Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9Y6I7 (WSB1_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 130. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (6) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
WD repeat and SOCS box-containing protein 1

Short name=WSB-1
Alternative name(s):
SOCS box-containing WD protein SWiP-1
Gene names
Name:WSB1
Synonyms:SWIP1
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length421 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Probable substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Recognizes type II iodothyronine deiodinase/DIO2. Confers constitutive instability to HIPK2 through proteasomal degradation. Ref.9 Ref.10 Ref.11

Pathway

Protein modification; protein ubiquitination.

Subunit structure

Interacts with DIO2. Component of the probable ECS(WSB1) E3 ubiquitin ligase complex which contains CUL5, RNF7/RBX2, Elongin BC complex and WSB1. Component of a probable ECS-like E3 ubiquitin-protein ligase complex which contains CUL5, RBX1, Elongin BC complex and WSB1. Interacts with CUL5, RNF7, TCEB1 and TCEB2. Binds to HIPK2 through WD40 repeats. Ref.9 Ref.10 Ref.11

Domain

The SOCS box domain mediates the interaction with the Elongin BC complex, an adapter module in different E3 ubiquitin ligase complexes By similarity.

Sequence similarities

Contains 1 SOCS box domain.

Contains 6 WD repeats.

Ontologies

Keywords
   Biological processUbl conjugation pathway
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainRepeat
WD repeat
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processintracellular signal transduction

Inferred from electronic annotation. Source: InterPro

protein ubiquitination

Inferred from electronic annotation. Source: UniProtKB-UniPathway

   Cellular_componentintracellular

Inferred from direct assay. Source: LIFEdb

   Molecular_functionprotein binding

Inferred from physical interaction Ref.11. Source: IntAct

Complete GO annotation...

Binary interactions

With

Entry

#Exp.

IntAct

Notes

Hipk2Q9QZR55EBI-1171494,EBI-366905From a different organism.

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9Y6I7-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9Y6I7-2)

The sequence of this isoform differs from the canonical sequence as follows:
     14-159: Missing.
Isoform 3 (identifier: Q9Y6I7-3)

The sequence of this isoform differs from the canonical sequence as follows:
     239-244: FLWNMD → VAAILV
     245-421: Missing.
Isoform 4 (identifier: Q9Y6I7-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-35: MASFPPRVNEKEIVRLRTIGELLAPAAPFDKKCGR → MLNIILIKFSSFSIRCAILSSVCLNEAITFAFLLQ
     36-237: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 421421WD repeat and SOCS box-containing protein 1
PRO_0000051457

Regions

Repeat32 – 7140WD 1
Repeat124 – 16542WD 2
Repeat168 – 20841WD 3
Repeat212 – 25140WD 4
Repeat254 – 29340WD 5
Repeat309 – 34638WD 6
Domain372 – 42150SOCS box

Natural variations

Alternative sequence1 – 3535MASFP…KKCGR → MLNIILIKFSSFSIRCAILS SVCLNEAITFAFLLQ in isoform 4.
VSP_053402
Alternative sequence14 – 159146Missing in isoform 2.
VSP_006792
Alternative sequence36 – 237202Missing in isoform 4.
VSP_053403
Alternative sequence239 – 2446FLWNMD → VAAILV in isoform 3.
VSP_039111
Alternative sequence245 – 421177Missing in isoform 3.
VSP_039112
Natural variant161L → S. Ref.4 Ref.5
Corresponds to variant rs9303634 [ dbSNP | Ensembl ].
VAR_024701

Experimental info

Sequence conflict1491N → S in CAB53708. Ref.7
Sequence conflict1711E → G in CAB53708. Ref.7
Sequence conflict1781F → L in AAD43036. Ref.6
Sequence conflict2011K → R in CAB53708. Ref.7
Sequence conflict2311S → P in AAD43036. Ref.6

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified November 1, 1999. Version 1.
Checksum: 650D4942E97D4BED

FASTA42147,432
        10         20         30         40         50         60 
MASFPPRVNE KEIVRLRTIG ELLAPAAPFD KKCGRENWTV AFAPDGSYFA WSQGHRTVKL 

        70         80         90        100        110        120 
VPWSQCLQNF LLHGTKNVTN SSSLRLPRQN SDGGQKNKPR EHIIDCGDIV WSLAFGSSVP 

       130        140        150        160        170        180 
EKQSRCVNIE WHRFRFGQDQ LLLATGLNNG RIKIWDVYTG KLLLNLVDHT EVVRDLTFAP 

       190        200        210        220        230        240 
DGSLILVSAS RDKTLRVWDL KDDGNMMKVL RGHQNWVYSC AFSPDSSMLC SVGASKAVFL 

       250        260        270        280        290        300 
WNMDKYTMIR KLEGHHHDVV ACDFSPDGAL LATASYDTRV YIWDPHNGDI LMEFGHLFPP 

       310        320        330        340        350        360 
PTPIFAGGAN DRWVRSVSFS HDGLHVASLA DDKMVRFWRI DEDYPVQVAP LSNGLCCAFS 

       370        380        390        400        410        420 
TDGSVLAAGT HDGSVYFWAT PRQVPSLQHL CRMSIRRVMP TQEVQELPIP SKLLEFLSYR 


I 

« Hide

Isoform 2 [UniParc].

Checksum: 8F3B7D4C581CBD3D
Show »

FASTA27530,883
Isoform 3 [UniParc].

Checksum: E3D403F3CEB81109
Show »

FASTA24427,295
Isoform 4 [UniParc].

Checksum: 832E6744DD6F23DC
Show »

FASTA21924,724

References

« Hide 'large scale' references
[1]"SWiP-1: novel SOCS box containing WD-protein regulated by signalling centres and by Shh during development."
Vasiliauskas D., Hancock S., Stern C.D.
Mech. Dev. 82:79-94(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
[2]"Human wsb-1 isoform gene."
Peng Y., Song H., Dai M., Huang Q., Mao Y., Zhang Q., Mao M., Fu G., Luo M., Chen J., Hu R.
Submitted (NOV-1998) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4).
Tissue: Pituitary.
[3]Zhang J.W., Liu T.X., Shen Y., Chen S.J., Chen Z.
Submitted (MAR-2000) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
[4]"Towards a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs."
Wiemann S., Weil B., Wellenreuther R., Gassenhuber J., Glassl S., Ansorge W., Boecher M., Bloecker H., Bauersachs S., Blum H., Lauber J., Duesterhoeft A., Beyer A., Koehrer K., Strack N., Mewes H.-W., Ottenwaelder B., Obermaier B. expand/collapse author list , Tampe J., Heubner D., Wambutt R., Korn B., Klein M., Poustka A.
Genome Res. 11:422-435(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT SER-16.
Tissue: Brain.
[5]"Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning."
Hu R.-M., Han Z.-G., Song H.-D., Peng Y.-D., Huang Q.-H., Ren S.-X., Gu Y.-J., Huang C.-H., Li Y.-B., Jiang C.-L., Fu G., Zhang Q.-H., Gu B.-W., Dai M., Mao Y.-F., Gao G.-F., Rong R., Ye M. expand/collapse author list , Zhou J., Xu S.-H., Gu J., Shi J.-X., Jin W.-R., Zhang C.-K., Wu T.-M., Huang G.-Y., Chen Z., Chen M.-D., Chen J.-L.
Proc. Natl. Acad. Sci. U.S.A. 97:9543-9548(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT SER-16.
Tissue: Hypothalamus.
[6]Song H., Peng Y., Dai M., Huang Q., Mao Y., Zhang Q., Mao M., Fu G., Luo M., Chen J., Hu R.
Submitted (NOV-1998) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Pituitary.
[7]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
Tissue: Brain.
[8]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Colon.
[9]"VHL-box and SOCS-box domains determine binding specificity for Cul2-Rbx1 and Cul5-Rbx2 modules of ubiquitin ligases."
Kamura T., Maenaka K., Kotoshiba S., Matsumoto M., Kohda D., Conaway R.C., Conaway J.W., Nakayama K.I.
Genes Dev. 18:3055-3065(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION IN AN E3 UBIQUITIN-PROTEIN LIGASE COMPLEX, IDENTIFICATION BY MASS SPECTROMETRY, INTERACTION WITH CUL5; RNF7; TCEB1 AND TCEB2.
[10]"The Hedgehog-inducible ubiquitin ligase subunit WSB-1 modulates thyroid hormone activation and PTHrP secretion in the developing growth plate."
Dentice M., Bandyopadhyay A., Gereben B., Callebaut I., Christoffolete M.A., Kim B.W., Nissim S., Mornon J.P., Zavacki A.M., Zeold A., Capelo L.P., Curcio-Morelli C., Ribeiro R., Harney J.W., Tabin C.J., Bianco A.C.
Nat. Cell Biol. 7:698-705(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, SUBUNIT, INTERACTION WITH DIO2.
[11]"Ubiquitination and degradation of homeodomain-interacting protein kinase 2 by WD40 repeat/SOCS box protein WSB-1."
Choi D.W., Seo Y.-M., Kim E.-A., Sung K.S., Ahn J.W., Park S.-J., Lee S.-R., Choi C.Y.
J. Biol. Chem. 283:4682-4689(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, INTERACTION WITH HIPK2.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF072880 mRNA. Translation: AAD28808.1.
AF106684 mRNA. Translation: AAD43037.1.
AF069313 mRNA. Translation: AAD20954.2.
AF240696 mRNA. Translation: AAF82746.1.
AL110243 mRNA. Translation: CAB53693.1.
AF112205 mRNA. Translation: AAF17193.1.
AF106683 mRNA. Translation: AAD43036.1.
AL110269 mRNA. Translation: CAB53708.2.
BC021110 mRNA. Translation: AAH21110.1.
CCDSCCDS11220.1. [Q9Y6I7-1]
CCDS11221.1. [Q9Y6I7-2]
PIRT14773.
T14788.
RefSeqNP_056441.6. NM_015626.8. [Q9Y6I7-1]
NP_599027.1. NM_134265.2. [Q9Y6I7-2]
UniGeneHs.446017.

3D structure databases

ProteinModelPortalQ9Y6I7.
SMRQ9Y6I7. Positions 38-378.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid117560. 12 interactions.
IntActQ9Y6I7. 5 interactions.
MINTMINT-4713879.
STRING9606.ENSP00000262394.

PTM databases

PhosphoSiteQ9Y6I7.

Polymorphism databases

DMDM20532298.

Proteomic databases

MaxQBQ9Y6I7.
PaxDbQ9Y6I7.
PRIDEQ9Y6I7.

Protocols and materials databases

DNASU26118.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000262394; ENSP00000262394; ENSG00000109046. [Q9Y6I7-1]
ENST00000348811; ENSP00000327055; ENSG00000109046. [Q9Y6I7-2]
GeneID26118.
KEGGhsa:26118.
UCSCuc002gzd.1. human. [Q9Y6I7-1]
uc002gze.1. human. [Q9Y6I7-2]

Organism-specific databases

CTD26118.
GeneCardsGC17P025621.
HGNCHGNC:19221. WSB1.
HPAHPA003293.
MIM610091. gene.
neXtProtNX_Q9Y6I7.
PharmGKBPA134867554.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG2319.
HOGENOMHOG000063727.
HOVERGENHBG034543.
InParanoidQ9Y6I7.
KOK10341.
OMAKLVPWSQ.
PhylomeDBQ9Y6I7.
TreeFamTF329216.

Enzyme and pathway databases

ReactomeREACT_6900. Immune System.
SignaLinkQ9Y6I7.
UniPathwayUPA00143.

Gene expression databases

ArrayExpressQ9Y6I7.
BgeeQ9Y6I7.
CleanExHS_WSB1.
GenevestigatorQ9Y6I7.

Family and domain databases

Gene3D2.130.10.10. 1 hit.
InterProIPR020472. G-protein_beta_WD-40_rep.
IPR001496. SOCS_C.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamPF07525. SOCS_box. 1 hit.
PF00400. WD40. 5 hits.
[Graphical view]
PRINTSPR00320. GPROTEINBRPT.
SMARTSM00253. SOCS. 1 hit.
SM00969. SOCS_box. 1 hit.
SM00320. WD40. 6 hits.
[Graphical view]
SUPFAMSSF50978. SSF50978. 2 hits.
PROSITEPS50225. SOCS. 1 hit.
PS00678. WD_REPEATS_1. 2 hits.
PS50082. WD_REPEATS_2. 6 hits.
PS50294. WD_REPEATS_REGION. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSWSB1. human.
GeneWikiWSB1.
GenomeRNAi26118.
NextBio48120.
PROQ9Y6I7.
SOURCESearch...

Entry information

Entry nameWSB1_HUMAN
AccessionPrimary (citable) accession number: Q9Y6I7
Secondary accession number(s): Q9NRB1 expand/collapse secondary AC list , Q9UBH9, Q9UG25, Q9UNN6, Q9Y656
Entry history
Integrated into UniProtKB/Swiss-Prot: May 10, 2002
Last sequence update: November 1, 1999
Last modified: July 9, 2014
This is version 130 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PATHWAY comments

Index of metabolic and biosynthesis pathways

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 17

Human chromosome 17: entries, gene names and cross-references to MIM