Q9Y6I4 (UBP3_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 109.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Ubiquitin carboxyl-terminal hydrolase 3 EC=3.4.19.12 Alternative name(s): Deubiquitinating enzyme 3 Ubiquitin thioesterase 3 Ubiquitin-specific-processing protease 3 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 520 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Hydrolase that deubiquitinates monoubiquitinated target proteins such as histone H2A and H2B. Required for proper progression through S phase and subsequent mitotic entry. May regulate the DNA damage response (DDR) checkpoint through deubiquitination of H2A at DNA damage sites. Associates with the chromatin. Ref.7 |
| Catalytic activity | Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal). |
| Subunit structure | Interacts (via UBP-type domain) with H2A; the interaction is less efficient than with monoubiquitinated H2A. Ref.7 |
| Subcellular location | Nucleus. Note: Localizes preferentially with monoubiquitinated H2A to chromatin. Ref.7 |
| Tissue specificity | Expressed in all tissues examined, with strongest expression in pancreas. |
| Domain | Both protease activity and an intact zinc finger are required for H2A monodeubiquitination. |
| Sequence similarities | Belongs to the peptidase C19 family. USP3 subfamily. Contains 1 UBP-type zinc finger. |
| Sequence caution | The sequence AAD42992.1 differs from that shown. Reason: Frameshift at positions 265, 274 and 299. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9Y6I4-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9Y6I4-2) The sequence of this isoform differs from the canonical sequence as follows: 51-95: RYVNGHAKKHYEDAQVPLTNHKKSEKQDKVQHTVCMDCSSYSTYC → S | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 520 | 520 | Ubiquitin carboxyl-terminal hydrolase 3 | PRO_0000080619 | |||||
Regions | |||||||||
| Zinc finger | 27 – 104 | 78 | UBP-type | ||||||
Sites | |||||||||
| Active site | 168 | 1 | Nucleophile By similarity | ||||||
| Active site | 471 | 1 | Proton acceptor By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 51 – 95 | 45 | RYVNG…YSTYC → S in isoform 2. | VSP_044712 | |||||
| Natural variant | 360 | 1 | P → T. Corresponds to variant rs34776764 [ dbSNP | Ensembl ]. | VAR_051521 | |||||
Experimental info | |||||||||
| Mutagenesis | 56 | 1 | H → A: Does not reduce monoubiquitinated H2A and H2B stability. Interaction with monoubiquitinated H2A is strongly inhibited. Ref.7 | ||||||
| Mutagenesis | 168 | 1 | C → S: Does not reduce H2A stability. Interacts more strongly with monoubiquitinated H2A than with nonubiquitinated H2A. Its nuclear localization to chromatin is enhanced. Ref.7 | ||||||
| Sequence conflict | 439 | 1 | C → W in AAD42992. Ref.1 | ||||||
| Sequence conflict | 473 | 1 | T → I in BAG62807. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Characterization and chromosomal localization of USP3, a novel human ubiquitin-specific protease." Sloper-Mould K.E., Eyre H.J., Wang X.-W., Sutherland G.R., Baker R.T. J. Biol. Chem. 274:26878-26884(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Spleen. |
| [4] | "Analysis of the DNA sequence and duplication history of human chromosome 15." Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K., Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N., Abouelleil A. Nusbaum C.Nature 440:671-675(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Eye and Skin. |
| [7] | "Human USP3 is a chromatin modifier required for S phase progression and genome stability." Nicassio F., Corrado N., Vissers J.H., Areces L.B., Bergink S., Marteijn J.A., Geverts B., Houtsmuller A.B., Vermeulen W., Di Fiore P.P., Citterio E. Curr. Biol. 17:1972-1977(2007) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH H2A, SUBCELLULAR LOCATION, MUTAGENESIS OF HIS-56 AND CYS-168, IDENTIFICATION BY MASS SPECTROMETRY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF073344 mRNA. Translation: AAD42992.1. Frameshift. BT007269 mRNA. Translation: AAP35933.1. AK301236 mRNA. Translation: BAG62807.1. AC007950 Genomic DNA. No translation available. AC118274 Genomic DNA. No translation available. CH471082 Genomic DNA. Translation: EAW77651.1. BC018113 mRNA. Translation: AAH18113.1. BC065300 mRNA. Translation: AAH65300.1. BC107137 mRNA. Translation: AAI07138.1. BC107138 mRNA. Translation: AAI07139.1. |
| IPI | IPI00002330. IPI01008797. |
| RefSeq | NP_001243631.1. NM_001256702.1. NP_006528.2. NM_006537.3. |
| UniGene | Hs.458499. |
3D structure databases | |
| ProteinModelPortal | Q9Y6I4. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9Y6I4. 20 interactions. |
| STRING | 9606.ENSP00000369681. |
Protein family/group databases | |
| MEROPS | C19.026. |
PTM databases | |
| PhosphoSite | Q9Y6I4. |
Proteomic databases | |
| PaxDb | Q9Y6I4. |
| PRIDE | Q9Y6I4. |
Protocols and materials databases | |
| DNASU | 9960. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000380324; ENSP00000369681; ENSG00000140455. ENST00000540797; ENSP00000445828; ENSG00000140455. |
| GeneID | 9960. |
| KEGG | hsa:9960. |
| UCSC | uc002amf.3. human. |
Organism-specific databases | |
| CTD | 9960. |
| GeneCards | GC15P063796. |
| H-InvDB | HIX0012328. |
| HGNC | HGNC:12626. USP3. |
| MIM | 604728. gene. |
| neXtProt | NX_Q9Y6I4. |
| PharmGKB | PA37251. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG5533. |
| HOGENOM | HOG000231498. |
| HOVERGEN | HBG103589. |
| InParanoid | Q9Y6I4. |
| KO | K11986. |
| OMA | DCLRSFT. |
| OrthoDB | EOG4G4GQC. |
Gene expression databases | |
| ArrayExpress | Q9Y6I4. |
| Bgee | Q9Y6I4. |
| CleanEx | HS_USP3. |
| Genevestigator | Q9Y6I4. |
| GermOnline | ENSG00000140455. Homo sapiens. |
Family and domain databases | |
| Gene3D | 3.30.40.10. 1 hit. |
| InterPro | IPR018200. Pept_C19ubi-hydrolase_C_CS. IPR001394. Peptidase_C19. IPR013083. Znf_RING/FYVE/PHD. IPR001607. Znf_UBP. [Graphical view] |
| Pfam | PF00443. UCH. 1 hit. PF02148. zf-UBP. 1 hit. [Graphical view] |
| PROSITE | PS00972. UCH_2_1. 1 hit. PS00973. UCH_2_2. 1 hit. PS50235. UCH_2_3. 1 hit. PS50271. ZF_UBP. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | USP3. human. |
| GenomeRNAi | 9960. |
| NextBio | 37582. |
| SOURCE | Search... |
Entry information
| Entry name | UBP3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9Y6I4 Secondary accession number(s): B4DVU5, F5H1A6, Q8WVD0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Peptidase families Classification of peptidase families and list of entries |
| Human chromosome 15 Human chromosome 15: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
