Q9Y6K9 (NEMO_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 148.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: NF-kappa-B essential modulator Short name=NEMO Alternative name(s): FIP-3 IkB kinase-associated protein 1 Short name=IKKAP1 Inhibitor of nuclear factor kappa-B kinase subunit gamma Short name=I-kappa-B kinase subunit gamma Short name=IKK-gamma Short name=IKKG Short name=IkB kinase subunit gamma NF-kappa-B essential modifier | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 419 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Regulatory subunit of the IKK core complex which phosphorylates inhibitors of NF-kappa-B thus leading to the dissociation of the inhibitor/NF-kappa-B complex and ultimately the degradation of the inhibitor. Its binding to scaffolding polyubiquitin seems to play a role in IKK activation by multiple signaling receptor pathways. However, the specific type of polyubiquitin recognized upon cell stimulation (either 'Lys-63'-linked or linear polyubiquitin) and its functional importance is reported conflictingly. Also considered to be a mediator for TAX activation of NF-kappa-B. Could be implicated in NF-kappa-B-mediated protection from cytokine toxicity By similarity. Essential for viral activation of IRF3. Involved in TLR3- and IFIH1-mediated antiviral innate response; this function requires 'Lys-27'-linked polyubiquitination. Ref.27 Ref.39 Ref.43 |
| Subunit structure | Homodimer; disulfide-linked. Component of the I-kappa-B-kinase (IKK) core complex consisting of CHUK, IKBKB and IKBKG; probably four alpha/CHUK-beta/IKBKB dimers are associated with four gamma/IKBKG subunits. The IKK core complex seems to associate with regulatory or adapter proteins to form a IKK-signalosome holo-complex. The IKK complex associates with TERF2IP/RAP1, leading to promote IKK-mediated phosphorylation of RELA/p65. Part of a complex composed of NCOA2, NCOA3, CHUK/IKKA, IKBKB, IKBKG and CREBBP. Interacts with COPS3, CYLD, NALP2, TRPC4AP and LRDD. Interacts with ATM; the complex is exported from the nucleus. Interacts with TRAF6. Interacts with HTLV-1 Tax oncoprotein; the interaction activates IKBKG. Interacts with TANK; the interaction is enhanced by IKBKE and TBK1. Part of a ternary complex consisting of TANK, IKBKB and IKBKG. Interacts with ZFAND5. Interacts with RIPK2. Interacts with TNIP1 and TNFAIP3; TNIP1 facilitates the TNFAIP3-mediated de-ubiquitination of IKBKG By similarity. Interacts with TNFAIP3; the interaction is induced by TNF stimulation and by polyubiquitin. Binds polyubiquitin; the interaction is mediated by two domains; reports about the binding to 'Lys-63'-linked and/or linear polyubiquitin, respective binding affinities and stoichiometry are conflicting. Interacts with Shigella flexneri ipah9.8; the interaction promotes TNIP1-dependent 'Lys-27'-linked polyubiquitination of IKBKG which perturbs NF-kappa-B activation during bacterial infection. Interacts with NLRP10. Ref.12 Ref.13 Ref.14 Ref.15 Ref.16 Ref.17 Ref.18 Ref.22 Ref.24 Ref.25 Ref.28 Ref.31 Ref.33 Ref.34 Ref.35 Ref.42 Ref.48 Ref.52 Ref.54 Ref.65 |
| Subcellular location | Cytoplasm. Nucleus. Note: Sumoylated NEMO accumulates in the nucleus in response to genotoxic stress. Ref.19 |
| Tissue specificity | Heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. |
| Domain | The leucine-zipper domain and the C2HC-type zinc-finger are essential for polyubiquitin binding and for the activation of IRF3. Ref.39 Ref.53 |
| Post-translational modification | Phosphorylation at Ser-68 attenuates aminoterminal homodimerization. Polyubiquitinated on Lys-285 through 'Lys-63'; the ubiquitination is mediated by NOD2 and RIPK2 and probably plays a role in signaling by facilitating interactions with ubiquitin domain-containing proteins and activates the NF-kappa-B pathway. Polyubiquitinated on Lys-399 through 'Lys-63'; the ubiquitination is mediated by BCL10, MALT1 and TRAF6 and probably plays a role in signaling by facilitating interactions with ubiquitin domain-containing proteins and activates the NF-kappa-B pathway. Monoubiquitinated on Lys-277 and Lys-309; promotes nuclear export. Polyubiquitinated through 'Lys-27' by TRIM23; involved in antiviral innate and inflammatory responses. Linear polyubiquitinated on Lys-111, Lys-143, Lys-226, Lys-246, Lys-264, Lys-277, Lys-285, Lys-292, Lys-302, Lys-309 and Lys-326; the head-to-tail polyubiquitination is mediated by the LUBAC complex and plays a key role in NF-kappa-B activation. Polyubiquitinated on Lys-309 and Lys-321 via 'Lys-27'-linked ubiquitin by Shigella flexneri E3 ubiquitin-protein ligase ipah9.8, leading to its degradation by the proteasome. Sumoylated on Lys-277 and Lys-309 with SUMO1; the modification results in phosphorylation of Ser-85 by ATM leading to a replacement of the sumoylation by mono-ubiquitination on these residues. Ref.19 Neddylated by TRIM40, resulting in stabilization of NFKBIA and down-regulation of NF-kappa-B activity. |
| Involvement in disease | Ectodermal dysplasia, anhidrotic, with immunodeficiency X-linked (EDAID) [MIM:300291]: A form of ectoderma dysplasia, a heterogeneous group of disorders due to abnormal development of two or more ectodermal structures. Characterized by absence of sweat glands, sparse scalp hair, rare conical teeth and immunological abnormalities resulting in severe infectious diseases. Ectodermal dysplasia, anhidrotic, with immunodeficiency, osteopetrosis and lymphedema (OLEDAID) [MIM:300301]: A form of ectoderma dysplasia, a heterogeneous group of disorders due to abnormal development of two or more ectodermal structures. Characterized by the association of anhidrotic ectodermal dysplasia with severe immunodeficiency, osteopetrosis and lymphedema. Immunodeficiency, NEMO-related, without anhidrotic ectodermal dysplasia (NEMOID) [MIM:300584]: Patients manifest immunodeficiency not associated with other abnormalities, and resulting in increased susceptibility to infections. Patients suffer from multiple episodes of infectious diseases. X-linked familial atypical micobacteriosis 1 (AMCBX1) [MIM:300636]: X-linked recessive form of Mendelian susceptibility to mycobacterial disease (MSMD). MSMD is a congenital syndrome resulting in predisposition to clinical disease caused by weakly virulent mycobacterial species, such as bacillus Calmette-Guerin vaccines and non-tuberculous, environmental mycobacteria. Patients are also susceptible to the more virulent species Mycobacterium tuberculosis. Recurrent isolated invasive pneumococcal disease 2 (IPD2) [MIM:300640]: Recurrent invasive pneumococcal disease (IPD) is defined as two episodes of IPD occurring at least 1 month apart, whether caused by the same or different serotypes or strains. Recurrent IPD occurs in at least 2% of patients in most series, making IPD the most important known risk factor for subsequent IPD. Incontinentia pigmenti (IP) [MIM:308300]: A genodermatosis usually prenatally lethal in males. In affected females, it causes abnormalities of the skin, hair, eyes, nails, teeth, skeleton, heart, and central nervous system. The prominent skin signs occur in four classic cutaneous stages: perinatal inflammatory vesicles, verrucous patches, a distinctive pattern of hyperpigmentation and dermal scarring. |
| Sequence similarities | Contains 1 C2HC-type zinc finger. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| ADAP2 | Q9NPF8 | 2 | EBI-81279,EBI-718895 | |
| ANXA1 | P04083 | 6 | EBI-81279,EBI-354007 | |
| ARL6IP4 | Q66PJ3 | 2 | EBI-81279,EBI-2683099 | |
| CALB1 | P05937 | 3 | EBI-81279,EBI-4286943 | |
| CDK2 | P24941 | 4 | EBI-81279,EBI-375096 | |
| CHUK | O15111 | 13 | EBI-81279,EBI-81249 | |
| COPS3 | Q9UNS2 | 2 | EBI-81279,EBI-350590 | |
| FLT3 | P36888 | 2 | EBI-81279,EBI-3946257 | |
| GIT2 | Q14161 | 6 | EBI-81279,EBI-1046878 | |
| IKBKB | O14920 | 14 | EBI-81279,EBI-81266 | |
| ipaH9.8 | Q8VSC3 | 8 | EBI-81279,EBI-6125799 | From a different organism. |
| KRT18 | P05783 | 3 | EBI-81279,EBI-297888 | |
| KRT8 | P05787 | 2 | EBI-81279,EBI-297852 | |
| NFKBIA | P25963 | 2 | EBI-81279,EBI-307386 | |
| RIPK1 | Q13546 | 6 | EBI-81279,EBI-358507 | |
| RNF7 | Q9UBF6 | 3 | EBI-81279,EBI-398632 | |
| RUSC1 | Q9BVN2-2 | 4 | EBI-81279,EBI-6257338 | |
| SENP2 | Q9HC62 | 3 | EBI-81279,EBI-714881 | |
| SRC | P12931 | 3 | EBI-81279,EBI-621482 | |
| SYT1 | P21579 | 3 | EBI-81279,EBI-524909 | |
| TNFAIP3 | P21580 | 2 | EBI-81279,EBI-527670 | |
| TNIP1 | Q15025 | 4 | EBI-81279,EBI-357849 | |
| TNIP2 | Q8NFZ5 | 6 | EBI-81279,EBI-359372 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9Y6K9-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9Y6K9-2) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MALVIQVGKLRPREVRTPQTINPSLFPSLPVKLSSIIEVPSGGERCCSRRTLVYKARAFWKGAPLPCWM | ||||||
| Isoform 3 (identifier: Q9Y6K9-3) The sequence of this isoform differs from the canonical sequence as follows: 174-224: Missing. 257-304: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||
Molecule processing | ||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 419 | 419 | NF-kappa-B essential modulator | PRO_0000096782 | ||||||||||||||||||
Regions | ||||||||||||||||||||||
| Zinc finger | 396 – 417 | 22 | C2HC-type | |||||||||||||||||||
| Region | 44 – 111 | 68 | Interaction with CHUK/IKBKB | |||||||||||||||||||
| Region | 150 – 257 | 108 | Interaction with TANK | |||||||||||||||||||
| Region | 242 – 350 | 109 | Ubiquitin-binding (UBD) | |||||||||||||||||||
| Region | 246 – 365 | 120 | Self-association | |||||||||||||||||||
| Region | 251 – 419 | 169 | Required for interaction with TNFAIP3 | |||||||||||||||||||
| Region | 322 – 343 | 22 | Leucine-zipper Potential | |||||||||||||||||||
| Region | 382 – 419 | 38 | Interaction with CYLD | |||||||||||||||||||
| Coiled coil | 49 – 356 | 308 | Potential | |||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||
| Modified residue | 31 | 1 | Phosphoserine; by IKKB Ref.20 | |||||||||||||||||||
| Modified residue | 43 | 1 | Phosphoserine; by IKKB Ref.20 | |||||||||||||||||||
| Modified residue | 68 | 1 | Phosphoserine Ref.35 | |||||||||||||||||||
| Modified residue | 85 | 1 | Phosphoserine; by ATM Ref.31 | |||||||||||||||||||
| Modified residue | 376 | 1 | Phosphoserine; by IKKB Ref.20 | |||||||||||||||||||
| Disulfide bond | 54 | Interchain Ref.33 | ||||||||||||||||||||
| Disulfide bond | 347 | Interchain Ref.33 | ||||||||||||||||||||
| Cross-link | 111 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) Ref.51 | ||||||||||||||||||||
| Cross-link | 139 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) Ref.51 | ||||||||||||||||||||
| Cross-link | 143 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) Ref.51 | ||||||||||||||||||||
| Cross-link | 226 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) Ref.51 | ||||||||||||||||||||
| Cross-link | 246 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) Ref.51 | ||||||||||||||||||||
| Cross-link | 264 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) Ref.51 | ||||||||||||||||||||
| Cross-link | 277 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO); alternate Ref.19 Ref.51 | ||||||||||||||||||||
| Cross-link | 277 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternate | ||||||||||||||||||||
| Cross-link | 283 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) Ref.51 | ||||||||||||||||||||
| Cross-link | 285 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) Ref.23 Ref.40 Ref.51 | ||||||||||||||||||||
| Cross-link | 292 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) Ref.51 | ||||||||||||||||||||
| Cross-link | 302 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) Ref.51 | ||||||||||||||||||||
| Cross-link | 309 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO); alternate Ref.19 Ref.40 Ref.42 Ref.51 | ||||||||||||||||||||
| Cross-link | 309 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternate | ||||||||||||||||||||
| Cross-link | 321 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) Ref.42 | ||||||||||||||||||||
| Cross-link | 325 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) By similarity | ||||||||||||||||||||
| Cross-link | 326 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) By similarity | ||||||||||||||||||||
| Cross-link | 399 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) Ref.27 | ||||||||||||||||||||
Natural variations | ||||||||||||||||||||||
| Alternative sequence | 1 | 1 | M → MALVIQVGKLRPREVRTPQT INPSLFPSLPVKLSSIIEVP SGGERCCSRRTLVYKARAFW KGAPLPCWM in isoform 2. | VSP_041000 | ||||||||||||||||||
| Alternative sequence | 174 – 224 | 51 | Missing in isoform 3. | VSP_041001 | ||||||||||||||||||
| Alternative sequence | 257 – 304 | 48 | Missing in isoform 3. | VSP_041002 | ||||||||||||||||||
| Natural variant | 57 | 1 | E → K in IP; shows the same luciferase activity as the control. Ref.57 Ref.61 Corresponds to variant rs148695964 [ dbSNP | Ensembl ]. | VAR_026491 | ||||||||||||||||||
| Natural variant | 90 | 1 | Missing in IP; only 46.3% of the activation obtained with the wild-type protein. Ref.61 | VAR_026492 | ||||||||||||||||||
| Natural variant | 113 | 1 | D → N. Ref.61 Corresponds to variant rs179363896 [ dbSNP | Ensembl ]. | VAR_026493 | ||||||||||||||||||
| Natural variant | 123 | 1 | R → W in IP; shows the same luciferase activity as the control. Ref.61 Corresponds to variant rs179363895 [ dbSNP | Ensembl ]. | VAR_026494 | ||||||||||||||||||
| Natural variant | 153 | 1 | L → R in EDAID. Ref.60 Ref.62 | VAR_026495 | ||||||||||||||||||
| Natural variant | 173 | 1 | R → G in IPD2. Ref.66 Corresponds to variant rs179363866 [ dbSNP | Ensembl ]. | VAR_031958 | ||||||||||||||||||
| Natural variant | 175 | 1 | R → P in EDAID. Ref.58 Corresponds to variant rs179363868 [ dbSNP | Ensembl ]. | VAR_011320 | ||||||||||||||||||
| Natural variant | 227 | 1 | L → P in EDAID. Ref.58 Corresponds to variant rs179363869 [ dbSNP | Ensembl ]. | VAR_011321 | ||||||||||||||||||
| Natural variant | 288 | 1 | A → G in EDAID. Ref.58 | VAR_011322 | ||||||||||||||||||
| Natural variant | 311 | 1 | D → N in EDAID; abolishes binding to polyubiquitin ('K63'-linked and linear) and greatly impairs tandem ubiquitin binding. Ref.29 Ref.47 Ref.55 Ref.58 Corresponds to variant rs179363867 [ dbSNP | Ensembl ]. | VAR_011323 | ||||||||||||||||||
| Natural variant | 315 | 1 | E → A in AMCBX1; greatly impairs tandem ubiquitin binding. Ref.55 Ref.64 | VAR_031959 | ||||||||||||||||||
| Natural variant | 319 | 1 | R → Q in AMCBX1; impairs tandem ubiquitin binding. Ref.55 Ref.64 | VAR_031960 | ||||||||||||||||||
| Natural variant | 323 | 1 | A → P in IP; diminishes interaction with TRAF6 and polyubiquitination, greatly impairs tandem ubiquitin binding. Ref.55 Ref.65 Corresponds to variant rs179363865 [ dbSNP | Ensembl ]. | VAR_042666 | ||||||||||||||||||
| Natural variant | 406 | 1 | D → V in EDAID. Ref.59 | VAR_011324 | ||||||||||||||||||
| Natural variant | 407 | 1 | M → V in IP; impairs binding to ubiquitin. Ref.4 Ref.38 Ref.57 | VAR_009182 | ||||||||||||||||||
| Natural variant | 417 | 1 | C → F in EDAID. Ref.53 Ref.56 Ref.58 Corresponds to variant rs137853326 [ dbSNP | Ensembl ]. | VAR_011325 | ||||||||||||||||||
| Natural variant | 417 | 1 | C → R in EDAID; loss of sumoylation. Ref.19 Ref.56 Ref.58 Ref.59 Ref.60 Ref.62 | VAR_011326 | ||||||||||||||||||
| Natural variant | 417 | 1 | C → Y in NEMOID. Ref.62 Corresponds to variant rs137853326 [ dbSNP | Ensembl ]. | VAR_026496 | ||||||||||||||||||
Experimental info | ||||||||||||||||||||||
| Mutagenesis | 68 | 1 | S → A: Increases formation of homodimers. Ref.35 | |||||||||||||||||||
| Mutagenesis | 68 | 1 | S → E: Abolishes interaction with IKBKB; abolishes TNF-alpha induced NF-kappa-B activity. Ref.35 | |||||||||||||||||||
| Mutagenesis | 85 | 1 | S → A: Decreases ubiquitination and abolishes nuclear export. Ref.31 | |||||||||||||||||||
| Mutagenesis | 115 | 1 | K → R: No change in the ubiquitination level; when associated with R-399. Ref.23 | |||||||||||||||||||
| Mutagenesis | 224 | 1 | K → R: No change in the ubiquitination level; when associated with R-399. Ref.23 | |||||||||||||||||||
| Mutagenesis | 277 | 1 | K → A: Partial abolition of sumoylation. Abolishes sumoylation and IKK activation; when associated with A-309. Ref.19 | |||||||||||||||||||
| Mutagenesis | 285 | 1 | K → R: Important decrease in the ubiquitination level; when associated with R-399. Ref.23 | |||||||||||||||||||
| Mutagenesis | 296 | 1 | E → A: No effet on oligomerization,impairs binding of 'Lys-63'-linked ubiuitin and linear tetra-ubiquitin, impairs TNF-induced NF-kappa-B activation. Ref.41 | |||||||||||||||||||
| Mutagenesis | 300 | 1 | V → D: Greatly impairs tandem ubiquitin binding. Ref.55 | |||||||||||||||||||
| Mutagenesis | 301 | 1 | L → A: Impairs tandem ubiquitin binding. Ref.55 | |||||||||||||||||||
| Mutagenesis | 304 | 1 | Q → A: Impairs tandem ubiquitin binding. Ref.55 | |||||||||||||||||||
| Mutagenesis | 307 | 1 | I → N: Greatly impairs tandem ubiquitin binding. Ref.55 | |||||||||||||||||||
| Mutagenesis | 308 | 1 | Y → A: Greatly impairs tandem ubiquitin binding. Ref.55 | |||||||||||||||||||
| Mutagenesis | 309 | 1 | K → A: Partial abolition of sumoylation. Abolishes sumoylation and IKK activation; when associated with A-277. Ref.19 | |||||||||||||||||||
| Mutagenesis | 312 | 1 | F → A: Greatly impairs tandem ubiquitin binding,impairs oligomerization, impairs TNF-induced NF-kappa-B activation. Ref.41 Ref.55 | |||||||||||||||||||
| Mutagenesis | 312 | 1 | F → W: MNo effet on oligomerization, preferentially binds tri-ubiquitin chains ('Lys-48' or 'Lys-63'-linked). Ref.41 Ref.55 | |||||||||||||||||||
| Mutagenesis | 312 | 1 | F → Y: Impairs tandem ubiquitin binding. Ref.41 Ref.55 | |||||||||||||||||||
| Mutagenesis | 313 | 1 | Q → A: Impairs tandem ubiquitin binding. Ref.55 | |||||||||||||||||||
| Mutagenesis | 315 | 1 | E → A: Impairs oligomerization, impairs binding of 'Lys-63'-linked ubiuitin and linear tetra-ubiquitin, impairs TNF-induced NF-kappa-B activation. Ref.41 | |||||||||||||||||||
| Mutagenesis | 315 | 1 | E → Q: Greatly impairs tandem ubiquitin binding. Ref.41 | |||||||||||||||||||
| Mutagenesis | 317 | 1 | Q → A or W: Greatly impairs tandem ubiquitin binding. Ref.55 | |||||||||||||||||||
| Mutagenesis | 323 | 1 | A → D: Greatly impairs tandem ubiquitin binding. Ref.41 | |||||||||||||||||||
| Mutagenesis | 323 | 1 | A → P: Impairs oligomerization, greatly impairs binding of 'Lys-63'-linked ubiuitin, and linear tetra-ubiquitin, impairs TNF-induced NF-kappa-B activation. Ref.41 | |||||||||||||||||||
| Mutagenesis | 329 | 1 | L → A: Impairs oligomerization, impairs binding of 'Lys-63'-linked ubiuitin, impairs TNF-induced NF-kappa-B activation; when associated with A-336. Ref.29 Ref.41 | |||||||||||||||||||
| Mutagenesis | 329 | 1 | L → P: Abolishes binding to polyubiquitin. Ref.29 Ref.41 | |||||||||||||||||||
| Mutagenesis | 336 | 1 | L → A: Impairs oligomerization, impairs binding of 'Lys-63'-linked ubiuitin, impairs TNF-induced NF-kappa-B activation; when associated with A-329. Ref.41 | |||||||||||||||||||
| Mutagenesis | 399 | 1 | K → R: Abolishes BCL10-mediated but not RIPK2-mediated ubiquitination. Important decrease in the ubiquitination level; when associated with R-285. No change in the ubiquitination level; when associated with R-115 or R-224. Ref.23 Ref.27 | |||||||||||||||||||
| Mutagenesis | 414 | 1 | V → S: Abolishes binding to polyubiquitin. Ref.38 | |||||||||||||||||||
| Mutagenesis | 415 | 1 | M → S: Impairs binding to polyubiquitin. Ref.38 | |||||||||||||||||||
| Sequence conflict | 341 | 1 | S → R in AAD12183. Ref.1 | |||||||||||||||||||
| Sequence conflict | 387 | 1 | S → R in AAD12183. Ref.1 | |||||||||||||||||||
Secondary structure | ||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||
| Helix | 50 – 108 | 59 | ||||||||||||||||||||
| Turn | 194 – 196 | 3 | ||||||||||||||||||||
| Helix | 197 – 249 | 53 | ||||||||||||||||||||
| Turn | 271 – 279 | 9 | ||||||||||||||||||||
| Helix | 280 – 321 | 42 | ||||||||||||||||||||
| Beta strand | 394 – 396 | 3 | ||||||||||||||||||||
| Beta strand | 403 – 406 | 4 | ||||||||||||||||||||
| Helix | 407 – 416 | 10 | ||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification of a cell protein (FIP-3) as a modulator of NF-kappaB activity and as a target of an adenovirus inhibitor of tumor necrosis factor alpha-induced apoptosis." Li Y., Kang J., Friedman J., Tarassishin L., Ye J., Kovalenko A., Wallach D., Horwitz M.S. Proc. Natl. Acad. Sci. U.S.A. 96:1042-1047(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Isolation of full-length cDNA and chromosomal localization of human NF-kappaB modulator NEMO to Xq28." Jin D.-Y., Jeang K.-T. J. Biomed. Sci. 6:115-120(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Mammary cancer. |
| [3] | "IKK-gamma is an essential regulatory subunit of the IkappaB kinase complex." Rothwarf D.M., Zandi E., Natoli G., Karin M. Nature 395:297-300(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PARTIAL PROTEIN SEQUENCE. Tissue: Cervix carcinoma. |
| [4] | "Genomic rearrangement in NEMO impairs NF-kappaB activation and is a cause of incontinentia pigmenti." Smahi A., Courtois G., Vabres P., Yamaoka S., Heuertz S., Munnich A., Israel A., Heiss N.S., Klauck S.M., Kioschis P., Wiemann S., Poustka A., Esposito T., Bardaro T., Gianfrancesco F., Ciccodicola A., D'Urso M., Woffendin H. Nelson D.L.Nature 405:466-472(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT IP VAL-407. |
| [5] | "cDNA cloning by amplification of circularized first strand cDNAs reveals non-IRE-regulated iron-responsive mRNAs." Ye Z., Connor J.R. Biochem. Biophys. Res. Commun. 275:223-227(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Astrocytoma. |
| [6] | "Ikbkg gene modulates the herpes virus susceptibility in mice." Perelygin A.A., Perelygina L.M. Submitted (MAY-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). |
| [7] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). |
| [8] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (OCT-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [9] | "The DNA sequence of the human X chromosome." Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C. Bentley D.R.Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [10] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Lung, Placenta and Skin. |
| [11] | "IkappaB kinase (IKK)-associated protein 1, a common component of the heterogeneous IKK complex." Mercurio F., Murray B.W., Shevchenko A., Bennett B.L., Young D.B., Li J.W., Pascual G., Motiwala A., Zhu H., Mann M., Manning A.M. Mol. Cell. Biol. 19:1526-1538(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 51-419 (ISOFORM 1), PROTEIN SEQUENCE OF 144-159. Tissue: Cervix carcinoma. |
| [12] | "Role of adapter function in oncoprotein-mediated activation of NF-kappaB: human T-cell leukemia virus type I Tax interacts directly with IkappaB kinase gamma." Jin D.-Y., Giordano V., Kibler K.V., Nakano H., Jeang K.-T. J. Biol. Chem. 274:17402-17405(1999) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH HTLV-1 TAX-1. |
| [13] | "Activation of IKKalpha and IKKbeta through their fusion with HTLV-I tax protein." Xiao G., Sun S.C. Oncogene 19:5198-5203(2000) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH HTLV-1 TAX-1. |
| [14] | "Functional redundancy of the zinc fingers of A20 for inhibition of NF-kappaB activation and protein-protein interactions." Klinkenberg M., Van Huffel S., Heyninck K., Beyaert R. FEBS Lett. 498:93-97(2001) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH TNFAIP3. |
| [15] | "CSN3 interacts with IKKgamma and inhibits TNF- but not IL-1-induced NF-kappaB activation." Hong X., Xu L.-G., Li X., Zhai Z., Shu H.-B. FEBS Lett. 499:133-136(2001) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH COPS3. |
| [16] | "Role of ikkgamma/nemo in assembly of the IkappaB kinase complex." Li X.-H., Fang X., Gaynor R.B. J. Biol. Chem. 276:4494-4500(2001) [PubMed] [Europe PMC] [Abstract] Cited for: SUBUNIT OF THE IKK COMPLEX. |
| [17] | "Association of the adaptor TANK with the I kappa B kinase (IKK) regulator NEMO connects IKK complexes with IKK epsilon and TBK1 kinases." Chariot A., Leonardi A., Muller J., Bonif M., Brown K., Siebenlist U. J. Biol. Chem. 277:37029-37036(2002) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH TANK AND IKBKB. |
| [18] | "Regulation of SRC-3 (pCIP/ACTR/AIB-1/RAC-3/TRAM-1) coactivator activity by I kappa B kinase." Wu R.-C., Qin J., Hashimoto Y., Wong J., Xu J., Tsai S.Y., Tsai M.-J., O'Malley B.W. Mol. Cell. Biol. 22:3549-3561(2002) [PubMed] [Europe PMC] [Abstract] Cited for: SUBUNIT OF A COMPLEX CONTAINING CREBBP; NCOA2; NCOA3; IKKA AND IKKB. |
| [19] | "Sequential modification of NEMO/IKKgamma by SUMO-1 and ubiquitin mediates NF-kappaB activation by genotoxic stress." Huang T.T., Wuerzberger-Davis S.M., Wu Z.H., Miyamoto S. Cell 115:565-576(2003) [PubMed] [Europe PMC] [Abstract] Cited for: SUMOYLATION AT LYS-277 AND LYS-309, UBIQUITINATION AT LYS-277 AND LYS-309, MUTAGENESIS OF LYS-277 AND LYS-309, SUBCELLULAR LOCATION, CHARACTERIZATION OF VARIANT EDAID ARG-417. |
| [20] | "In vivo identification of inducible phosphoacceptors in the IKKgamma/NEMO subunit of human IkappaB kinase." Carter R.S., Pennington K.N., Ungurait B.J., Ballard D.W. J. Biol. Chem. 278:19642-19648(2003) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT SER-31; SER-43 AND SER-376. |
| [21] | "Tetrameric oligomerization of IkappaB kinase gamma (IKKgamma) is obligatory for IKK complex activity and NF-kappaB activation." Tegethoff S., Behlke J., Scheidereit C. Mol. Cell. Biol. 23:2029-2041(2003) [PubMed] [Europe PMC] [Abstract] Cited for: SELF-ASSOCIATION, COMPOSITION OF THE IKK COMPLEX. |
| [22] | "The tumour suppressor CYLD negatively regulates NF-kappaB signalling by deubiquitination." Kovalenko A., Chable-Bessia C., Cantarella G., Israeel A., Wallach D., Courtois G. Nature 424:801-805(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH CYLD. |
| [23] | "The Crohn's disease protein, NOD2, requires RIP2 in order to induce ubiquitinylation of a novel site on NEMO." Abbott D.W., Wilkins A., Asara J.M., Cantley L.C. Curr. Biol. 14:2217-2227(2004) [PubMed] [Europe PMC] [Abstract] Cited for: UBIQUITINATION AT LYS-285, MUTAGENESIS OF LYS-115; LYS-224; LYS-285 AND LYS-399. |
| [24] | "ZNF216 is an A20-like and IkappaB kinase gamma-interacting inhibitor of NFkappaB activation." Huang J., Teng L., Li L., Liu T., Li L., Chen D., Xu L.-G., Zhai Z., Shu H.-B. J. Biol. Chem. 279:16847-16853(2004) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH ZFAND5. |
| [25] | "PAN1/NALP2/PYPAF2, an inducible inflammatory mediator that regulates NF-kappaB and caspase-1 activation in macrophages." Bruey J.-M., Bruey-Sedano N., Newman R., Chandler S., Stehlik C., Reed J.C. J. Biol. Chem. 279:51897-51907(2004) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH NALP2. |
| [26] | "The TRAF6 ubiquitin ligase and TAK1 kinase mediate IKK activation by BCL10 and MALT1 in T lymphocytes." Sun L., Deng L., Ea C.-K., Xia Z.-P., Chen Z.J. Mol. Cell 14:289-301(2004) [PubMed] [Europe PMC] [Abstract] Cited for: UBIQUITINATION. |
| [27] | "Bcl10 activates the NF-kappaB pathway through ubiquitination of NEMO." Zhou H., Wertz I., O'Rourke K., Ultsch M., Seshagiri S., Eby M., Xiao W., Dixit V.M. Nature 427:167-171(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, UBIQUITINATION AT LYS-399, MUTAGENESIS OF LYS-399. |
| [28] | "PIDD mediates NF-kappaB activation in response to DNA damage." Janssens S., Tinel A., Lippens S., Tschopp J. Cell 123:1079-1092(2005) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH LRDD. |
| [29] | "Sensing of Lys 63-linked polyubiquitination by NEMO is a key event in NF-kappaB activation." Wu C.J., Conze D.B., Li T., Srinivasula S.M., Ashwell J.D. Nat. Cell Biol. 8:398-406(2006) [PubMed] [Europe PMC] [Abstract] Cited for: UBIQUITIN-BINDING, MUTAGENESIS OF PRO-329, CHARACTERIZATION OF VARIANT EDAID ASN-311. |
| [30] | Erratum Wu C.J., Conze D.B., Li T., Srinivasula S.M., Ashwell J.D. Nat. Cell Biol. 8:424-424(2006) |
| [31] | "Molecular linkage between the kinase ATM and NF-kappaB signaling in response to genotoxic stimuli." Wu Z.H., Shi Y., Tibbetts R.S., Miyamoto S. Science 311:1141-1146(2006) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH ATM, PHOSPHORYLATION AT SER-85, MUTAGENESIS OF SER-85. |
| [32] | "Site-specific Lys-63-linked tumor necrosis factor receptor-associated factor 6 auto-ubiquitination is a critical determinant of I kappa B kinase activation." Lamothe B., Besse A., Campos A.D., Webster W.K., Wu H., Darnay B.G. J. Biol. Chem. 282:4102-4112(2007) [PubMed] [Europe PMC] [Abstract] Cited for: UBIQUITINATION. |
| [33] | "Intermolecular disulfide bond formation in the NEMO dimer requires Cys54 and Cys347." Herscovitch M., Comb W., Ennis T., Coleman K., Yong S., Armstead B., Kalaitzidis D., Chandani S., Gilmore T.D. Biochem. Biophys. Res. Commun. 367:103-108(2008) [PubMed] [Europe PMC] [Abstract] Cited for: SUBUNIT, DISULFIDE BONDS. |
| [34] | "A critical role of RICK/RIP2 polyubiquitination in Nod-induced NF-kappaB activation." Hasegawa M., Fujimoto Y., Lucas P.C., Nakano H., Fukase K., Nunez G., Inohara N. EMBO J. 27:373-383(2008) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH RIPK2. |
| [35] | "Phosphorylation of serine 68 in the IkappaB kinase (IKK)-binding domain of NEMO interferes with the structure of the IKK complex and tumor necrosis factor-alpha-induced NF-kappaB activity." Palkowitsch L., Leidner J., Ghosh S., Marienfeld R.B. J. Biol. Chem. 283:76-86(2008) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH IKBKB, PHOSPHORYLATION AT SER-68, MUTAGENESIS OF SER-68. |
| [36] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [37] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [38] | "The zinc finger of NEMO is a functional ubiquitin-binding domain." Cordier F., Grubisha O., Traincard F., Veron M., Delepierre M., Agou F. J. Biol. Chem. 284:2902-2907(2009) [PubMed] [Europe PMC] [Abstract] Cited for: UBIQUITIN-BINDING, MUTAGENESIS OF VAL-414 AND MET-415, CHARACTERIZATION OF VARIANT IP VAL-407. |
| [39] | "Key role of Ubc5 and lysine-63 polyubiquitination in viral activation of IRF3." Zeng W., Xu M., Liu S., Sun L., Chen Z.J. Mol. Cell 36:315-325(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, DOMAIN LEUCINE-ZIPPER AND C2HC-TYPE ZINC-FINGER. |
| [40] | "Involvement of linear polyubiquitylation of NEMO in NF-kappaB activation." Tokunaga F., Sakata S., Saeki Y., Satomi Y., Kirisako T., Kamei K., Nakagawa T., Kato M., Murata S., Yamaoka S., Yamamoto M., Akira S., Takao T., Tanaka K., Iwai K. Nat. Cell Biol. 11:123-132(2009) [PubMed] [Europe PMC] [Abstract] Cited for: UBIQUITINATION AT LYS-285 AND LYS-309. |
| [41] | "DARPin-assisted crystallography of the CC2-LZ domain of NEMO reveals a coupling between dimerization and ubiquitin binding." Grubisha O., Kaminska M., Duquerroy S., Fontan E., Cordier F., Haouz A., Raynal B., Chiaravalli J., Delepierre M., Israel A., Veron M., Agou F. J. Mol. Biol. 395:89-104(2010) [PubMed] [Europe PMC] [Abstract] Cited for: MUTAGENESIS OF GLU-296; PHE-312; GLU-315; ALA-323; LEU-329 AND LEU-336. |
| [42] | "A bacterial E3 ubiquitin ligase IpaH9.8 targets NEMO/IKKgamma to dampen the host NF-kappaB-mediated inflammatory response." Ashida H., Kim M., Schmidt-Supprian M., Ma A., Ogawa M., Sasakawa C. Nat. Cell Biol. 12:66-73(2010) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH SHIGELLA FLEXNERI IPAH9.8, UBIQUITINATION AT LYS-309 AND LYS-321. |
| [43] | "Polyubiquitin conjugation to NEMO by tripartite motif protein 23 (TRIM23) is critical in antiviral defense." Arimoto K., Funami K., Saeki Y., Tanaka K., Okawa K., Takeuchi O., Akira S., Murakami Y., Shimotohno K. Proc. Natl. Acad. Sci. U.S.A. 107:15856-15861(2010) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, UBIQUITINATION. |
| [44] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [45] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [46] | "TRIM40 promotes neddylation of IKKgamma and is downregulated in gastrointestinal cancers." Noguchi K., Okumura F., Takahashi N., Kataoka A., Kamiyama T., Todo S., Hatakeyama S. Carcinogenesis 32:995-1004(2011) [PubMed] [Europe PMC] [Abstract] Cited for: NEDDYLATION BY TRIM40. |
| [47] | "Polyubiquitin binding to ABIN1 is required to prevent autoimmunity." Nanda S.K., Venigalla R.K., Ordureau A., Patterson-Kane J.C., Powell D.W., Toth R., Arthur J.S., Cohen P. J. Exp. Med. 208:1215-1228(2011) [PubMed] [Europe PMC] [Abstract] Cited for: UBIQUITIN-BINDING, CHARACTERIZATION OF VARIANT EDAID ASN-311. |
| [48] | "Direct, noncatalytic mechanism of IKK inhibition by A20." Skaug B., Chen J., Du F., He J., Ma A., Chen Z.J. Mol. Cell 44:559-571(2011) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH TNFAIP3. |
| [49] | "Linear ubiquitination prevents inflammation and regulates immune signalling." Gerlach B., Cordier S.M., Schmukle A.C., Emmerich C.H., Rieser E., Haas T.L., Webb A.I., Rickard J.A., Anderton H., Wong W.W., Nachbur U., Gangoda L., Warnken U., Purcell A.W., Silke J., Walczak H. Nature 471:591-596(2011) [PubMed] [Europe PMC] [Abstract] Cited for: UBIQUITINATION BY THE LUBAC COMPLEX. |
| [50] | "SHARPIN is a component of the NF-kappaB-activating linear ubiquitin chain assembly complex." Tokunaga F., Nakagawa T., Nakahara M., Saeki Y., Taniguchi M., Sakata S., Tanaka K., Nakano H., Iwai K. Nature 471:633-636(2011) [PubMed] [Europe PMC] [Abstract] Cited for: UBIQUITINATION BY THE LUBAC COMPLEX. |
| [51] | "SHARPIN forms a linear ubiquitin ligase complex regulating NF-kappaB activity and apoptosis." Ikeda F., Deribe Y.L., Skanland S.S., Stieglitz B., Grabbe C., Franz-Wachtel M., van Wijk S.J., Goswami P., Nagy V., Terzic J., Tokunaga F., Androulidaki A., Nakagawa T., Pasparakis M., Iwai K., Sundberg J.P., Schaefer L., Rittinger K., Macek B., Dikic I. Nature 471:637-641(2011) [PubMed] [Europe PMC] [Abstract] Cited for: UBIQUITINATION AT LYS-277; LYS-285; LYS-309; LYS-326; LYS-111; LYS-143; LYS-226; LYS-246; LYS-264; LYS-292 AND LYS-302 BY THE LUBAC COMPLEX, UBIQUITINATION AT LYS-139 AND LYS-283. |
| [52] | "NLRP10 enhances Shigella-induced pro-inflammatory responses." Lautz K., Damm A., Menning M., Wenger J., Adam A.C., Zigrino P., Kremmer E., Kufer T.A. Cell. Microbiol. 14:1568-1583(2012) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH NLRP10. |
| [53] | "Solution structure of NEMO zinc finger and impact of an anhidrotic ectodermal dysplasia with immunodeficiency-related point mutation." Cordier F., Vinolo E., Veron M., Delepierre M., Agou F. J. Mol. Biol. 377:1419-1432(2008) [PubMed] [Europe PMC] [Abstract] Cited for: STRUCTURE BY NMR OF 394-419 OF WILD-TYPE AND MUTANT PHE-417, DOMAIN ZINC FINGER. |
| [54] | "Structure of a NEMO/IKK-associating domain reveals architecture of the interaction site." Rushe M., Silvian L., Bixler S., Chen L.L., Cheung A., Bowes S., Cuervo H., Berkowitz S., Zheng T., Guckian K., Pellegrini M., Lugovskoy A. Structure 16:798-808(2008) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.2 ANGSTROMS) OF 44-111 IN COMPLEX WITH CHUK AND IKBKB, SUBUNIT. |
| [55] | "Structural basis for recognition of diubiquitins by NEMO." Lo Y.C., Lin S.C., Rospigliosi C.C., Conze D.B., Wu C.J., Ashwell J.D., Eliezer D., Wu H. Mol. Cell 33:602-615(2009) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (3.2 ANGSTROMS) OF 246-337, UBIQUITIN-BINDING, MUTAGENESIS OF VAL-300; LEU-301; GLN-304; ILE-307; TYR-308; PHE-312; GLN-313 AND GLN-317, CHARACTERIZATION OF VARIANT EDAID ASN-311, CHARACTERIZATION OF VARIANT AMCBX1 ALA-315, CHARACTERIZATION OF VARIANTS GLN-319 AND IP PRO-323. |
| [56] | "A novel X-linked disorder of immune deficiency and hypohidrotic ectodermal dysplasia is allelic to incontinentia pigmenti and due to mutations in IKK-gamma (NEMO)." Zonana J., Elder M.E., Schneider L.C., Orlow S.J., Moss C., Golabi M., Shapira S.K., Farndon P.A., Wara D.W., Emmal S.A., Ferguson B.M. Am. J. Hum. Genet. 67:1555-1562(2000) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS EDAID ARG-417 AND PHE-417. |
| [57] | "A recurrent deletion in the ubiquitously expressed NEMO (IKK-gamma) gene accounts for the vast majority of incontinentia pigmenti mutations." Aradhya S., Woffendin H., Jakins T., Bardaro T., Esposito T., Smahi A., Shaw C., Levy M., Munnich A., D'Urso M., Lewis R.A., Kenwrick S., Nelson D.L. Hum. Mol. Genet. 10:2171-2179(2001) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS IP LYS-57 AND VAL-407. |
| [58] | "X-linked anhidrotic ectodermal dysplasia with immunodeficiency is caused by impaired NF-kappa B signaling." Doeffinger R., Smahi A., Bessia C., Geissmann F., Feinberg J., Durandy A., Bodemer C., Kenwrick S.J., Dupuis-Girod S., Blanche S., Wood P., Rabia S.H., Headon D.J., Overbeek P.A., Le Deist F., Holland S.M., Belani K., Kumararatne D.S. Casanova J.-L.Nat. Genet. 27:277-285(2001) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS EDAID PRO-175; PRO-227; GLY-288; ASN-311; ARG-417 AND PHE-417. |
| [59] | "Specific missense mutations in NEMO result in hyper-IgM syndrome with hypohydrotic ectodermal dysplasia." Jain A., Ma C.A., Liu S., Brown M., Cohen J., Strober W. Nat. Immunol. 2:223-228(2001) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS EDAID VAL-406 AND ARG-417. |
| [60] | "Deficient natural killer cell cytotoxicity in patients with IKK-gamma/NEMO mutations." Orange J.S., Brodeur S.R., Jain A., Bonilla F.A., Schneider L.C., Kretschmer R., Nurko S., Rasmussen W.L., Koehler J.R., Gellis S.E., Ferguson B.M., Strominger J.L., Zonana J., Ramesh N., Ballas Z.K., Geha R.S. J. Clin. Invest. 109:1501-1509(2002) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS EDAID ARG-153 AND ARG-417. |
| [61] | "Molecular analysis of the genetic defect in a large cohort of IP patients and identification of novel NEMO mutations interfering with NF-kappaB activation." Fusco F., Bardaro T., Fimiani G., Mercadante V., Miano M.G., Falco G., Israeel A., Courtois G., D'Urso M., Ursini M.V. Hum. Mol. Genet. 13:1763-1773(2004) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS IP LYS-57; LYS-90 DEL AND TRP-123, VARIANT ASN-113, CHARACTERIZATION OF VARIANTS IP LYS-57; LYS-90 DEL AND TRP-123, CHARACTERIZATION OF VARIANT ASN-113. |
| [62] | "The presentation and natural history of immunodeficiency caused by nuclear factor kappaB essential modulator mutation." Orange J.S., Jain A., Ballas Z.K., Schneider L.C., Geha R.S., Bonilla F.A. J. Allergy Clin. Immunol. 113:725-733(2004) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS EDAID ARG-153 AND ARG-417, VARIANT NEMOID TYR-417. |
| [63] | "Human nuclear factor kappa B essential modulator mutation can result in immunodeficiency without ectodermal dysplasia." Orange J.S., Levy O., Brodeur S.R., Krzewski K., Roy R.M., Niemela J.E., Fleisher T.A., Bonilla F.A., Geha R.S. J. Allergy Clin. Immunol. 114:650-656(2004) [PubMed] [Europe PMC] [Abstract] Cited for: INVOLVEMENT IN NEMOID. |
| [64] | "X-linked susceptibility to mycobacteria is caused by mutations in NEMO impairing CD40-dependent IL-12 production." Filipe-Santos O., Bustamante J., Haverkamp M.H., Vinolo E., Ku C.-L., Puel A., Frucht D.M., Christel K., von Bernuth H., Jouanguy E., Feinberg J., Durandy A., Senechal B., Chapgier A., Vogt G., de Beaucoudrey L., Fieschi C., Picard C. Casanova J.-L.J. Exp. Med. 203:1745-1759(2006) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS AMCBX1 ALA-315 AND GLN-319. |
| [65] | "Identification of TRAF6-dependent NEMO polyubiquitination sites through analysis of a new NEMO mutation causing incontinentia pigmenti." Sebban-Benin H., Pescatore A., Fusco F., Pascuale V., Gautheron J., Yamaoka S., Moncla A., Ursini M.V., Courtois G. Hum. Mol. Genet. 16:2805-2815(2007) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT IP PRO-323, CHARACTERIZATION OF VARIANT IP PRO-323, INTERACTION WITH TRAF6. |
| [66] | "IRAK4 and NEMO mutations in otherwise healthy children with recurrent invasive pneumococcal disease." Ku C.-L., Picard C., Erdos M., Jeurissen A., Bustamante J., Puel A., von Bernuth H., Filipe-Santos O., Chang H.-H., Lawrence T., Raes M., Marodi L., Bossuyt X., Casanova J.-L. J. Med. Genet. 44:16-23(2007) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT IPD2 GLY-173. |
| + | Additional computationally mapped references. |
Web resources
| IKBKGbase IKBKG mutation db |
| GeneReviews |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF062089 mRNA. Translation: AAD12183.1. AF091453 mRNA. Translation: AAD38081.1. AF074382 mRNA. Translation: AAC36330.1. AJ271718 Genomic DNA. Translation: CAB93146.1. AF261086 mRNA. Translation: AAF99679.1. AY114157 mRNA. Translation: AAM44073.1. AK000593 mRNA. No translation available. BT019621 mRNA. Translation: AAV38427.1. AF277315 Genomic DNA. Translation: AAL27012.1. BC000299 mRNA. Translation: AAH00299.1. BC012114 mRNA. Translation: AAH12114.1. BC046922 mRNA. Translation: AAH46922.1. BC050612 mRNA. Translation: AAH50612.1. | ||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00002411. IPI00641117. IPI00641409. | ||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_001093326.2. NM_001099856.2. NP_001093327.1. NM_001099857.1. NP_001138727.1. NM_001145255.1. NP_003630.1. NM_003639.3. | ||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.43505. | ||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | Q9Y6K9. | ||||||||||||||||||||||||||||||||||||||||||
| SMR | Q9Y6K9. Positions 49-109, 193-251, 263-333, 394-419. | ||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||
| DIP | DIP-27528N. | ||||||||||||||||||||||||||||||||||||||||||
| IntAct | Q9Y6K9. 134 interactions. | ||||||||||||||||||||||||||||||||||||||||||
| MINT | MINT-1133340. | ||||||||||||||||||||||||||||||||||||||||||
| STRING | 9606.ENSP00000358622. | ||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | Q9Y6K9. | ||||||||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||||||||
| DMDM | 6685695. | ||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||
| PaxDb | Q9Y6K9. | ||||||||||||||||||||||||||||||||||||||||||
| PRIDE | Q9Y6K9. | ||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||
| DNASU | 8517. | ||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000369601; ENSP00000358614; ENSG00000073009. ENST00000369602; ENSP00000358615; ENSG00000073009. ENST00000369606; ENSP00000358619; ENSG00000073009. ENST00000369607; ENSP00000358620; ENSG00000073009. ENST00000369609; ENSP00000358622; ENSG00000073009. | ||||||||||||||||||||||||||||||||||||||||||
| GeneID | 8517. | ||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:8517. | ||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc004fmb.4. human. uc011mzr.2. human. uc011mzs.2. human. | ||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||
| CTD | 8517. | ||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC0XP153769. | ||||||||||||||||||||||||||||||||||||||||||
| H-InvDB | HIX0203333. | ||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:5961. IKBKG. | ||||||||||||||||||||||||||||||||||||||||||
| HPA | CAB010373. HPA000426. | ||||||||||||||||||||||||||||||||||||||||||
| MIM | 300248. gene. 300291. phenotype. 300301. phenotype. 300584. phenotype. 300636. phenotype. 300640. phenotype. 308300. phenotype. | ||||||||||||||||||||||||||||||||||||||||||
| neXtProt | NX_Q9Y6K9. | ||||||||||||||||||||||||||||||||||||||||||
| Orphanet | 69088. Anhidrotic ectodermal dysplasia - immunodeficiency - osteopetrosis - lymphedema. 98813. Hypohidrotic ectodermal dysplasia with immunodeficiency. 464. Incontinentia pigmenti. 748. Mendelian susceptibility to mycobacterial diseases. | ||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA29777. | ||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||
| eggNOG | NOG138369. | ||||||||||||||||||||||||||||||||||||||||||
| HOGENOM | HOG000293233. | ||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG000417. | ||||||||||||||||||||||||||||||||||||||||||
| InParanoid | Q9Y6K9. | ||||||||||||||||||||||||||||||||||||||||||
| KO | K07210. | ||||||||||||||||||||||||||||||||||||||||||
| OMA | QKFQEAR. | ||||||||||||||||||||||||||||||||||||||||||
| PhylomeDB | Q9Y6K9. | ||||||||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||||||||
| Pathway_Interaction_DB | bcr_5pathway. BCR signaling pathway. nfkappabcanonicalpathway. Canonical NF-kappaB pathway. fcer1pathway. Fc-epsilon receptor I signaling in mast cells. il1pathway. IL1-mediated signaling events. p75ntrpathway. p75(NTR)-mediated signaling. tcrpathway. TCR signaling in naive CD4+ T cells. cd8tcrpathway. TCR signaling in naive CD8+ T cells. tnfpathway. TNF receptor signaling pathway. trail_pathway. TRAIL signaling pathway. | ||||||||||||||||||||||||||||||||||||||||||
| Reactome | REACT_6782. TRAF6 Mediated Induction of proinflammatory cytokines. REACT_6900. Immune System. | ||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | Q9Y6K9. | ||||||||||||||||||||||||||||||||||||||||||
| Bgee | Q9Y6K9. | ||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_IKBKG. | ||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | Q9Y6K9. | ||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000073009. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR021063. NEMO_N. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF11577. NEMO. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||
| BindingDB | Q9Y6K9. | ||||||||||||||||||||||||||||||||||||||||||
| ChEMBL | CHEMBL4967. | ||||||||||||||||||||||||||||||||||||||||||
| ChiTaRS | IKBKG. human. | ||||||||||||||||||||||||||||||||||||||||||
| EvolutionaryTrace | Q9Y6K9. | ||||||||||||||||||||||||||||||||||||||||||
| GenomeRNAi | 8517. | ||||||||||||||||||||||||||||||||||||||||||
| NextBio | 31882. | ||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | NEMO_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9Y6K9 Secondary accession number(s): Q7LBY6, Q7Z7F1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome X Human chromosome X: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
