Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

WD repeat and SOCS box-containing protein 1

Gene

WSB1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Probable substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Recognizes type II iodothyronine deiodinase/DIO2. Confers constitutive instability to HIPK2 through proteasomal degradation.3 Publications

Pathwayi

GO - Biological processi

  1. intracellular signal transduction Source: InterPro
  2. protein ubiquitination Source: UniProtKB-UniPathway
Complete GO annotation...

Keywords - Biological processi

Ubl conjugation pathway

Enzyme and pathway databases

ReactomeiREACT_75842. Antigen processing: Ubiquitination & Proteasome degradation.
SignaLinkiQ9Y6I7.
UniPathwayiUPA00143.

Names & Taxonomyi

Protein namesi
Recommended name:
WD repeat and SOCS box-containing protein 1
Short name:
WSB-1
Alternative name(s):
SOCS box-containing WD protein SWiP-1
Gene namesi
Name:WSB1
Synonyms:SWIP1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 17

Organism-specific databases

HGNCiHGNC:19221. WSB1.

Subcellular locationi

GO - Cellular componenti

  1. intracellular Source: LIFEdb
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134867554.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 421421WD repeat and SOCS box-containing protein 1PRO_0000051457Add
BLAST

Proteomic databases

MaxQBiQ9Y6I7.
PaxDbiQ9Y6I7.
PRIDEiQ9Y6I7.

PTM databases

PhosphoSiteiQ9Y6I7.

Expressioni

Gene expression databases

BgeeiQ9Y6I7.
CleanExiHS_WSB1.
ExpressionAtlasiQ9Y6I7. baseline and differential.
GenevestigatoriQ9Y6I7.

Organism-specific databases

HPAiHPA003293.

Interactioni

Subunit structurei

Interacts with DIO2. Component of the probable ECS(WSB1) E3 ubiquitin ligase complex which contains CUL5, RNF7/RBX2, Elongin BC complex and WSB1. Component of a probable ECS-like E3 ubiquitin-protein ligase complex which contains CUL5, RBX1, Elongin BC complex and WSB1. Interacts with CUL5, RNF7, TCEB1 and TCEB2. Binds to HIPK2 through WD40 repeats.3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
Hipk2Q9QZR55EBI-1171494,EBI-366905From a different organism.

Protein-protein interaction databases

BioGridi117560. 12 interactions.
IntActiQ9Y6I7. 5 interactions.
MINTiMINT-4713879.
STRINGi9606.ENSP00000262394.

Structurei

3D structure databases

ProteinModelPortaliQ9Y6I7.
SMRiQ9Y6I7. Positions 38-409.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati32 – 7140WD 1Add
BLAST
Repeati124 – 16542WD 2Add
BLAST
Repeati168 – 20841WD 3Add
BLAST
Repeati212 – 25140WD 4Add
BLAST
Repeati254 – 29340WD 5Add
BLAST
Repeati309 – 34638WD 6Add
BLAST
Domaini372 – 42150SOCS boxPROSITE-ProRule annotationAdd
BLAST

Domaini

The SOCS box domain mediates the interaction with the Elongin BC complex, an adapter module in different E3 ubiquitin ligase complexes.By similarity

Sequence similaritiesi

Contains 1 SOCS box domain.PROSITE-ProRule annotation
Contains 6 WD repeats.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

eggNOGiCOG2319.
GeneTreeiENSGT00780000121941.
HOGENOMiHOG000063727.
HOVERGENiHBG034543.
InParanoidiQ9Y6I7.
KOiK10341.
OMAiKLVPWSQ.
PhylomeDBiQ9Y6I7.
TreeFamiTF329216.

Family and domain databases

Gene3Di2.130.10.10. 1 hit.
InterProiIPR020472. G-protein_beta_WD-40_rep.
IPR001496. SOCS_C.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamiPF07525. SOCS_box. 1 hit.
PF00400. WD40. 5 hits.
[Graphical view]
PRINTSiPR00320. GPROTEINBRPT.
SMARTiSM00253. SOCS. 1 hit.
SM00969. SOCS_box. 1 hit.
SM00320. WD40. 6 hits.
[Graphical view]
SUPFAMiSSF50978. SSF50978. 2 hits.
PROSITEiPS50225. SOCS. 1 hit.
PS00678. WD_REPEATS_1. 2 hits.
PS50082. WD_REPEATS_2. 6 hits.
PS50294. WD_REPEATS_REGION. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9Y6I7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MASFPPRVNE KEIVRLRTIG ELLAPAAPFD KKCGRENWTV AFAPDGSYFA
60 70 80 90 100
WSQGHRTVKL VPWSQCLQNF LLHGTKNVTN SSSLRLPRQN SDGGQKNKPR
110 120 130 140 150
EHIIDCGDIV WSLAFGSSVP EKQSRCVNIE WHRFRFGQDQ LLLATGLNNG
160 170 180 190 200
RIKIWDVYTG KLLLNLVDHT EVVRDLTFAP DGSLILVSAS RDKTLRVWDL
210 220 230 240 250
KDDGNMMKVL RGHQNWVYSC AFSPDSSMLC SVGASKAVFL WNMDKYTMIR
260 270 280 290 300
KLEGHHHDVV ACDFSPDGAL LATASYDTRV YIWDPHNGDI LMEFGHLFPP
310 320 330 340 350
PTPIFAGGAN DRWVRSVSFS HDGLHVASLA DDKMVRFWRI DEDYPVQVAP
360 370 380 390 400
LSNGLCCAFS TDGSVLAAGT HDGSVYFWAT PRQVPSLQHL CRMSIRRVMP
410 420
TQEVQELPIP SKLLEFLSYR I
Length:421
Mass (Da):47,432
Last modified:November 1, 1999 - v1
Checksum:i650D4942E97D4BED
GO
Isoform 2 (identifier: Q9Y6I7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     14-159: Missing.

Show »
Length:275
Mass (Da):30,883
Checksum:i8F3B7D4C581CBD3D
GO
Isoform 3 (identifier: Q9Y6I7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     239-244: FLWNMD → VAAILV
     245-421: Missing.

Show »
Length:244
Mass (Da):27,295
Checksum:iE3D403F3CEB81109
GO
Isoform 4 (identifier: Q9Y6I7-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-35: MASFPPRVNEKEIVRLRTIGELLAPAAPFDKKCGR → MLNIILIKFSSFSIRCAILSSVCLNEAITFAFLLQ
     36-237: Missing.

Show »
Length:219
Mass (Da):24,724
Checksum:i832E6744DD6F23DC
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti149 – 1491N → S in CAB53708 (PubMed:17974005).Curated
Sequence conflicti171 – 1711E → G in CAB53708 (PubMed:17974005).Curated
Sequence conflicti178 – 1781F → L in AAD43036 (Ref. 6) Curated
Sequence conflicti201 – 2011K → R in CAB53708 (PubMed:17974005).Curated
Sequence conflicti231 – 2311S → P in AAD43036 (Ref. 6) Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti16 – 161L → S.2 Publications
Corresponds to variant rs9303634 [ dbSNP | Ensembl ].
VAR_024701

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3535MASFP…KKCGR → MLNIILIKFSSFSIRCAILS SVCLNEAITFAFLLQ in isoform 4. 1 PublicationVSP_053402Add
BLAST
Alternative sequencei14 – 159146Missing in isoform 2. 1 PublicationVSP_006792Add
BLAST
Alternative sequencei36 – 237202Missing in isoform 4. 1 PublicationVSP_053403Add
BLAST
Alternative sequencei239 – 2446FLWNMD → VAAILV in isoform 3. 1 PublicationVSP_039111
Alternative sequencei245 – 421177Missing in isoform 3. 1 PublicationVSP_039112Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF072880 mRNA. Translation: AAD28808.1.
AF106684 mRNA. Translation: AAD43037.1.
AF069313 mRNA. Translation: AAD20954.2.
AF240696 mRNA. Translation: AAF82746.1.
AL110243 mRNA. Translation: CAB53693.1.
AF112205 mRNA. Translation: AAF17193.1.
AF106683 mRNA. Translation: AAD43036.1.
AL110269 mRNA. Translation: CAB53708.2.
BC021110 mRNA. Translation: AAH21110.1.
CCDSiCCDS11220.1. [Q9Y6I7-1]
CCDS11221.1. [Q9Y6I7-2]
PIRiT14773.
T14788.
RefSeqiNP_056441.6. NM_015626.8. [Q9Y6I7-1]
NP_599027.1. NM_134265.2. [Q9Y6I7-2]
UniGeneiHs.446017.

Genome annotation databases

EnsembliENST00000262394; ENSP00000262394; ENSG00000109046. [Q9Y6I7-1]
ENST00000348811; ENSP00000327055; ENSG00000109046. [Q9Y6I7-2]
GeneIDi26118.
KEGGihsa:26118.
UCSCiuc002gzd.1. human. [Q9Y6I7-1]
uc002gze.1. human. [Q9Y6I7-2]

Polymorphism databases

DMDMi20532298.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF072880 mRNA. Translation: AAD28808.1.
AF106684 mRNA. Translation: AAD43037.1.
AF069313 mRNA. Translation: AAD20954.2.
AF240696 mRNA. Translation: AAF82746.1.
AL110243 mRNA. Translation: CAB53693.1.
AF112205 mRNA. Translation: AAF17193.1.
AF106683 mRNA. Translation: AAD43036.1.
AL110269 mRNA. Translation: CAB53708.2.
BC021110 mRNA. Translation: AAH21110.1.
CCDSiCCDS11220.1. [Q9Y6I7-1]
CCDS11221.1. [Q9Y6I7-2]
PIRiT14773.
T14788.
RefSeqiNP_056441.6. NM_015626.8. [Q9Y6I7-1]
NP_599027.1. NM_134265.2. [Q9Y6I7-2]
UniGeneiHs.446017.

3D structure databases

ProteinModelPortaliQ9Y6I7.
SMRiQ9Y6I7. Positions 38-409.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi117560. 12 interactions.
IntActiQ9Y6I7. 5 interactions.
MINTiMINT-4713879.
STRINGi9606.ENSP00000262394.

PTM databases

PhosphoSiteiQ9Y6I7.

Polymorphism databases

DMDMi20532298.

Proteomic databases

MaxQBiQ9Y6I7.
PaxDbiQ9Y6I7.
PRIDEiQ9Y6I7.

Protocols and materials databases

DNASUi26118.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000262394; ENSP00000262394; ENSG00000109046. [Q9Y6I7-1]
ENST00000348811; ENSP00000327055; ENSG00000109046. [Q9Y6I7-2]
GeneIDi26118.
KEGGihsa:26118.
UCSCiuc002gzd.1. human. [Q9Y6I7-1]
uc002gze.1. human. [Q9Y6I7-2]

Organism-specific databases

CTDi26118.
GeneCardsiGC17P025621.
HGNCiHGNC:19221. WSB1.
HPAiHPA003293.
MIMi610091. gene.
neXtProtiNX_Q9Y6I7.
PharmGKBiPA134867554.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiCOG2319.
GeneTreeiENSGT00780000121941.
HOGENOMiHOG000063727.
HOVERGENiHBG034543.
InParanoidiQ9Y6I7.
KOiK10341.
OMAiKLVPWSQ.
PhylomeDBiQ9Y6I7.
TreeFamiTF329216.

Enzyme and pathway databases

UniPathwayiUPA00143.
ReactomeiREACT_75842. Antigen processing: Ubiquitination & Proteasome degradation.
SignaLinkiQ9Y6I7.

Miscellaneous databases

ChiTaRSiWSB1. human.
GeneWikiiWSB1.
GenomeRNAii26118.
NextBioi48120.
PROiQ9Y6I7.
SOURCEiSearch...

Gene expression databases

BgeeiQ9Y6I7.
CleanExiHS_WSB1.
ExpressionAtlasiQ9Y6I7. baseline and differential.
GenevestigatoriQ9Y6I7.

Family and domain databases

Gene3Di2.130.10.10. 1 hit.
InterProiIPR020472. G-protein_beta_WD-40_rep.
IPR001496. SOCS_C.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamiPF07525. SOCS_box. 1 hit.
PF00400. WD40. 5 hits.
[Graphical view]
PRINTSiPR00320. GPROTEINBRPT.
SMARTiSM00253. SOCS. 1 hit.
SM00969. SOCS_box. 1 hit.
SM00320. WD40. 6 hits.
[Graphical view]
SUPFAMiSSF50978. SSF50978. 2 hits.
PROSITEiPS50225. SOCS. 1 hit.
PS00678. WD_REPEATS_1. 2 hits.
PS50082. WD_REPEATS_2. 6 hits.
PS50294. WD_REPEATS_REGION. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "SWiP-1: novel SOCS box containing WD-protein regulated by signalling centres and by Shh during development."
    Vasiliauskas D., Hancock S., Stern C.D.
    Mech. Dev. 82:79-94(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "Human wsb-1 isoform gene."
    Peng Y., Song H., Dai M., Huang Q., Mao Y., Zhang Q., Mao M., Fu G., Luo M., Chen J., Hu R.
    Submitted (NOV-1998) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4).
    Tissue: Pituitary.
  3. Zhang J.W., Liu T.X., Shen Y., Chen S.J., Chen Z.
    Submitted (MAR-2000) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT SER-16.
    Tissue: Brain.
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT SER-16.
    Tissue: Hypothalamus.
  6. Song H., Peng Y., Dai M., Huang Q., Mao Y., Zhang Q., Mao M., Fu G., Luo M., Chen J., Hu R.
    Submitted (NOV-1998) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Pituitary.
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Brain.
  8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Colon.
  9. "VHL-box and SOCS-box domains determine binding specificity for Cul2-Rbx1 and Cul5-Rbx2 modules of ubiquitin ligases."
    Kamura T., Maenaka K., Kotoshiba S., Matsumoto M., Kohda D., Conaway R.C., Conaway J.W., Nakayama K.I.
    Genes Dev. 18:3055-3065(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION IN AN E3 UBIQUITIN-PROTEIN LIGASE COMPLEX, IDENTIFICATION BY MASS SPECTROMETRY, INTERACTION WITH CUL5; RNF7; TCEB1 AND TCEB2.
  10. "The Hedgehog-inducible ubiquitin ligase subunit WSB-1 modulates thyroid hormone activation and PTHrP secretion in the developing growth plate."
    Dentice M., Bandyopadhyay A., Gereben B., Callebaut I., Christoffolete M.A., Kim B.W., Nissim S., Mornon J.P., Zavacki A.M., Zeold A., Capelo L.P., Curcio-Morelli C., Ribeiro R., Harney J.W., Tabin C.J., Bianco A.C.
    Nat. Cell Biol. 7:698-705(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBUNIT, INTERACTION WITH DIO2.
  11. "Ubiquitination and degradation of homeodomain-interacting protein kinase 2 by WD40 repeat/SOCS box protein WSB-1."
    Choi D.W., Seo Y.-M., Kim E.-A., Sung K.S., Ahn J.W., Park S.-J., Lee S.-R., Choi C.Y.
    J. Biol. Chem. 283:4682-4689(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH HIPK2.

Entry informationi

Entry nameiWSB1_HUMAN
AccessioniPrimary (citable) accession number: Q9Y6I7
Secondary accession number(s): Q9NRB1
, Q9UBH9, Q9UG25, Q9UNN6, Q9Y656
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 10, 2002
Last sequence update: November 1, 1999
Last modified: February 4, 2015
This is version 136 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.