Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

WD repeat and SOCS box-containing protein 1

Gene

WSB1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Probable substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Recognizes type II iodothyronine deiodinase/DIO2. Confers constitutive instability to HIPK2 through proteasomal degradation.3 Publications

Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Ubl conjugation pathway

Enzyme and pathway databases

BioCyciZFISH:ENSG00000109046-MONOMER.
ReactomeiR-HSA-983168. Antigen processing: Ubiquitination & Proteasome degradation.
SignaLinkiQ9Y6I7.
SIGNORiQ9Y6I7.
UniPathwayiUPA00143.

Names & Taxonomyi

Protein namesi
Recommended name:
WD repeat and SOCS box-containing protein 1
Short name:
WSB-1
Alternative name(s):
SOCS box-containing WD protein SWiP-1
Gene namesi
Name:WSB1
Synonyms:SWIP1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

HGNCiHGNC:19221. WSB1.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

DisGeNETi26118.
OpenTargetsiENSG00000109046.
PharmGKBiPA134867554.

Polymorphism and mutation databases

BioMutaiWSB1.
DMDMi20532298.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000514571 – 421WD repeat and SOCS box-containing protein 1Add BLAST421

Proteomic databases

EPDiQ9Y6I7.
PaxDbiQ9Y6I7.
PeptideAtlasiQ9Y6I7.
PRIDEiQ9Y6I7.

PTM databases

iPTMnetiQ9Y6I7.
PhosphoSitePlusiQ9Y6I7.

Expressioni

Gene expression databases

BgeeiENSG00000109046.
CleanExiHS_WSB1.
ExpressionAtlasiQ9Y6I7. baseline and differential.
GenevisibleiQ9Y6I7. HS.

Organism-specific databases

HPAiHPA003293.

Interactioni

Subunit structurei

Interacts with DIO2. Component of the probable ECS(WSB1) E3 ubiquitin ligase complex which contains CUL5, RNF7/RBX2, Elongin BC complex and WSB1. Component of a probable ECS-like E3 ubiquitin-protein ligase complex which contains CUL5, RBX1, Elongin BC complex and WSB1. Interacts with CUL5, RNF7, TCEB1 and TCEB2. Binds to HIPK2 through WD40 repeats.3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
Hipk2Q9QZR55EBI-1171494,EBI-366905From a different organism.

Protein-protein interaction databases

BioGridi117560. 12 interactors.
IntActiQ9Y6I7. 5 interactors.
MINTiMINT-4713879.
STRINGi9606.ENSP00000262394.

Structurei

3D structure databases

ProteinModelPortaliQ9Y6I7.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati32 – 71WD 1Add BLAST40
Repeati124 – 165WD 2Add BLAST42
Repeati168 – 208WD 3Add BLAST41
Repeati212 – 251WD 4Add BLAST40
Repeati254 – 293WD 5Add BLAST40
Repeati309 – 346WD 6Add BLAST38
Domaini372 – 421SOCS boxPROSITE-ProRule annotationAdd BLAST50

Domaini

The SOCS box domain mediates the interaction with the Elongin BC complex, an adapter module in different E3 ubiquitin ligase complexes.By similarity

Sequence similaritiesi

Contains 1 SOCS box domain.PROSITE-ProRule annotation
Contains 6 WD repeats.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

eggNOGiENOG410IQ0Y. Eukaryota.
ENOG411010D. LUCA.
GeneTreeiENSGT00860000133757.
HOGENOMiHOG000063727.
HOVERGENiHBG034543.
InParanoidiQ9Y6I7.
KOiK10341.
OMAiGHHNDVV.
OrthoDBiEOG091G06GY.
PhylomeDBiQ9Y6I7.
TreeFamiTF329216.

Family and domain databases

Gene3Di2.130.10.10. 1 hit.
InterProiIPR020472. G-protein_beta_WD-40_rep.
IPR001496. SOCS_box.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamiPF07525. SOCS_box. 1 hit.
PF00400. WD40. 5 hits.
[Graphical view]
PRINTSiPR00320. GPROTEINBRPT.
SMARTiSM00253. SOCS. 1 hit.
SM00969. SOCS_box. 1 hit.
SM00320. WD40. 6 hits.
[Graphical view]
SUPFAMiSSF158235. SSF158235. 1 hit.
SSF50978. SSF50978. 2 hits.
PROSITEiPS50225. SOCS. 1 hit.
PS00678. WD_REPEATS_1. 2 hits.
PS50082. WD_REPEATS_2. 6 hits.
PS50294. WD_REPEATS_REGION. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9Y6I7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MASFPPRVNE KEIVRLRTIG ELLAPAAPFD KKCGRENWTV AFAPDGSYFA
60 70 80 90 100
WSQGHRTVKL VPWSQCLQNF LLHGTKNVTN SSSLRLPRQN SDGGQKNKPR
110 120 130 140 150
EHIIDCGDIV WSLAFGSSVP EKQSRCVNIE WHRFRFGQDQ LLLATGLNNG
160 170 180 190 200
RIKIWDVYTG KLLLNLVDHT EVVRDLTFAP DGSLILVSAS RDKTLRVWDL
210 220 230 240 250
KDDGNMMKVL RGHQNWVYSC AFSPDSSMLC SVGASKAVFL WNMDKYTMIR
260 270 280 290 300
KLEGHHHDVV ACDFSPDGAL LATASYDTRV YIWDPHNGDI LMEFGHLFPP
310 320 330 340 350
PTPIFAGGAN DRWVRSVSFS HDGLHVASLA DDKMVRFWRI DEDYPVQVAP
360 370 380 390 400
LSNGLCCAFS TDGSVLAAGT HDGSVYFWAT PRQVPSLQHL CRMSIRRVMP
410 420
TQEVQELPIP SKLLEFLSYR I
Length:421
Mass (Da):47,432
Last modified:November 1, 1999 - v1
Checksum:i650D4942E97D4BED
GO
Isoform 2 (identifier: Q9Y6I7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     14-159: Missing.

Show »
Length:275
Mass (Da):30,883
Checksum:i8F3B7D4C581CBD3D
GO
Isoform 3 (identifier: Q9Y6I7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     239-244: FLWNMD → VAAILV
     245-421: Missing.

Show »
Length:244
Mass (Da):27,295
Checksum:iE3D403F3CEB81109
GO
Isoform 4 (identifier: Q9Y6I7-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-35: MASFPPRVNEKEIVRLRTIGELLAPAAPFDKKCGR → MLNIILIKFSSFSIRCAILSSVCLNEAITFAFLLQ
     36-237: Missing.

Show »
Length:219
Mass (Da):24,724
Checksum:i832E6744DD6F23DC
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti149N → S in CAB53708 (PubMed:17974005).Curated1
Sequence conflicti171E → G in CAB53708 (PubMed:17974005).Curated1
Sequence conflicti178F → L in AAD43036 (Ref. 6) Curated1
Sequence conflicti201K → R in CAB53708 (PubMed:17974005).Curated1
Sequence conflicti231S → P in AAD43036 (Ref. 6) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02470116L → S.2 PublicationsCorresponds to variant rs9303634dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0534021 – 35MASFP…KKCGR → MLNIILIKFSSFSIRCAILS SVCLNEAITFAFLLQ in isoform 4. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_00679214 – 159Missing in isoform 2. 1 PublicationAdd BLAST146
Alternative sequenceiVSP_05340336 – 237Missing in isoform 4. 1 PublicationAdd BLAST202
Alternative sequenceiVSP_039111239 – 244FLWNMD → VAAILV in isoform 3. 1 Publication6
Alternative sequenceiVSP_039112245 – 421Missing in isoform 3. 1 PublicationAdd BLAST177

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF072880 mRNA. Translation: AAD28808.1.
AF106684 mRNA. Translation: AAD43037.1.
AF069313 mRNA. Translation: AAD20954.2.
AF240696 mRNA. Translation: AAF82746.1.
AL110243 mRNA. Translation: CAB53693.1.
AF112205 mRNA. Translation: AAF17193.1.
AF106683 mRNA. Translation: AAD43036.1.
AL110269 mRNA. Translation: CAB53708.2.
BC021110 mRNA. Translation: AAH21110.1.
CCDSiCCDS11220.1. [Q9Y6I7-1]
CCDS11221.1. [Q9Y6I7-2]
PIRiT14773.
T14788.
RefSeqiNP_056441.6. NM_015626.8. [Q9Y6I7-1]
NP_599027.1. NM_134265.2. [Q9Y6I7-2]
XP_016879924.1. XM_017024435.1. [Q9Y6I7-4]
XP_016879925.1. XM_017024436.1. [Q9Y6I7-4]
UniGeneiHs.446017.
Hs.655024.

Genome annotation databases

EnsembliENST00000262394; ENSP00000262394; ENSG00000109046. [Q9Y6I7-1]
ENST00000348811; ENSP00000327055; ENSG00000109046. [Q9Y6I7-2]
GeneIDi26118.
KEGGihsa:26118.
UCSCiuc002gzd.2. human. [Q9Y6I7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF072880 mRNA. Translation: AAD28808.1.
AF106684 mRNA. Translation: AAD43037.1.
AF069313 mRNA. Translation: AAD20954.2.
AF240696 mRNA. Translation: AAF82746.1.
AL110243 mRNA. Translation: CAB53693.1.
AF112205 mRNA. Translation: AAF17193.1.
AF106683 mRNA. Translation: AAD43036.1.
AL110269 mRNA. Translation: CAB53708.2.
BC021110 mRNA. Translation: AAH21110.1.
CCDSiCCDS11220.1. [Q9Y6I7-1]
CCDS11221.1. [Q9Y6I7-2]
PIRiT14773.
T14788.
RefSeqiNP_056441.6. NM_015626.8. [Q9Y6I7-1]
NP_599027.1. NM_134265.2. [Q9Y6I7-2]
XP_016879924.1. XM_017024435.1. [Q9Y6I7-4]
XP_016879925.1. XM_017024436.1. [Q9Y6I7-4]
UniGeneiHs.446017.
Hs.655024.

3D structure databases

ProteinModelPortaliQ9Y6I7.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi117560. 12 interactors.
IntActiQ9Y6I7. 5 interactors.
MINTiMINT-4713879.
STRINGi9606.ENSP00000262394.

PTM databases

iPTMnetiQ9Y6I7.
PhosphoSitePlusiQ9Y6I7.

Polymorphism and mutation databases

BioMutaiWSB1.
DMDMi20532298.

Proteomic databases

EPDiQ9Y6I7.
PaxDbiQ9Y6I7.
PeptideAtlasiQ9Y6I7.
PRIDEiQ9Y6I7.

Protocols and materials databases

DNASUi26118.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000262394; ENSP00000262394; ENSG00000109046. [Q9Y6I7-1]
ENST00000348811; ENSP00000327055; ENSG00000109046. [Q9Y6I7-2]
GeneIDi26118.
KEGGihsa:26118.
UCSCiuc002gzd.2. human. [Q9Y6I7-1]

Organism-specific databases

CTDi26118.
DisGeNETi26118.
GeneCardsiWSB1.
HGNCiHGNC:19221. WSB1.
HPAiHPA003293.
MIMi610091. gene.
neXtProtiNX_Q9Y6I7.
OpenTargetsiENSG00000109046.
PharmGKBiPA134867554.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IQ0Y. Eukaryota.
ENOG411010D. LUCA.
GeneTreeiENSGT00860000133757.
HOGENOMiHOG000063727.
HOVERGENiHBG034543.
InParanoidiQ9Y6I7.
KOiK10341.
OMAiGHHNDVV.
OrthoDBiEOG091G06GY.
PhylomeDBiQ9Y6I7.
TreeFamiTF329216.

Enzyme and pathway databases

UniPathwayiUPA00143.
BioCyciZFISH:ENSG00000109046-MONOMER.
ReactomeiR-HSA-983168. Antigen processing: Ubiquitination & Proteasome degradation.
SignaLinkiQ9Y6I7.
SIGNORiQ9Y6I7.

Miscellaneous databases

ChiTaRSiWSB1. human.
GeneWikiiWSB1.
GenomeRNAii26118.
PROiQ9Y6I7.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000109046.
CleanExiHS_WSB1.
ExpressionAtlasiQ9Y6I7. baseline and differential.
GenevisibleiQ9Y6I7. HS.

Family and domain databases

Gene3Di2.130.10.10. 1 hit.
InterProiIPR020472. G-protein_beta_WD-40_rep.
IPR001496. SOCS_box.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamiPF07525. SOCS_box. 1 hit.
PF00400. WD40. 5 hits.
[Graphical view]
PRINTSiPR00320. GPROTEINBRPT.
SMARTiSM00253. SOCS. 1 hit.
SM00969. SOCS_box. 1 hit.
SM00320. WD40. 6 hits.
[Graphical view]
SUPFAMiSSF158235. SSF158235. 1 hit.
SSF50978. SSF50978. 2 hits.
PROSITEiPS50225. SOCS. 1 hit.
PS00678. WD_REPEATS_1. 2 hits.
PS50082. WD_REPEATS_2. 6 hits.
PS50294. WD_REPEATS_REGION. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiWSB1_HUMAN
AccessioniPrimary (citable) accession number: Q9Y6I7
Secondary accession number(s): Q9NRB1
, Q9UBH9, Q9UG25, Q9UNN6, Q9Y656
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 10, 2002
Last sequence update: November 1, 1999
Last modified: November 30, 2016
This is version 154 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.