Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9Y6I7

- WSB1_HUMAN

UniProt

Q9Y6I7 - WSB1_HUMAN

Protein

WD repeat and SOCS box-containing protein 1

Gene

WSB1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 132 (01 Oct 2014)
      Sequence version 1 (01 Nov 1999)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Probable substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Recognizes type II iodothyronine deiodinase/DIO2. Confers constitutive instability to HIPK2 through proteasomal degradation.3 Publications

    Pathwayi

    GO - Molecular functioni

    1. protein binding Source: IntAct

    GO - Biological processi

    1. intracellular signal transduction Source: InterPro
    2. protein ubiquitination Source: UniProtKB-UniPathway

    Keywords - Biological processi

    Ubl conjugation pathway

    Enzyme and pathway databases

    ReactomeiREACT_75842. Antigen processing: Ubiquitination & Proteasome degradation.
    SignaLinkiQ9Y6I7.
    UniPathwayiUPA00143.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    WD repeat and SOCS box-containing protein 1
    Short name:
    WSB-1
    Alternative name(s):
    SOCS box-containing WD protein SWiP-1
    Gene namesi
    Name:WSB1
    Synonyms:SWIP1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 17

    Organism-specific databases

    HGNCiHGNC:19221. WSB1.

    Subcellular locationi

    GO - Cellular componenti

    1. intracellular Source: LIFEdb

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134867554.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 421421WD repeat and SOCS box-containing protein 1PRO_0000051457Add
    BLAST

    Proteomic databases

    MaxQBiQ9Y6I7.
    PaxDbiQ9Y6I7.
    PRIDEiQ9Y6I7.

    PTM databases

    PhosphoSiteiQ9Y6I7.

    Expressioni

    Gene expression databases

    ArrayExpressiQ9Y6I7.
    BgeeiQ9Y6I7.
    CleanExiHS_WSB1.
    GenevestigatoriQ9Y6I7.

    Organism-specific databases

    HPAiHPA003293.

    Interactioni

    Subunit structurei

    Interacts with DIO2. Component of the probable ECS(WSB1) E3 ubiquitin ligase complex which contains CUL5, RNF7/RBX2, Elongin BC complex and WSB1. Component of a probable ECS-like E3 ubiquitin-protein ligase complex which contains CUL5, RBX1, Elongin BC complex and WSB1. Interacts with CUL5, RNF7, TCEB1 and TCEB2. Binds to HIPK2 through WD40 repeats.3 Publications

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    Hipk2Q9QZR55EBI-1171494,EBI-366905From a different organism.

    Protein-protein interaction databases

    BioGridi117560. 12 interactions.
    IntActiQ9Y6I7. 5 interactions.
    MINTiMINT-4713879.
    STRINGi9606.ENSP00000262394.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9Y6I7.
    SMRiQ9Y6I7. Positions 38-378.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Repeati32 – 7140WD 1Add
    BLAST
    Repeati124 – 16542WD 2Add
    BLAST
    Repeati168 – 20841WD 3Add
    BLAST
    Repeati212 – 25140WD 4Add
    BLAST
    Repeati254 – 29340WD 5Add
    BLAST
    Repeati309 – 34638WD 6Add
    BLAST
    Domaini372 – 42150SOCS boxPROSITE-ProRule annotationAdd
    BLAST

    Domaini

    The SOCS box domain mediates the interaction with the Elongin BC complex, an adapter module in different E3 ubiquitin ligase complexes.By similarity

    Sequence similaritiesi

    Contains 1 SOCS box domain.PROSITE-ProRule annotation
    Contains 6 WD repeats.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat, WD repeat

    Phylogenomic databases

    eggNOGiCOG2319.
    HOGENOMiHOG000063727.
    HOVERGENiHBG034543.
    InParanoidiQ9Y6I7.
    KOiK10341.
    OMAiKLVPWSQ.
    PhylomeDBiQ9Y6I7.
    TreeFamiTF329216.

    Family and domain databases

    Gene3Di2.130.10.10. 1 hit.
    InterProiIPR020472. G-protein_beta_WD-40_rep.
    IPR001496. SOCS_C.
    IPR015943. WD40/YVTN_repeat-like_dom.
    IPR001680. WD40_repeat.
    IPR019775. WD40_repeat_CS.
    IPR017986. WD40_repeat_dom.
    [Graphical view]
    PfamiPF07525. SOCS_box. 1 hit.
    PF00400. WD40. 5 hits.
    [Graphical view]
    PRINTSiPR00320. GPROTEINBRPT.
    SMARTiSM00253. SOCS. 1 hit.
    SM00969. SOCS_box. 1 hit.
    SM00320. WD40. 6 hits.
    [Graphical view]
    SUPFAMiSSF50978. SSF50978. 2 hits.
    PROSITEiPS50225. SOCS. 1 hit.
    PS00678. WD_REPEATS_1. 2 hits.
    PS50082. WD_REPEATS_2. 6 hits.
    PS50294. WD_REPEATS_REGION. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9Y6I7-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MASFPPRVNE KEIVRLRTIG ELLAPAAPFD KKCGRENWTV AFAPDGSYFA    50
    WSQGHRTVKL VPWSQCLQNF LLHGTKNVTN SSSLRLPRQN SDGGQKNKPR 100
    EHIIDCGDIV WSLAFGSSVP EKQSRCVNIE WHRFRFGQDQ LLLATGLNNG 150
    RIKIWDVYTG KLLLNLVDHT EVVRDLTFAP DGSLILVSAS RDKTLRVWDL 200
    KDDGNMMKVL RGHQNWVYSC AFSPDSSMLC SVGASKAVFL WNMDKYTMIR 250
    KLEGHHHDVV ACDFSPDGAL LATASYDTRV YIWDPHNGDI LMEFGHLFPP 300
    PTPIFAGGAN DRWVRSVSFS HDGLHVASLA DDKMVRFWRI DEDYPVQVAP 350
    LSNGLCCAFS TDGSVLAAGT HDGSVYFWAT PRQVPSLQHL CRMSIRRVMP 400
    TQEVQELPIP SKLLEFLSYR I 421
    Length:421
    Mass (Da):47,432
    Last modified:November 1, 1999 - v1
    Checksum:i650D4942E97D4BED
    GO
    Isoform 2 (identifier: Q9Y6I7-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         14-159: Missing.

    Show »
    Length:275
    Mass (Da):30,883
    Checksum:i8F3B7D4C581CBD3D
    GO
    Isoform 3 (identifier: Q9Y6I7-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         239-244: FLWNMD → VAAILV
         245-421: Missing.

    Show »
    Length:244
    Mass (Da):27,295
    Checksum:iE3D403F3CEB81109
    GO
    Isoform 4 (identifier: Q9Y6I7-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-35: MASFPPRVNEKEIVRLRTIGELLAPAAPFDKKCGR → MLNIILIKFSSFSIRCAILSSVCLNEAITFAFLLQ
         36-237: Missing.

    Show »
    Length:219
    Mass (Da):24,724
    Checksum:i832E6744DD6F23DC
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti149 – 1491N → S in CAB53708. (PubMed:17974005)Curated
    Sequence conflicti171 – 1711E → G in CAB53708. (PubMed:17974005)Curated
    Sequence conflicti178 – 1781F → L in AAD43036. 1 PublicationCurated
    Sequence conflicti201 – 2011K → R in CAB53708. (PubMed:17974005)Curated
    Sequence conflicti231 – 2311S → P in AAD43036. 1 PublicationCurated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti16 – 161L → S.2 Publications
    Corresponds to variant rs9303634 [ dbSNP | Ensembl ].
    VAR_024701

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 3535MASFP…KKCGR → MLNIILIKFSSFSIRCAILS SVCLNEAITFAFLLQ in isoform 4. 1 PublicationVSP_053402Add
    BLAST
    Alternative sequencei14 – 159146Missing in isoform 2. 1 PublicationVSP_006792Add
    BLAST
    Alternative sequencei36 – 237202Missing in isoform 4. 1 PublicationVSP_053403Add
    BLAST
    Alternative sequencei239 – 2446FLWNMD → VAAILV in isoform 3. 1 PublicationVSP_039111
    Alternative sequencei245 – 421177Missing in isoform 3. 1 PublicationVSP_039112Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF072880 mRNA. Translation: AAD28808.1.
    AF106684 mRNA. Translation: AAD43037.1.
    AF069313 mRNA. Translation: AAD20954.2.
    AF240696 mRNA. Translation: AAF82746.1.
    AL110243 mRNA. Translation: CAB53693.1.
    AF112205 mRNA. Translation: AAF17193.1.
    AF106683 mRNA. Translation: AAD43036.1.
    AL110269 mRNA. Translation: CAB53708.2.
    BC021110 mRNA. Translation: AAH21110.1.
    CCDSiCCDS11220.1. [Q9Y6I7-1]
    CCDS11221.1. [Q9Y6I7-2]
    PIRiT14773.
    T14788.
    RefSeqiNP_056441.6. NM_015626.8. [Q9Y6I7-1]
    NP_599027.1. NM_134265.2. [Q9Y6I7-2]
    UniGeneiHs.446017.

    Genome annotation databases

    EnsembliENST00000262394; ENSP00000262394; ENSG00000109046. [Q9Y6I7-1]
    ENST00000348811; ENSP00000327055; ENSG00000109046. [Q9Y6I7-2]
    GeneIDi26118.
    KEGGihsa:26118.
    UCSCiuc002gzd.1. human. [Q9Y6I7-1]
    uc002gze.1. human. [Q9Y6I7-2]

    Polymorphism databases

    DMDMi20532298.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF072880 mRNA. Translation: AAD28808.1 .
    AF106684 mRNA. Translation: AAD43037.1 .
    AF069313 mRNA. Translation: AAD20954.2 .
    AF240696 mRNA. Translation: AAF82746.1 .
    AL110243 mRNA. Translation: CAB53693.1 .
    AF112205 mRNA. Translation: AAF17193.1 .
    AF106683 mRNA. Translation: AAD43036.1 .
    AL110269 mRNA. Translation: CAB53708.2 .
    BC021110 mRNA. Translation: AAH21110.1 .
    CCDSi CCDS11220.1. [Q9Y6I7-1 ]
    CCDS11221.1. [Q9Y6I7-2 ]
    PIRi T14773.
    T14788.
    RefSeqi NP_056441.6. NM_015626.8. [Q9Y6I7-1 ]
    NP_599027.1. NM_134265.2. [Q9Y6I7-2 ]
    UniGenei Hs.446017.

    3D structure databases

    ProteinModelPortali Q9Y6I7.
    SMRi Q9Y6I7. Positions 38-378.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 117560. 12 interactions.
    IntActi Q9Y6I7. 5 interactions.
    MINTi MINT-4713879.
    STRINGi 9606.ENSP00000262394.

    PTM databases

    PhosphoSitei Q9Y6I7.

    Polymorphism databases

    DMDMi 20532298.

    Proteomic databases

    MaxQBi Q9Y6I7.
    PaxDbi Q9Y6I7.
    PRIDEi Q9Y6I7.

    Protocols and materials databases

    DNASUi 26118.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000262394 ; ENSP00000262394 ; ENSG00000109046 . [Q9Y6I7-1 ]
    ENST00000348811 ; ENSP00000327055 ; ENSG00000109046 . [Q9Y6I7-2 ]
    GeneIDi 26118.
    KEGGi hsa:26118.
    UCSCi uc002gzd.1. human. [Q9Y6I7-1 ]
    uc002gze.1. human. [Q9Y6I7-2 ]

    Organism-specific databases

    CTDi 26118.
    GeneCardsi GC17P025621.
    HGNCi HGNC:19221. WSB1.
    HPAi HPA003293.
    MIMi 610091. gene.
    neXtProti NX_Q9Y6I7.
    PharmGKBi PA134867554.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG2319.
    HOGENOMi HOG000063727.
    HOVERGENi HBG034543.
    InParanoidi Q9Y6I7.
    KOi K10341.
    OMAi KLVPWSQ.
    PhylomeDBi Q9Y6I7.
    TreeFami TF329216.

    Enzyme and pathway databases

    UniPathwayi UPA00143 .
    Reactomei REACT_75842. Antigen processing: Ubiquitination & Proteasome degradation.
    SignaLinki Q9Y6I7.

    Miscellaneous databases

    ChiTaRSi WSB1. human.
    GeneWikii WSB1.
    GenomeRNAii 26118.
    NextBioi 48120.
    PROi Q9Y6I7.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9Y6I7.
    Bgeei Q9Y6I7.
    CleanExi HS_WSB1.
    Genevestigatori Q9Y6I7.

    Family and domain databases

    Gene3Di 2.130.10.10. 1 hit.
    InterProi IPR020472. G-protein_beta_WD-40_rep.
    IPR001496. SOCS_C.
    IPR015943. WD40/YVTN_repeat-like_dom.
    IPR001680. WD40_repeat.
    IPR019775. WD40_repeat_CS.
    IPR017986. WD40_repeat_dom.
    [Graphical view ]
    Pfami PF07525. SOCS_box. 1 hit.
    PF00400. WD40. 5 hits.
    [Graphical view ]
    PRINTSi PR00320. GPROTEINBRPT.
    SMARTi SM00253. SOCS. 1 hit.
    SM00969. SOCS_box. 1 hit.
    SM00320. WD40. 6 hits.
    [Graphical view ]
    SUPFAMi SSF50978. SSF50978. 2 hits.
    PROSITEi PS50225. SOCS. 1 hit.
    PS00678. WD_REPEATS_1. 2 hits.
    PS50082. WD_REPEATS_2. 6 hits.
    PS50294. WD_REPEATS_REGION. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "SWiP-1: novel SOCS box containing WD-protein regulated by signalling centres and by Shh during development."
      Vasiliauskas D., Hancock S., Stern C.D.
      Mech. Dev. 82:79-94(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    2. "Human wsb-1 isoform gene."
      Peng Y., Song H., Dai M., Huang Q., Mao Y., Zhang Q., Mao M., Fu G., Luo M., Chen J., Hu R.
      Submitted (NOV-1998) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4).
      Tissue: Pituitary.
    3. Zhang J.W., Liu T.X., Shen Y., Chen S.J., Chen Z.
      Submitted (MAR-2000) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT SER-16.
      Tissue: Brain.
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT SER-16.
      Tissue: Hypothalamus.
    6. Song H., Peng Y., Dai M., Huang Q., Mao Y., Zhang Q., Mao M., Fu G., Luo M., Chen J., Hu R.
      Submitted (NOV-1998) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Pituitary.
    7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Tissue: Brain.
    8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Colon.
    9. "VHL-box and SOCS-box domains determine binding specificity for Cul2-Rbx1 and Cul5-Rbx2 modules of ubiquitin ligases."
      Kamura T., Maenaka K., Kotoshiba S., Matsumoto M., Kohda D., Conaway R.C., Conaway J.W., Nakayama K.I.
      Genes Dev. 18:3055-3065(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION IN AN E3 UBIQUITIN-PROTEIN LIGASE COMPLEX, IDENTIFICATION BY MASS SPECTROMETRY, INTERACTION WITH CUL5; RNF7; TCEB1 AND TCEB2.
    10. "The Hedgehog-inducible ubiquitin ligase subunit WSB-1 modulates thyroid hormone activation and PTHrP secretion in the developing growth plate."
      Dentice M., Bandyopadhyay A., Gereben B., Callebaut I., Christoffolete M.A., Kim B.W., Nissim S., Mornon J.P., Zavacki A.M., Zeold A., Capelo L.P., Curcio-Morelli C., Ribeiro R., Harney J.W., Tabin C.J., Bianco A.C.
      Nat. Cell Biol. 7:698-705(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, SUBUNIT, INTERACTION WITH DIO2.
    11. "Ubiquitination and degradation of homeodomain-interacting protein kinase 2 by WD40 repeat/SOCS box protein WSB-1."
      Choi D.W., Seo Y.-M., Kim E.-A., Sung K.S., Ahn J.W., Park S.-J., Lee S.-R., Choi C.Y.
      J. Biol. Chem. 283:4682-4689(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH HIPK2.

    Entry informationi

    Entry nameiWSB1_HUMAN
    AccessioniPrimary (citable) accession number: Q9Y6I7
    Secondary accession number(s): Q9NRB1
    , Q9UBH9, Q9UG25, Q9UNN6, Q9Y656
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 10, 2002
    Last sequence update: November 1, 1999
    Last modified: October 1, 2014
    This is version 132 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 17
      Human chromosome 17: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PATHWAY comments
      Index of metabolic and biosynthesis pathways
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3