Q9Y6H5 (SNCAP_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 103.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Synphilin-1 Short name=Sph1 Alternative name(s): Alpha-synuclein-interacting protein | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 919 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Isoform 2 inhibits the ubiquitin ligase activity of SIAH1 and inhibits proteasomal degradation of target proteins. Isoform 2 inhibits autoubiquitination and proteasomal degradation of SIAH1, and thereby increases cellular levels of SIAH. Isoform 2 modulates SNCA monoubiquitination by SIAH1. Ref.3 Ref.12 |
| Subunit structure | Homodimer Probable. Heterodimer of isoform 1 and isoform 2 Probable. Interacts with SIAH1, SIAH2, SNCA, RNF19A AND PARK2. Isoform 2 has a strong tendency to form aggregates and can sequester isoform 1. Ref.1 Ref.3 Ref.7 Ref.8 Ref.9 Ref.10 Ref.12 Ref.13 |
| Subcellular location | Cytoplasm. Note: Detected in cytoplasmic inclusion bodies, together with SNCA. Ref.1 Ref.3 Ref.10 Ref.13 |
| Tissue specificity | Detected in brain (at protein level). Widely expressed, with highest levels in brain, heart and placenta. Ref.1 Ref.3 |
| Post-translational modification | Ubiquitinated; mediated by SIAH1, SIAH2 or RNF19A and leading to its subsequent proteasomal degradation. In the absence of proteasomal degradation, ubiquitinated SNCAIP accumulates in cytoplasmic inclusion bodies. Isoform 2 is subject to limited ubiquitination that does not lead to proteasomal degradation. Ref.7 Ref.8 Ref.9 Ref.10 |
| Involvement in disease | Defects in SNCAIP may be a cause of Parkinson disease (PARK) [MIM:168600]. A complex neurodegenerative disorder characterized by bradykinesia, resting tremor, muscular rigidity and postural instability. Additional features are characteristic postural abnormalities, dysautonomia, dystonic cramps, and dementia. The pathology of Parkinson disease involves the loss of dopaminergic neurons in the substantia nigra and the presence of Lewy bodies (intraneuronal accumulations of aggregated proteins), in surviving neurons in various areas of the brain. The disease is progressive and usually manifests after the age of 50 years, although early-onset cases (before 50 years) are known. The majority of the cases are sporadic suggesting a multifactorial etiology based on environmental and genetic factors. However, some patients present with a positive family history for the disease. Familial forms of the disease usually begin at earlier ages and are associated with atypical clinical features. Ref.7 Ref.14 Ref.15 |
| Miscellaneous | Constructs encoding portions of SNCA and SNCAIP co-transfected in mammalian cells promote cytosolic inclusions resembling the Lewy bodies of Parkinson disease. Coexpression of SNCA, SNCAIP, and PARK2 result in the formation of Lewy body-like. ubiquitin-positive cytosolic inclusions. SNCAIP isoform 2 is particularly aggregatation-prone. Familial mutations in PARK2 disrupt the ubiquitination of SNCAIP and the formation of the ubiquitin-positive inclusions. These results provide a molecular basis for the ubiquitination of Lewy body-associated proteins and link PARK2 and SNCA in a common pathogenic mechanism through their interaction with SNCAIP. |
| Sequence similarities | Contains 6 ANK repeats. |
Ontologies
Alternative products
| This entry describes 6 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9Y6H5-1) Also known as: 1a; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9Y6H5-2) Also known as: Synphilin-1A; The sequence of this isoform differs from the canonical sequence as follows: 1-366: Missing. 367-394: QHLTSLMGEDCLNERNTEKLTPAGLAIK → MTYLIQSHHSRRSQNCAEDVIRKTKTDQ 919-919: A → EMYSSCINLSSNMLIEEHLCNDTRHNDINRKMKKSYSIKHIAEPESKELFL | ||||||
| Isoform 3 (identifier: Q9Y6H5-3) The sequence of this isoform differs from the canonical sequence as follows: 19-19: S → SDNRSQGNRLQKLGLEDTDREDAMGFGSHRAKLTVVAALGACHCPENE 919-919: A → EMYSSCINLSSNMLIEEHLCNDTRHNDINRKMKKSYSIKHIAEPESKELFL | ||||||
| Isoform 4 (identifier: Q9Y6H5-4) Also known as: 1b; The sequence of this isoform differs from the canonical sequence as follows: 335-394: Missing. | ||||||
| Isoform 5 (identifier: Q9Y6H5-5) The sequence of this isoform differs from the canonical sequence as follows: 1-366: Missing. 367-394: QHLTSLMGEDCLNERNTEKLTPAGLAIK → MTYLIQSHHSRRSQNCAEDVIRKTKTDQ | ||||||
| Isoform 6 (identifier: Q9Y6H5-6) Also known as: 1c; The sequence of this isoform differs from the canonical sequence as follows: 19-19: S → SDNRSQGNRLQKLGLEDTDREDAMGFGSHRAKLTVVAALGACHCPENE 476-541: LVEYGANVTM...QTVERVTLQN → RLKIQGTWNG...NQLPETKSSY 542-919: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 919 | 919 | Synphilin-1 | PRO_0000067068 | |||||||
Regions | |||||||||||
| Repeat | 349 – 380 | 32 | ANK 1 | ||||||||
| Repeat | 384 – 413 | 30 | ANK 2 | ||||||||
| Repeat | 419 – 448 | 30 | ANK 3 | ||||||||
| Repeat | 456 – 485 | 30 | ANK 4 | ||||||||
| Repeat | 603 – 632 | 30 | ANK 5 | ||||||||
| Repeat | 699 – 729 | 31 | ANK 6 | ||||||||
| Coiled coil | 515 – 552 | 38 | Potential | ||||||||
Amino acid modifications | |||||||||||
| Modified residue | 387 | 1 | Phosphothreonine Ref.11 | ||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 – 366 | 366 | Missing in isoform 2 and isoform 5. | VSP_038839 | |||||||
| Alternative sequence | 19 | 1 | S → SDNRSQGNRLQKLGLEDTDR EDAMGFGSHRAKLTVVAALG ACHCPENE in isoform 3 and isoform 6. | VSP_038840 | |||||||
| Alternative sequence | 335 – 394 | 60 | Missing in isoform 4. | VSP_038841 | |||||||
| Alternative sequence | 367 – 394 | 28 | QHLTS…GLAIK → MTYLIQSHHSRRSQNCAEDV IRKTKTDQ in isoform 2 and isoform 5. | VSP_038842 | |||||||
| Alternative sequence | 476 – 541 | 66 | LVEYG…VTLQN → RLKIQGTWNGSETCLFTHHF SSYPPISSGLQCQGQEGVLF IPDQVGAATNKQVLFQNQLP ETKSSY in isoform 6. | VSP_038843 | |||||||
| Alternative sequence | 542 – 919 | 378 | Missing in isoform 6. | VSP_038844 | |||||||
| Alternative sequence | 919 | 1 | A → EMYSSCINLSSNMLIEEHLC NDTRHNDINRKMKKSYSIKH IAEPESKELFL in isoform 2 and isoform 3. | VSP_038845 | |||||||
| Natural variant | 44 | 1 | V → A. Ref.1 Ref.4 Ref.15 Corresponds to variant rs56285021 [ dbSNP | Ensembl ]. | VAR_065358 | |||||||
| Natural variant | 235 | 1 | E → G. Corresponds to variant rs6867105 [ dbSNP | Ensembl ]. | VAR_048312 | |||||||
| Natural variant | 621 | 1 | R → C Found in patients with symptoms of Parkinson disease; unknown pathological significance; reduced number of cytoplasmic inclusions in cells expressing C-621 compared with cells expressing wild-type (wt) protein when subjected to proteasomal inhibition; C-621 transfected cells are more susceptible to staurosporine-induced cell death than cells expressin wt protein. Ref.14 Ref.15 Corresponds to variant rs28937592 [ dbSNP | Ensembl ]. | VAR_025667 | |||||||
| Natural variant | 706 | 1 | E → Q. Ref.15 | VAR_065359 | |||||||
Experimental info | |||||||||||
| Mutagenesis | 79 | 1 | V → N: Decreases interaction with SIAH1 and formation of cytoplasmic inclusion bodies; when associated with N-81. Ref.10 | ||||||||
| Mutagenesis | 81 | 1 | P → N: Decreases interaction with SIAH1 and formation of cytoplasmic inclusion bodies; when associated with N-79. Ref.10 | ||||||||
| Sequence conflict | 188 | 1 | S → F in AAH40552. Ref.6 | ||||||||
| Sequence conflict | 614 | 1 | E → G in AAH40552. Ref.6 | ||||||||
| Sequence conflict | 696 | 1 | A → G in AAH40552. Ref.6 | ||||||||
| Sequence conflict | 712 | 1 | D → G in AAH94759. Ref.6 | ||||||||
| Sequence conflict | 801 | 1 | S → P in AAH33743. Ref.6 | ||||||||
| Sequence conflict | 919 | 1 | A → E in AAH94759. Ref.6 | ||||||||
Secondary structure | |||||||||||
Helix Strand Turn | |||||||||||
| Helix | 512 – 552 | 41 | |||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Synphilin-1 associates with alpha-synuclein and promotes the formation of cytosolic inclusions." Engelender S., Kaminsky Z., Guo X., Sharp A.H., Amaravi R.K., Kleiderlein J.J., Margolis R.L., Troncoso J.C., Lanahan A., Worley P.F., Dawson V.L., Dawson T.M., Ross C.A. Nat. Genet. 22:110-114(1999) [PubMed: 10319874] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), INTERACTION WITH SNCA, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, VARIANT ALA-44. Tissue: Brain. |
| [2] | "Organization of the human synphilin-1 gene, a candidate for Parkinson's disease." Engelender S., Wanner T., Kleiderlein J.J., Wakabayashi K., Tsuji S., Takahashi H., Ashworth R., Margolis R.L., Ross C.A. Mamm. Genome 11:763-766(2000) [PubMed: 10967135] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1). |
| [3] | "Synphilin-1A: an aggregation-prone isoform of synphilin-1 that causes neuronal death and is present in aggregates from alpha-synucleinopathy patients." Eyal A., Szargel R., Avraham E., Liani E., Haskin J., Rott R., Engelender S. Proc. Natl. Acad. Sci. U.S.A. 103:5917-5922(2006) [PubMed: 16595633] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, INTERACTION WITH SNCA, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| [4] | "Identification and characterization of alternatively spliced form of human synphilin-1." Lim M.K., Ohsawa Y., Kawamura T., Asakawa S., Takayanagi A., Minoshima S., Shimizu N. Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 4 AND 6), VARIANT ALA-44. Tissue: Cerebellum and Testis. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3 AND 5). Tissue: Brain and Testis. |
| [7] | "Parkin ubiquitinates the alpha-synuclein-interacting protein, synphilin-1: implications for Lewy-body formation in Parkinson disease." Chung K.K.K., Zhang Y., Lim K.L., Tanaka Y., Huang H., Gao J., Ross C.A., Dawson V.L., Dawson T.M. Nat. Med. 7:1144-1150(2001) [PubMed: 11590439] [Abstract] Cited for: INTERACTION WITH PARK2, UBIQUITINATION. |
| [8] | "Dorfin localizes to Lewy bodies and ubiquitylates synphilin-1." Ito T., Niwa J., Hishikawa N., Ishigaki S., Doyu M., Sobue G. J. Biol. Chem. 278:29106-29114(2003) [PubMed: 12750386] [Abstract] Cited for: INTERACTION WITH RNF19A, UBIQUITINATION. |
| [9] | "Siah-1 facilitates ubiquitination and degradation of synphilin-1." Nagano Y., Yamashita H., Takahashi T., Kishida S., Nakamura T., Iseki E., Hattori N., Mizuno Y., Kikuchi A., Matsumoto M. J. Biol. Chem. 278:51504-51514(2003) [PubMed: 14506261] [Abstract] Cited for: INTERACTION WITH SIAH1, DEGRADATION. |
| [10] | "Ubiquitylation of synphilin-1 and alpha-synuclein by SIAH and its presence in cellular inclusions and Lewy bodies imply a role in Parkinson's disease." Liani E., Eyal A., Avraham E., Shemer R., Szargel R., Berg D., Bornemann A., Riess O., Ross C.A., Rott R., Engelender S. Proc. Natl. Acad. Sci. U.S.A. 101:5500-5505(2004) [PubMed: 15064394] [Abstract] Cited for: SUBCELLULAR LOCATION, UBIQUITINATION, PROTEASOMAL DEGRADATION, INTERACTION WITH SIAH1 AND SIAH2, MUTAGENESIS OF VAL-79 AND PRO-81. |
| [11] | "Automated phosphoproteome analysis for cultured cancer cells by two-dimensional nanoLC-MS using a calcined titania/C18 biphasic column." Imami K., Sugiyama N., Kyono Y., Tomita M., Ishihama Y. Anal. Sci. 24:161-166(2008) [PubMed: 18187866] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-387, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [12] | "Synphilin-1A inhibits seven in absentia homolog (SIAH) and modulates alpha-synuclein monoubiquitylation and inclusion formation." Szargel R., Rott R., Eyal A., Haskin J., Shani V., Balan L., Wolosker H., Engelender S. J. Biol. Chem. 284:11706-11716(2009) [PubMed: 19224863] [Abstract] Cited for: FUNCTION, INTERACTION WITH SIAH1. |
| [13] | "Interaction with synphilin-1 promotes inclusion formation of alpha-synuclein: mechanistic insights and pathological implication." Xie Y.Y., Zhou C.J., Zhou Z.R., Hong J., Che M.X., Fu Q.S., Song A.X., Lin D.H., Hu H.Y. FASEB J. 24:196-205(2010) [PubMed: 19762560] [Abstract] Cited for: STRUCTURE BY NMR OF 512-557, INTERACTION WITH SNCA, PROMOTION OF INCLUSION BODY FORMATION, SUBCELLULAR LOCATION. |
| [14] | "Identification and functional characterization of a novel R621C mutation in the synphilin-1 gene in Parkinson's disease." Marx F.P., Holzmann C., Strauss K.M., Li L., Eberhardt O., Gerhardt E., Cookson M.R., Hernandez D., Farrer M.J., Kachergus J., Engelender S., Ross C.A., Berger K., Schols L., Schulz J.B., Riess O., Kruger R. Hum. Mol. Genet. 12:1223-1231(2003) [PubMed: 12761037] [Abstract] Cited for: VARIANT CYS-621, CHARACTERIZATION OF VARIANT CYS-621, POSSIBLE INVOLVEMENT IN SUSCEPTIBILITY TO PARKINSON DISEASE. |
| [15] | "Genetic association study of synphilin-1 in idiopathic Parkinson's disease." Myhre R., Klungland H., Farrer M.J., Aasly J.O. BMC Med. Genet. 9:19-19(2008) [PubMed: 18366718] [Abstract] Cited for: VARIANTS ALA-44; CYS-621 AND GLN-706, LACK OF ASSOCIATION WITH PARKINSON DISEASE. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF076929 mRNA. Translation: AAD30362.1. AF167306 AF167305 Genomic DNA. Translation: AAG17478.1.DQ227317 mRNA. Translation: ABB51162.1. CH471086 Genomic DNA. Translation: EAW48889.1. AB110788 mRNA. Translation: BAD19017.1. AB110789 mRNA. Translation: BAD19018.1. AB110790 mRNA. Translation: BAD19019.1. CH471086 Genomic DNA. Translation: EAW48890.1. BC033743 mRNA. Translation: AAH33743.1. BC040552 mRNA. Translation: AAH40552.1. BC094759 mRNA. Translation: AAH94759.1. | ||||||||||||
| IPI | IPI00002293. IPI00385910. IPI00438113. IPI00956081. IPI00956102. IPI00967042. | ||||||||||||
| RefSeq | NP_001229864.1. NM_001242935.1. NP_005451.2. NM_005460.2. | ||||||||||||
| UniGene | Hs.426463. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q9Y6H5. | ||||||||||||
| SMR | Q9Y6H5. Positions 280-557. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | Q9Y6H5. 6 interactions. | ||||||||||||
| MINT | MINT-1380209. | ||||||||||||
| STRING | Q9Y6H5. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q9Y6H5. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 205831000. | ||||||||||||
Proteomic databases | |||||||||||||
| PRIDE | Q9Y6H5. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000261367; ENSP00000261367; ENSG00000064692. ENST00000261368; ENSP00000261368; ENSG00000064692. ENST00000379533; ENSP00000368848; ENSG00000064692. ENST00000379536; ENSP00000368851; ENSG00000064692. ENST00000395469; ENSP00000378852; ENSG00000064692. ENST00000503116; ENSP00000423199; ENSG00000064692. | ||||||||||||
| GeneID | 9627. | ||||||||||||
| KEGG | hsa:9627. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 9627. | ||||||||||||
| GeneCards | GC05P121675. | ||||||||||||
| HGNC | HGNC:11139. SNCAIP. | ||||||||||||
| HPA | HPA003266. | ||||||||||||
| MIM | 168600. phenotype. 603779. gene. | ||||||||||||
| neXtProt | NX_Q9Y6H5. | ||||||||||||
| PharmGKB | PA35987. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| GeneTree | ENSGT00390000001485. | ||||||||||||
| HOVERGEN | HBG061375. | ||||||||||||
| OMA | PIVESVE. | ||||||||||||
| PhylomeDB | Q9Y6H5. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q9Y6H5. | ||||||||||||
| Bgee | Q9Y6H5. | ||||||||||||
| CleanEx | HS_SNCAIP. | ||||||||||||
| Genevestigator | Q9Y6H5. | ||||||||||||
| GermOnline | ENSG00000064692. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR002110. Ankyrin_rpt. IPR020683. Ankyrin_rpt-contain_dom. [Graphical view] | ||||||||||||
| Gene3D | G3DSA:1.25.40.20. ANK. 1 hit. | ||||||||||||
| KO | K04558. | ||||||||||||
| Pfam | PF12796. Ank_2. 2 hits. [Graphical view] | ||||||||||||
| SMART | SM00248. ANK. 4 hits. [Graphical view] | ||||||||||||
| SUPFAM | SSF48403. ANK. 1 hit. | ||||||||||||
| PROSITE | PS50297. ANK_REP_REGION. 1 hit. PS50088. ANK_REPEAT. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| NextBio | 36127. | ||||||||||||
| PMAP-CutDB | Q9Y6H5. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | SNCAP_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9Y6H5 Secondary accession number(s): D3DSZ1 Q9HC59 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 5 Human chromosome 5: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with