Q9Y6M7 (S4A7_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 102.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Sodium bicarbonate cotransporter 3 Alternative name(s): Sodium bicarbonate cotransporter 2 Sodium bicarbonate cotransporter 2b Short name=Bicarbonate transporter Solute carrier family 4 member 7 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1214 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Electroneutral sodium- and bicarbonate-dependent cotransporter with a Na+:HCO3- 1:1 stoichiometry. Regulates intracellular pH and may play a role in bicarbonate salvage in secretory epithelia. May also have an associated sodium channel activity. Ref.2 Ref.8 |
| Enzyme regulation | Transporter activity is regulated by CA2/carbonic anhydrase 2, cAMP and PKA. Insensitive to stilbene derivatives. Ref.2 states it is inhibited by 5-(N-ethyl-N-isopropyl)-amiloride (EIPA). |
| Subunit structure | Interacts with CFTR through SLC9A3R1/EBP50. Interacts with USH1C. Forms a complex with ATP6V1B1 and SLC9A3R1/EBP50. Interacts in a pH dependent-manner with CA2/carbonic anhydrase 2. Ref.8 Ref.9 Ref.10 Ref.12 |
| Subcellular location | Basolateral cell membrane; Multi-pass membrane protein. Apical cell membrane; Multi-pass membrane protein By similarity. Cell projection › stereocilium By similarity. Note: Also described at the apical cell membrane. Localizes to the stereocilia of cochlear outer hair cells and to the lateral membrane of cochlear inner hair cells By similarity. |
| Tissue specificity | Highly expressed in testis and spleen. Also expressed in retina, colon, small intestine, ovary, thymus, prostate, muscle, heart and kidney. Isoform 1 is expressed in skeletal muscle and heart muscle. Ref.1 |
| Domain | The PDZ-binding motif mediates interaction with the CFTR, SLC9A3R1/EBP50 complex and probably with USH1C. Ref.8 |
| Sequence similarities | Belongs to the anion exchanger (TC 2.A.31) family. [View classification] |
| Biophysicochemical properties | Kinetic parameters: KM=24 mM for external sodium Ref.2 |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| YWHAB | P31946 | 1 | EBI-1044546,EBI-359815 |
Alternative products
| This entry describes 9 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9Y6M7-1) Also known as: mNBC3; NBCn1-A; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9Y6M7-2) Also known as: NBCn1-F; The sequence of this isoform differs from the canonical sequence as follows: 251-374: Missing. | ||||||
| Note: Contains a phosphoserine at position 258. Contains a phosphoserine at position 255. | ||||||
| Isoform 3 (identifier: Q9Y6M7-3) The sequence of this isoform differs from the canonical sequence as follows: 1-90: Missing. 91-118: SQRVQFILGTEDDDEEHIPHDLFTEMDE → MAVTQFIHFREEIMGNMFFIIIFSTKDK 251-374: Missing. 1189-1214: PDKPVSVKISFEDEPRKKYVDAETSL → GDPSIGNISDEMAKTAQWKALSMNTENAKVTRSNMSPDKPVSVK | ||||||
| Note: Contains a phosphoserine at position 168. Contains a phosphoserine at position 1010. Contains a phosphoserine at position 1016. Contains a phosphoserine at position 165. Contains a phosphoserine at position 1007. | ||||||
| Isoform 4 (identifier: Q9Y6M7-4) The sequence of this isoform differs from the canonical sequence as follows: 1-90: Missing. 91-118: SQRVQFILGTEDDDEEHIPHDLFTEMDE → MAVTQFIHFREEIMGNMFFIIIFSTKDK 251-374: Missing. | ||||||
| Note: Contains a phosphoserine at position 168. Contains a phosphoserine at position 165. | ||||||
| Isoform 5 (identifier: Q9Y6M7-5) The sequence of this isoform differs from the canonical sequence as follows: 1-450: Missing. 451-465: PAVLLTGLTEVPVPT → MEVVEAEKIVLLTSA 1188-1188: S → SVDPSIVNISDEMAKTAQWKALSMNSENAKVTRSNMS | ||||||
| Note: No experimental confirmation available. Contains a phosphoserine at position 774. Contains a phosphoserine at position 780. Contains a phosphoserine at position 742. Contains a phosphoserine at position 771. | ||||||
| Isoform 6 (identifier: Q9Y6M7-6) Also known as: NBCn1-G; The sequence of this isoform differs from the canonical sequence as follows: 1-11: MERFRLEKKLP → MEADGAGEQMRPLLTR 251-374: Missing. 1188-1188: S → SVDPSIVNISDEMAKTAQWKALSMNSENAKVTRSNMS | ||||||
| Note: Contains a phosphoserine at position 263. Contains a phosphoserine at position 1105. Contains a phosphoserine at position 1111. Contains a phosphoserine at position 1073. Contains a phosphoserine at position 260. Contains a phosphoserine at position 1102. | ||||||
| Isoform 7 (identifier: Q9Y6M7-7) Also known as: NBCn1-D; The sequence of this isoform differs from the canonical sequence as follows: 1-11: MERFRLEKKLP → MEADGAGEQMRPLLTRVTSR 1188-1188: S → SVDPSIVNISDEMAKTAQWKALSMNSENAKVTRSNMS | ||||||
| Note: Contains a phosphoserine at position 1233. Contains a phosphoserine at position 1239. Contains a phosphoserine at position 1201. Contains a phosphoserine at position 1230. | ||||||
| Isoform 8 (identifier: Q9Y6M7-8) Also known as: NBCn1-C; The sequence of this isoform differs from the canonical sequence as follows: 1-11: MERFRLEKKLP → MEADGAGEQMRPLLTRVTSR 238-250: Missing. 1188-1188: S → SVDPSIVNISDEMAKTAQWKALSMNSENAKVTRSNMS | ||||||
| Note: Contains a phosphoserine at position 1220. Contains a phosphoserine at position 1226. Contains a phosphoserine at position 1188. Contains a phosphoserine at position 1217. | ||||||
| Isoform 9 (identifier: Q9Y6M7-9) Also known as: NBCn1-E; The sequence of this isoform differs from the canonical sequence as follows: 1-11: MERFRLEKKLP → MEADGAGEQMRPLLTR 251-374: Missing. | ||||||
| Note: Contains a phosphoserine at position 263. Contains a phosphoserine at position 260. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1214 | 1214 | Sodium bicarbonate cotransporter 3 | PRO_0000079233 | |||||
Regions | |||||||||
| Topological domain | 1 – 608 | 608 | Extracellular Potential | ||||||
| Transmembrane | 609 – 629 | 21 | Helical; Potential | ||||||
| Topological domain | 630 – 637 | 8 | Cytoplasmic Potential | ||||||
| Transmembrane | 638 – 658 | 21 | Helical; Potential | ||||||
| Topological domain | 659 – 695 | 37 | Extracellular Potential | ||||||
| Transmembrane | 696 – 716 | 21 | Helical; Potential | ||||||
| Topological domain | 717 – 725 | 9 | Cytoplasmic Potential | ||||||
| Transmembrane | 726 – 746 | 21 | Helical; Potential | ||||||
| Topological domain | 747 – 817 | 71 | Extracellular Potential | ||||||
| Transmembrane | 818 – 838 | 21 | Helical; Potential | ||||||
| Topological domain | 839 – 861 | 23 | Cytoplasmic Potential | ||||||
| Transmembrane | 862 – 882 | 21 | Helical; Potential | ||||||
| Topological domain | 883 – 908 | 26 | Extracellular Potential | ||||||
| Transmembrane | 909 – 929 | 21 | Helical; Potential | ||||||
| Topological domain | 930 – 954 | 25 | Cytoplasmic Potential | ||||||
| Transmembrane | 955 – 975 | 21 | Helical; Potential | ||||||
| Topological domain | 976 – 1011 | 36 | Extracellular Potential | ||||||
| Transmembrane | 1012 – 1032 | 21 | Helical; Potential | ||||||
| Topological domain | 1033 – 1034 | 2 | Cytoplasmic Potential | ||||||
| Transmembrane | 1035 – 1055 | 21 | Helical; Potential | ||||||
| Topological domain | 1056 – 1092 | 37 | Extracellular Potential | ||||||
| Transmembrane | 1093 – 1113 | 21 | Helical; Potential | ||||||
| Topological domain | 1114 – 1214 | 101 | Cytoplasmic Potential | ||||||
| Region | 1134 – 1136 | 3 | CA2-binding | ||||||
| Motif | 1211 – 1214 | 4 | PDZ-binding | ||||||
Amino acid modifications | |||||||||
| Modified residue | 233 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 242 | 1 | Phosphoserine Ref.20 | ||||||
| Modified residue | 379 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 403 | 1 | Phosphoserine Ref.15 Ref.20 | ||||||
| Modified residue | 407 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 1167 | 1 | Phosphothreonine Ref.14 Ref.18 | ||||||
| Modified residue | 1176 | 1 | Phosphoserine Ref.14 Ref.18 Ref.19 | ||||||
| Modified residue | 1213 | 1 | Phosphoserine Ref.15 | ||||||
| Glycosylation | 171 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 269 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 398 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 406 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 776 | 1 | N-linked (GlcNAc...) Ref.17 | ||||||
| Glycosylation | 786 | 1 | N-linked (GlcNAc...) Ref.17 | ||||||
| Glycosylation | 791 | 1 | N-linked (GlcNAc...) Ref.17 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 450 | 450 | Missing in isoform 5. | VSP_017159 | |||||
| Alternative sequence | 1 – 90 | 90 | Missing in isoform 3 and isoform 4. | VSP_017160 | |||||
| Alternative sequence | 1 – 11 | 11 | MERFRLEKKLP → MEADGAGEQMRPLLTR in isoform 6 and isoform 9. | VSP_044843 | |||||
| Alternative sequence | 1 – 11 | 11 | MERFRLEKKLP → MEADGAGEQMRPLLTRVTSR in isoform 7 and isoform 8. | VSP_044844 | |||||
| Alternative sequence | 91 – 118 | 28 | SQRVQ…TEMDE → MAVTQFIHFREEIMGNMFFI IIFSTKDK in isoform 3 and isoform 4. | VSP_017161 | |||||
| Alternative sequence | 238 – 250 | 13 | Missing in isoform 8. | VSP_044845 | |||||
| Alternative sequence | 251 – 374 | 124 | Missing in isoform 2, isoform 3, isoform 4, isoform 6 and isoform 9. | VSP_017162 | |||||
| Alternative sequence | 451 – 465 | 15 | PAVLL…VPVPT → MEVVEAEKIVLLTSA in isoform 5. | VSP_017163 | |||||
| Alternative sequence | 1188 | 1 | S → SVDPSIVNISDEMAKTAQWK ALSMNSENAKVTRSNMS in isoform 5, isoform 6, isoform 7 and isoform 8. | VSP_017164 | |||||
| Alternative sequence | 1189 – 1214 | 26 | PDKPV…AETSL → GDPSIGNISDEMAKTAQWKA LSMNTENAKVTRSNMSPDKP VSVK in isoform 3. | VSP_017165 | |||||
| Natural variant | 326 | 1 | E → K. Ref.2 Ref.4 Corresponds to variant rs3755652 [ dbSNP | Ensembl ]. | VAR_055317 | |||||
Experimental info | |||||||||
| Mutagenesis | 1135 – 1136 | 2 | DD → NN: Loss of interaction with CA2. Loss of regulation by CA2. | ||||||
| Mutagenesis | 1163 – 1165 | 3 | DDD → NNN: No effect on interaction with CA2. No effect on regulation by CA2. Ref.10 | ||||||
| Mutagenesis | 1214 | 1 | L → G: Loss of interaction with ATP6V1B1. Ref.9 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning of a new sodium bicarbonate cotransporter cDNA from human retina." Ishibashi K., Sasaki S., Marumo F. Biochem. Biophys. Res. Commun. 246:535-538(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), TISSUE SPECIFICITY. Tissue: Retina. |
| [2] | "Cloning, tissue distribution, genomic organization, and functional characterization of NBC3, a new member of the sodium bicarbonate cotransporter family." Pushkin A., Abuladze N., Lee I., Newman D., Hwang J., Kurtz I. J. Biol. Chem. 274:16569-16575(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), FUNCTION, BIOPHYSICOCHEMICAL PROPERTIES, REGULATION, VARIANT LYS-326. Tissue: Kidney and Skeletal muscle. |
| [3] | "Cloning of a HCO3 transporter, NT2-NBC, from human brain, similar to both the Anion exchangers (AEs) and the Na/Bicarbonate Cotransporters (NBCs)." Romero M.F. Submitted (MAR-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4). Tissue: Neuroepithelium. |
| [4] | "Cloning and identification of novel human NBCn1 splice variants." Liu Y., Chen L.-M., Parker M.D., Boron W.F. Submitted (JUL-2008) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 6; 7; 8 AND 9), ALTERNATIVE SPLICING, VARIANT LYS-326. Tissue: Brain, Liver and Skeletal muscle. |
| [5] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5). Tissue: Cervix. |
| [6] | "The DNA sequence, annotation and analysis of human chromosome 3." Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J. Gibbs R.A.Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "The cystic fibrosis transmembrane conductance regulator interacts with and regulates the activity of the HCO3- salvage transporter human Na+-HCO3-cotransport isoform 3." Park M., Ko S.B.H., Choi J.Y., Muallem G., Thomas P.J., Pushkin A., Lee M.-S., Kim J.Y., Lee M.G., Muallem S., Kurtz I. J. Biol. Chem. 277:50503-50509(2002) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH CFTR AND SLC9A3R1, DOMAIN. |
| [9] | "The COOH termini of NBC3 and the 56-kDa H+-ATPase subunit are PDZ motifs involved in their interaction." Pushkin A., Abuladze N., Newman D., Muronets V., Sassani P., Tatishchev S., Kurtz I. Am. J. Physiol. 284:C667-C673(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH ATP6V1B1 AND SLC9A3R1, MUTAGENESIS OF LEU-1214. |
| [10] | "Regulation of the human NBC3 Na+/HCO3- cotransporter by carbonic anhydrase II and PKA." Loiselle F.B., Morgan P.E., Alvarez B.V., Casey J.R. Am. J. Physiol. 286:C1423-C1433(2004) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH CA2, REGULATION, MUTAGENESIS OF 1135-ASP-ASP-1136 AND 1163-ASP--ASP-1165. |
| [11] | "Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry." Brill L.M., Salomon A.R., Ficarro S.B., Mukherji M., Stettler-Gill M., Peters E.C. Anal. Chem. 76:2763-2772(2004) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Leukemic T-cell. |
| [12] | "Scaffold protein harmonin (USH1C) provides molecular links between Usher syndrome type 1 and type 2." Reiners J., van Wijk E., Maerker T., Zimmermann U., Juergens K., te Brinke H., Overlack N., Roepman R., Knipper M., Kremer H., Wolfrum U. Hum. Mol. Genet. 14:3933-3943(2005) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH USH1C. |
| [13] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [14] | "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis." Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-1167 AND SER-1176, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [15] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-403 AND SER-1213, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-258 (ISOFORM 2), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1010 AND SER-1016 (ISOFORM 3), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-168 (ISOFORMS 3 AND 4), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-774 AND SER-780 (ISOFORM 5), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1105 AND SER-1111 (ISOFORM 6), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-263 (ISOFORMS 6 AND 9), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1233 AND SER-1239 (ISOFORM 7), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1220 AND SER-1226 (ISOFORM 8), MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [16] | "Modular structure of sodium-coupled bicarbonate transporters." Boron W.F., Chen L., Parker M.D. J. Exp. Biol. 212:1697-1706(2009) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW, ALTERNATIVE SPLICING. |
| [17] | "Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins." Wollscheid B., Bausch-Fluck D., Henderson C., O'Brien R., Bibel M., Schiess R., Aebersold R., Watts J.D. Nat. Biotechnol. 27:378-386(2009) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-776; ASN-786 AND ASN-791, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [18] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-1167 AND SER-1176, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-258 (ISOFORM 2), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-168 (ISOFORMS 3 AND 4), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-742 (ISOFORM 5), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1073 (ISOFORM 6), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-263 (ISOFORMS 6 AND 9), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1201 (ISOFORM 7), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1188 (ISOFORM 8), MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [19] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1176, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-255 AND SER-258 (ISOFORM 2), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1007 AND SER-1010 (ISOFORM 3), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-165 AND SER-168 (ISOFORMS 3 AND 4), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-771 AND SER-774 (ISOFORM 5), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1102 AND SER-1105 (ISOFORM 6), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-260 AND SER-263 (ISOFORMS 6 AND 9), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1230 AND SER-1233 (ISOFORM 7), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1217 AND SER-1220 (ISOFORM 8), MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [20] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-242 AND SER-403, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-258 (ISOFORM 2), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1007 (ISOFORM 3), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-168 (ISOFORMS 3 AND 4), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-771 (ISOFORM 5), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1102 (ISOFORM 6), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-263 (ISOFORMS 6 AND 9), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1230 (ISOFORM 7), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1217 (ISOFORM 8), MASS SPECTROMETRY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB012130 mRNA. Translation: BAA25898.1. AF047033 mRNA. Translation: AAD38322.1. AF089726 mRNA. Translation: AAG16773.1. AF053755 mRNA. Translation: AAF21720.1. EU499349 mRNA. Translation: ACB47400.1. EU934248 mRNA. Translation: ACH61960.1. EU934249 mRNA. Translation: ACH61961.1. EU934250 mRNA. Translation: ACH61962.1. CR627428 mRNA. Translation: CAH10515.1. AC099535 Genomic DNA. No translation available. CH471055 Genomic DNA. Translation: EAW64382.1. |
| IPI | IPI00021058. IPI00328342. IPI00387156. IPI00719704. IPI00719757. IPI00926820. IPI00926934. IPI00927879. |
| PIR | JE0160. |
| RefSeq | NP_001245308.1. NM_001258379.1. NP_001245309.1. NM_001258380.1. NP_003606.3. NM_003615.4. |
| UniGene | Hs.250072. |
3D structure databases | |
| ProteinModelPortal | Q9Y6M7. |
| ModBase | Search... |
Protein-protein interaction databases | |
| MINT | MINT-1632023. |
| STRING | 9606.ENSP00000295736. |
PTM databases | |
| PhosphoSite | Q9Y6M7. |
Polymorphism databases | |
| DMDM | 229462789. |
Proteomic databases | |
| PaxDb | Q9Y6M7. |
| PRIDE | Q9Y6M7. |
Protocols and materials databases | |
| DNASU | 9497. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000295736; ENSP00000295736; ENSG00000033867. ENST00000428386; ENSP00000416368; ENSG00000033867. ENST00000437179; ENSP00000394252; ENSG00000033867. ENST00000440156; ENSP00000414797; ENSG00000033867. ENST00000455077; ENSP00000407382; ENSG00000033867. |
| GeneID | 9497. |
| KEGG | hsa:9497. |
| UCSC | uc003cdv.3. human. uc003cdw.3. human. |
Organism-specific databases | |
| CTD | 9497. |
| GeneCards | GC03M027414. |
| HGNC | HGNC:11033. SLC4A7. |
| HPA | CAB022494. HPA035857. |
| MIM | 603353. gene. |
| neXtProt | NX_Q9Y6M7. |
| PharmGKB | PA35899. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG268067. |
| HOGENOM | HOG000280684. |
| HOVERGEN | HBG004326. |
| InParanoid | Q9Y6M7. |
| KO | K13858. |
| OrthoDB | EOG40GCQ3. |
Enzyme and pathway databases | |
| Reactome | REACT_15518. Transmembrane transport of small molecules. |
Gene expression databases | |
| ArrayExpress | Q9Y6M7. |
| Bgee | Q9Y6M7. |
| CleanEx | HS_SLC4A7. |
| Genevestigator | Q9Y6M7. |
| GermOnline | ENSG00000033867. Homo sapiens. |
Family and domain databases | |
| Gene3D | 3.40.1100.10. 2 hits. |
| InterPro | IPR013769. Band3_cytoplasmic_dom. IPR011531. HCO3_transpt_C. IPR003020. HCO3_transpt_euk. IPR016152. PTrfase/Anion_transptr. [Graphical view] |
| PANTHER | PTHR11453. PTHR11453. 1 hit. |
| Pfam | PF07565. Band_3_cyto. 1 hit. PF00955. HCO3_cotransp. 1 hit. [Graphical view] |
| PRINTS | PR01231. HCO3TRNSPORT. |
| SUPFAM | SSF55804. PTrfase/Anion_transptr. 2 hits. |
| TIGRFAMs | TIGR00834. ae. 1 hit. |
| PROSITE | PS00219. ANION_EXCHANGER_1. False negative. PS00220. ANION_EXCHANGER_2. False negative. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | SLC4A7. human. |
| GenomeRNAi | 9497. |
| NextBio | 35478003. |
| SOURCE | Search... |
Entry information
| Entry name | S4A7_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9Y6M7 Secondary accession number(s): A6NIA8 Q9UIB9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
