.1. [Q9Y6M7-12]
    PIRiJE0160.
    RefSeqiNP_001245308.1. NM_001258379.1. [Q9Y6M7-6]
    NP_001245309.1. NM_001258380.1. [Q9Y6M7-2]
    NP_001308032.1. NM_001321103.1. [Q9Y6M7-7]
    NP_001308033.1. NM_001321104.1. [Q9Y6M7-8]
    NP_001308034.1. NM_001321105.1.
    NP_001308035.1. NM_001321106.1. [Q9Y6M7-12]
    NP_001308036.1. NM_001321107.1. [Q9Y6M7-9]
    NP_001308037.1. NM_001321108.1. [Q9Y6M7-13]
    NP_003606.3. NM_003615.4. [Q9Y6M7-1]
    XP_016863017.1. XM_017007528.1. [Q9Y6M7-5]
    XP_016863018.1. XM_017007529.1. [Q9Y6M7-5]
    UniGeneiHs.250072.

    Genome annotation databases

    EnsembliENST00000295736; ENSP00000295736; ENSG00000033867. [Q9Y6M7-1]
    ENST00000428386; ENSP00000416368; ENSG00000033867. [Q9Y6M7-2]
    ENST00000437179; ENSP00000394252; ENSG00000033867. [Q9Y6M7-9]
    ENST00000437266; ENSP00000409418; ENSG00000033867. [Q9Y6M7-11]
    ENST00000438530; ENSP00000407304; ENSG00000033867. [Q9Y6M7-10]
    ENST00000440156; ENSP00000414797; ENSG00000033867. [Q9Y6M7-8]
    ENST00000446700; ENSP00000406605; ENSG00000033867. [Q9Y6M7-12]
    ENST00000454389; ENSP00000390394; ENSG00000033867. [Q9Y6M7-7]
    ENST00000455077; ENSP00000407382; ENSG00000033867. [Q9Y6M7-6]
    ENST00000457377; ENSP00000408323; ENSG00000033867. [Q9Y6M7-11]
    GeneIDi9497.
    KEGGihsa:9497.
    UCSCiuc003cdu.6. human. [Q9Y6M7-1]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    AB012130 mRNA. Translation: BAA25898.1.
    AF047033 mRNA. Translation: AAD38322.1.
    AF089726 mRNA. Translation: AAG16773.1.
    AF053755 mRNA. Translation: AAF21720.1.
    EU499349 mRNA. Translation: ACB47400.1.
    EU934246 mRNA. Translation: ACH61958.1.
    EU934248 mRNA. Translation: ACH61960.1.
    EU934249 mRNA. Translation: ACH61961.1.
    EU934250 mRNA. Translation: ACH61962.1.
    FJ178574 mRNA. Translation: ACI24740.1.
    FJ178575 mRNA. Translation: ACI24741.1.
    FJ178576 mRNA. Translation: ACI24742.1.
    GU354307 mRNA. Translation: ADC32649.1.
    GU354308 mRNA. Translation: ADC32650.1.
    GU354309 mRNA. Translation: ADC32651.1.
    GU354310 mRNA. Translation: ADC32652.1.
    CR627428 mRNA. Translation: CAH10515.1.
    AC099535 Genomic DNA. No translation available.
    CH471055 Genomic DNA. Translation: EAW64382.1.
    CCDSiCCDS33721.1. [Q9Y6M7-1]
    CCDS58819.1. [Q9Y6M7-2]
    CCDS58820.1. [Q9Y6M7-6]
    CCDS82747.1. [Q9Y6M7-7]
    CCDS82749.1. [Q9Y6M7-8]
    CCDS82750.1. [Q9Y6M7-9]
    CCDS82751.1. [Q9Y6M7-12]
    PIRiJE0160.
    RefSeqiNP_001245308.1. NM_001258379.1. [Q9Y6M7-6]
    NP_001245309.1. NM_001258380.1. [Q9Y6M7-2]
    NP_001308032.1. NM_001321103.1. [Q9Y6M7-7]
    NP_001308033.1. NM_001321104.1. [Q9Y6M7-8]
    NP_001308034.1. NM_001321105.1.
    NP_001308035.1. NM_001321106.1. [Q9Y6M7-12]
    NP_001308036.1. NM_001321107.1. [Q9Y6M7-9]
    NP_001308037.1. NM_001321108.1. [Q9Y6M7-13]
    NP_003606.3. NM_003615.4. [Q9Y6M7-1]
    XP_016863017.1. XM_017007528.1. [Q9Y6M7-5]
    XP_016863018.1. XM_017007529.1. [Q9Y6M7-5]
    UniGeneiHs.250072.

    3D structure databases

    ProteinModelPortaliQ9Y6M7.
    ModBaseiSearch...
    MobiDBiSearch...

    Protein-protein interaction databases

    BioGridi114876. 28 interactors.
    IntActiQ9Y6M7. 6 interactors.
    MINTiMINT-1632023.
    STRINGi9606.ENSP00000295736.

    Chemistry databases

    DrugBankiDB01390. Sodium bicarbonate.

    Protein family/group databases

    TCDBi2.A.31.2.11. the anion exchanger (ae) family.

    PTM databases

    iPTMnetiQ9Y6M7.
    PhosphoSitePlusiQ9Y6M7.

    Polymorphism and mutation databases

    BioMutaiSLC4A7.
    DMDMi229462789.

    Proteomic databases

    EPDiQ9Y6M7.
    PaxDbiQ9Y6M7.
    PeptideAtlasiQ9Y6M7.
    PRIDEiQ9Y6M7.

    Protocols and materials databases

    DNASUi9497.
    Structural Biology KnowledgebaseSearch...

    Genome annotation databases

    EnsembliENST00000295736; ENSP00000295736; ENSG00000033867. [Q9Y6M7-1]
    ENST00000428386; ENSP00000416368; ENSG00000033867. [Q9Y6M7-2]
    ENST00000437179; ENSP00000394252; ENSG00000033867. [Q9Y6M7-9]
    ENST00000437266; ENSP00000409418; ENSG00000033867. [Q9Y6M7-11]
    ENST00000438530; ENSP00000407304; ENSG00000033867. [Q9Y6M7-10]
    ENST00000440156; ENSP00000414797; ENSG00000033867. [Q9Y6M7-8]
    ENST00000446700; ENSP00000406605; ENSG00000033867. [Q9Y6M7-12]
    ENST00000454389; ENSP00000390394; ENSG00000033867. [Q9Y6M7-7]
    ENST00000455077; ENSP00000407382; ENSG00000033867. [Q9Y6M7-6]
    ENST00000457377; ENSP00000408323; ENSG00000033867. [Q9Y6M7-11]
    GeneIDi9497.
    KEGGihsa:9497.
    UCSCiuc003cdu.6. human. [Q9Y6M7-1]

    Organism-specific databases

    CTDi9497.
    DisGeNETi9497.
    GeneCardsiSLC4A7.
    HGNCiHGNC:11033. SLC4A7.
    HPAiCAB022494.
    HPA035857.
    MIMi603353. gene.
    neXtProtiNX_Q9Y6M7.
    OpenTargetsiENSG00000033867.
    PharmGKBiPA35899.
    GenAtlasiSearch...

    Phylogenomic databases

    eggNOGiKOG1172. Eukaryota.
    ENOG410XPHD. LUCA.
    GeneTreeiENSGT00760000119021.
    HOGENOMiHOG000280684.
    HOVERGENiHBG004326.
    InParanoidiQ9Y6M7.
    KOiK13858.
    OMAiETYAFNM.
    OrthoDBiEOG091G01FT.
    PhylomeDBiQ9Y6M7.
    TreeFamiTF313630.

    Enzyme and pathway databases

    ReactomeiR-HSA-425381. Bicarbonate transporters.

    Miscellaneous databases

    ChiTaRSiSLC4A7. human.
    GeneWikiiSLC4A7.
    GenomeRNAii9497.
    PROiQ9Y6M7.
    SOURCEiSearch...

    Gene expression databases

    BgeeiENSG00000033867.
    CleanExiHS_SLC4A7.
    ExpressionAtlasiQ9Y6M7. baseline and differential.
    GenevisibleiQ9Y6M7. HS.

    Family and domain databases

    Gene3Di3.40.1100.10. 2 hits.
    InterProiIPR013769. Band3_cytoplasmic_dom.
    IPR011531. HCO3_transpt_C.
    IPR003020. HCO3_transpt_euk.
    IPR016152. PTrfase/Anion_transptr.
    [Graphical view]
    PANTHERiPTHR11453. PTHR11453. 2 hits.
    PfamiPF07565. Band_3_cyto. 1 hit.
    PF00955. HCO3_cotransp. 1 hit.
    [Graphical view]
    PRINTSiPR01231. HCO3TRNSPORT.
    SUPFAMiSSF55804. SSF55804. 2 hits.
    TIGRFAMsiTIGR00834. ae. 1 hit.
    ProtoNetiSearch...

    Entry informationi

    Entry nameiS4A7_HUMAN
    AccessioniPrimary (citable) accession number: Q9Y6M7
    Secondary accession number(s): A6NIA8
    , B2CI53, B5M449, B5M451, B5M452, B5M453, B6DY52, B6DY53, C9JST9, D3K174, D3K175, O60350, Q6AHZ9, Q9HC88, Q9UIB9
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 7, 2006
    Last sequence update: May 5, 2009
    Last modified: November 2, 2016
    This is version 137 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 3
      Human chromosome 3: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    Similar proteinsi

    Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
    100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
    90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
    50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.