Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Serine/threonine/tyrosine-interacting-like protein 1

Gene

STYXL1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

Probable pseudophosphatase. Contains a Ser residue instead of a conserved Cys residue in the dsPTPase catalytic loop which probably renders it catalytically inactive as a phosphatase. The binding pocket may be however sufficiently preserved to bind phosphorylated substrates, and maybe protect them from phosphatases.

GO - Molecular functioni

GO - Biological processi

  • intracellular signal transduction Source: ProtInc
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Protein phosphatase

Enzyme and pathway databases

BioCyciZFISH:ENSG00000127952-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Serine/threonine/tyrosine-interacting-like protein 1
Alternative name(s):
Dual specificity phosphatase inhibitor MK-STYX
Dual specificity protein phosphatase 24
Map kinase phosphatase-like protein MK-STYX
Gene namesi
Name:STYXL1
Synonyms:DUSP24, MKSTYX
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

HGNCiHGNC:18165. STYXL1.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

DisGeNETi51657.
OpenTargetsiENSG00000127952.
PharmGKBiPA134942462.

Polymorphism and mutation databases

BioMutaiSTYXL1.
DMDMi29840801.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000948371 – 313Serine/threonine/tyrosine-interacting-like protein 1Add BLAST313

Proteomic databases

PaxDbiQ9Y6J8.
PeptideAtlasiQ9Y6J8.
PRIDEiQ9Y6J8.

PTM databases

DEPODiQ9Y6J8.
iPTMnetiQ9Y6J8.
PhosphoSitePlusiQ9Y6J8.

Expressioni

Gene expression databases

BgeeiENSG00000127952.
CleanExiHS_STYXL1.
ExpressionAtlasiQ9Y6J8. baseline and differential.
GenevisibleiQ9Y6J8. HS.

Organism-specific databases

HPAiHPA050261.

Interactioni

Protein-protein interaction databases

BioGridi119663. 6 interactors.
STRINGi9606.ENSP00000248600.

Structurei

3D structure databases

ProteinModelPortaliQ9Y6J8.
SMRiQ9Y6J8.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini17 – 140RhodaneseAdd BLAST124
Domaini160 – 301Tyrosine-protein phosphataseAdd BLAST142

Sequence similaritiesi

Contains 1 rhodanese domain.Curated

Phylogenomic databases

eggNOGiKOG1716. Eukaryota.
COG2453. LUCA.
GeneTreeiENSGT00390000010113.
HOGENOMiHOG000004828.
HOVERGENiHBG052516.
InParanoidiQ9Y6J8.
KOiK18047.
OMAiRGFVKQL.
OrthoDBiEOG091G0JOE.
PhylomeDBiQ9Y6J8.
TreeFamiTF352452.

Family and domain databases

Gene3Di3.40.250.10. 1 hit.
3.90.190.10. 1 hit.
InterProiIPR000340. Dual-sp_phosphatase_cat-dom.
IPR024950. DUSP.
IPR029021. Prot-tyrosine_phosphatase-like.
IPR001763. Rhodanese-like_dom.
IPR020422. TYR_PHOSPHATASE_DUAL_dom.
[Graphical view]
PANTHERiPTHR10159. PTHR10159. 1 hit.
PfamiPF00782. DSPc. 1 hit.
PF00581. Rhodanese. 1 hit.
[Graphical view]
SMARTiSM00195. DSPc. 1 hit.
SM00450. RHOD. 1 hit.
[Graphical view]
SUPFAMiSSF52799. SSF52799. 1 hit.
SSF52821. SSF52821. 1 hit.
PROSITEiPS50054. TYR_PHOSPHATASE_DUAL. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Experimental confirmation may be lacking for some isoforms.
Isoform 1 (identifier: Q9Y6J8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPGLLLCEPT ELYNILNQAT KLSRLTDPNY LCLLDVRSKW EYDESHVITA
60 70 80 90 100
LRVKKKNNEY LLPESVDLEC VKYCVVYDNN SSTLEILLKD DDDDSDSDGD
110 120 130 140 150
GKDLVPQAAI EYGRILTRLT HHPVYILKGG YERFSGTYHF LRTQKIIWMP
160 170 180 190 200
QELDAFQPYP IEIVPGKVFV GNFSQACDPK IQKDLKIKAH VNVSMDTGPF
210 220 230 240 250
FAGDADKLLH IRIEDSPEAQ ILPFLRHMCH FIEIHHHLGS VILIFSTQGI
260 270 280 290 300
SRSCAAIIAY LMHSNEQTLQ RSWAYVKKCK NNMCPNRGLV SQLLEWEKTI
310
LGDSITNIMD PLY
Length:313
Mass (Da):35,818
Last modified:November 1, 1999 - v1
Checksum:i5EDB25AB4EB60419
GO
Isoform 2 (identifier: Q9Y6J8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     233-287: EIHHHLGSVILIFSTQGISRSCAAIIAYLMHSNEQTLQRSWAYVKKCKNNMCPNR → GYQPQLCRHHSLPHA
     288-313: Missing.

Show »
Length:247
Mass (Da):28,330
Checksum:iBE7BE323BED2552D
GO
Isoform 3 (identifier: Q9Y6J8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     234-313: IHHHLGSVIL...SITNIMDPLY → VLGLCQEVQK...RRRPLLPESL

Show »
Length:318
Mass (Da):36,110
Checksum:i1C1DEC7DF8E9B493
GO
Isoform 4 (identifier: Q9Y6J8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     56-151: Missing.

Show »
Length:217
Mass (Da):24,752
Checksum:iDC1D778045C40929
GO
Isoform 5 (identifier: Q9Y6J8-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     103-138: DLVPQAAIEYGRILTRLTHHPVYILKGGYERFSGTY → GTGCISAIP
     139-313: Missing.

Show »
Length:111
Mass (Da):12,475
Checksum:i42E0DCD053A70068
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_00517556 – 151Missing in isoform 4. CuratedAdd BLAST96
Alternative sequenceiVSP_005176103 – 138DLVPQ…FSGTY → GTGCISAIP in isoform 5. CuratedAdd BLAST36
Alternative sequenceiVSP_005177139 – 313Missing in isoform 5. CuratedAdd BLAST175
Alternative sequenceiVSP_005178233 – 287EIHHH…MCPNR → GYQPQLCRHHSLPHA in isoform 2. CuratedAdd BLAST55
Alternative sequenceiVSP_005180234 – 313IHHHL…MDPLY → VLGLCQEVQKQHVSKSGIGE PAAGMGEDYPWRFHHKHHGS ALLIFSEAHRRVLKSLTWGH FVGGGPECVYPGLSGRRRPL LPESL in isoform 3. CuratedAdd BLAST80
Alternative sequenceiVSP_005179288 – 313Missing in isoform 2. CuratedAdd BLAST26

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF069762 mRNA. Translation: AAD36983.1.
AC006330 Genomic DNA. Translation: AAS07535.1.
BC024035 mRNA. Translation: AAH24035.1.
AF188201 mRNA. Translation: AAF04111.1.
AF188202 mRNA. Translation: AAF04112.1.
AF188203 mRNA. Translation: AAF04113.1.
AF188204 mRNA. Translation: AAF04114.1.
AF169647 mRNA. Translation: AAD53723.1.
AF169648 mRNA. Translation: AAD53724.1.
CCDSiCCDS5580.1. [Q9Y6J8-1]
CCDS83193.1. [Q9Y6J8-4]
RefSeqiNP_001304714.1. NM_001317785.1. [Q9Y6J8-1]
NP_001304715.1. NM_001317786.1. [Q9Y6J8-1]
NP_001304716.1. NM_001317787.1. [Q9Y6J8-4]
NP_001304717.1. NM_001317788.1.
NP_001304718.1. NM_001317789.1.
NP_057170.1. NM_016086.2. [Q9Y6J8-1]
XP_011514595.1. XM_011516293.2. [Q9Y6J8-1]
UniGeneiHs.11615.

Genome annotation databases

EnsembliENST00000248600; ENSP00000248600; ENSG00000127952. [Q9Y6J8-1]
ENST00000340062; ENSP00000343383; ENSG00000127952. [Q9Y6J8-4]
ENST00000359697; ENSP00000352726; ENSG00000127952. [Q9Y6J8-1]
ENST00000360591; ENSP00000353798; ENSG00000127952. [Q9Y6J8-4]
ENST00000431581; ENSP00000392221; ENSG00000127952. [Q9Y6J8-1]
GeneIDi51657.
KEGGihsa:51657.
UCSCiuc003uek.5. human. [Q9Y6J8-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF069762 mRNA. Translation: AAD36983.1.
AC006330 Genomic DNA. Translation: AAS07535.1.
BC024035 mRNA. Translation: AAH24035.1.
AF188201 mRNA. Translation: AAF04111.1.
AF188202 mRNA. Translation: AAF04112.1.
AF188203 mRNA. Translation: AAF04113.1.
AF188204 mRNA. Translation: AAF04114.1.
AF169647 mRNA. Translation: AAD53723.1.
AF169648 mRNA. Translation: AAD53724.1.
CCDSiCCDS5580.1. [Q9Y6J8-1]
CCDS83193.1. [Q9Y6J8-4]
RefSeqiNP_001304714.1. NM_001317785.1. [Q9Y6J8-1]
NP_001304715.1. NM_001317786.1. [Q9Y6J8-1]
NP_001304716.1. NM_001317787.1. [Q9Y6J8-4]
NP_001304717.1. NM_001317788.1.
NP_001304718.1. NM_001317789.1.
NP_057170.1. NM_016086.2. [Q9Y6J8-1]
XP_011514595.1. XM_011516293.2. [Q9Y6J8-1]
UniGeneiHs.11615.

3D structure databases

ProteinModelPortaliQ9Y6J8.
SMRiQ9Y6J8.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119663. 6 interactors.
STRINGi9606.ENSP00000248600.

PTM databases

DEPODiQ9Y6J8.
iPTMnetiQ9Y6J8.
PhosphoSitePlusiQ9Y6J8.

Polymorphism and mutation databases

BioMutaiSTYXL1.
DMDMi29840801.

Proteomic databases

PaxDbiQ9Y6J8.
PeptideAtlasiQ9Y6J8.
PRIDEiQ9Y6J8.

Protocols and materials databases

DNASUi51657.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000248600; ENSP00000248600; ENSG00000127952. [Q9Y6J8-1]
ENST00000340062; ENSP00000343383; ENSG00000127952. [Q9Y6J8-4]
ENST00000359697; ENSP00000352726; ENSG00000127952. [Q9Y6J8-1]
ENST00000360591; ENSP00000353798; ENSG00000127952. [Q9Y6J8-4]
ENST00000431581; ENSP00000392221; ENSG00000127952. [Q9Y6J8-1]
GeneIDi51657.
KEGGihsa:51657.
UCSCiuc003uek.5. human. [Q9Y6J8-1]

Organism-specific databases

CTDi51657.
DisGeNETi51657.
GeneCardsiSTYXL1.
HGNCiHGNC:18165. STYXL1.
HPAiHPA050261.
neXtProtiNX_Q9Y6J8.
OpenTargetsiENSG00000127952.
PharmGKBiPA134942462.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1716. Eukaryota.
COG2453. LUCA.
GeneTreeiENSGT00390000010113.
HOGENOMiHOG000004828.
HOVERGENiHBG052516.
InParanoidiQ9Y6J8.
KOiK18047.
OMAiRGFVKQL.
OrthoDBiEOG091G0JOE.
PhylomeDBiQ9Y6J8.
TreeFamiTF352452.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000127952-MONOMER.

Miscellaneous databases

ChiTaRSiSTYXL1. human.
GeneWikiiSTYXL1.
GenomeRNAii51657.
PROiQ9Y6J8.

Gene expression databases

BgeeiENSG00000127952.
CleanExiHS_STYXL1.
ExpressionAtlasiQ9Y6J8. baseline and differential.
GenevisibleiQ9Y6J8. HS.

Family and domain databases

Gene3Di3.40.250.10. 1 hit.
3.90.190.10. 1 hit.
InterProiIPR000340. Dual-sp_phosphatase_cat-dom.
IPR024950. DUSP.
IPR029021. Prot-tyrosine_phosphatase-like.
IPR001763. Rhodanese-like_dom.
IPR020422. TYR_PHOSPHATASE_DUAL_dom.
[Graphical view]
PANTHERiPTHR10159. PTHR10159. 1 hit.
PfamiPF00782. DSPc. 1 hit.
PF00581. Rhodanese. 1 hit.
[Graphical view]
SMARTiSM00195. DSPc. 1 hit.
SM00450. RHOD. 1 hit.
[Graphical view]
SUPFAMiSSF52799. SSF52799. 1 hit.
SSF52821. SSF52821. 1 hit.
PROSITEiPS50054. TYR_PHOSPHATASE_DUAL. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiSTYL1_HUMAN
AccessioniPrimary (citable) accession number: Q9Y6J8
Secondary accession number(s): Q9UBP1
, Q9UK06, Q9UK07, Q9UKG2, Q9UKG3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 28, 2003
Last sequence update: November 1, 1999
Last modified: November 2, 2016
This is version 141 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.