Q9Y6C5 (PTC2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 97.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Protein patched homolog 2 Short name=PTC2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 1203 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | May have a role in epidermal development. May act as a receptor for Sonic hedgehog (SHH). |
| Subcellular location | |
| Involvement in disease | Defects in PTCH2 are a cause of medulloblastoma (MDB) [MIM:155255]. MDB is a malignant, invasive embryonal tumor of the cerebellum with a preferential manifestation in children. Although the majority of medulloblastomas occur sporadically, some manifest within familial cancer syndromes such as Turcot syndrome and basal cell nevus syndrome (Gorlin syndrome). Ref.2 Defects in PTCH2 are a cause of sporadic basal cell carcinoma (BCC) [MIM:605462]. Ref.2 |
| Sequence similarities | Belongs to the patched family. Contains 1 SSD (sterol-sensing) domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Transmembrane Transmembrane helix |
| Molecular function | Receptor |
| PTM | Glycoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | negative regulation of smoothened signaling pathway Traceable author statement. Source: BHF-UCL |
| Cellular component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW |
| Molecular function | hedgehog family protein binding Inferred from physical interaction Ref.1. Source: BHF-UCL hedgehog receptor activityTraceable author statement. Source: BHF-UCL smoothened bindingInferred from physical interaction Ref.1. Source: BHF-UCL |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9Y6C5-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9Y6C5-2) The sequence of this isoform differs from the canonical sequence as follows: 1143-1203: WGASSSLPQSFARVTTSMTVAIHPPPLPGAYIHPAPDEPPWSPAATSSGNLSSRGPGPATG → PEEI |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1203 | 1203 | Protein patched homolog 2 | PRO_0000205970 | |||||
Regions | |||||||||
| Topological domain | 1 – 57 | 57 | Cytoplasmic Potential | ||||||
| Transmembrane | 58 – 78 | 21 | Helical; Potential | ||||||
| Topological domain | 79 – 392 | 314 | Extracellular Potential | ||||||
| Transmembrane | 393 – 413 | 21 | Helical; Potential | ||||||
| Topological domain | 414 – 428 | 15 | Cytoplasmic Potential | ||||||
| Transmembrane | 429 – 449 | 21 | Helical; Potential | ||||||
| Topological domain | 450 – 457 | 8 | Extracellular Potential | ||||||
| Transmembrane | 458 – 478 | 21 | Helical; Potential | ||||||
| Topological domain | 479 – 501 | 23 | Cytoplasmic Potential | ||||||
| Transmembrane | 502 – 522 | 21 | Helical; Potential | ||||||
| Topological domain | 523 – 531 | 9 | Extracellular Potential | ||||||
| Transmembrane | 532 – 552 | 21 | Helical; Potential | ||||||
| Topological domain | 553 – 686 | 134 | Cytoplasmic Potential | ||||||
| Transmembrane | 687 – 707 | 21 | Helical; Potential | ||||||
| Topological domain | 708 – 963 | 256 | Extracellular Potential | ||||||
| Transmembrane | 964 – 984 | 21 | Helical; Potential | ||||||
| Topological domain | 985 – 991 | 7 | Cytoplasmic Potential | ||||||
| Transmembrane | 992 – 1012 | 21 | Helical; Potential | ||||||
| Topological domain | 1013 | 1 | Extracellular Potential | ||||||
| Transmembrane | 1014 – 1034 | 21 | Helical; Potential | ||||||
| Topological domain | 1035 – 1064 | 30 | Cytoplasmic Potential | ||||||
| Transmembrane | 1065 – 1085 | 21 | Helical; Potential | ||||||
| Topological domain | 1086 – 1093 | 8 | Extracellular Potential | ||||||
| Transmembrane | 1094 – 1114 | 21 | Helical; Potential | ||||||
| Topological domain | 1115 – 1203 | 89 | Cytoplasmic Potential | ||||||
| Domain | 394 – 552 | 159 | SSD | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 370 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 812 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1143 – 1203 | 61 | WGASS…GPATG → PEEI in isoform 2. | VSP_004542 | |||||
| Natural variant | 346 | 1 | E → Q. Ref.5 Corresponds to variant rs11573578 [ dbSNP | Ensembl ]. | VAR_018935 | |||||
| Natural variant | 493 | 1 | E → K. Ref.5 Corresponds to variant rs11573581 [ dbSNP | Ensembl ]. | VAR_018936 | |||||
| Natural variant | 622 | 1 | H → Y. Ref.5 Corresponds to variant rs11573586 [ dbSNP | Ensembl ]. | VAR_018937 | |||||
| Natural variant | 988 | 1 | T → M. Ref.5 Corresponds to variant rs11573590 [ dbSNP | Ensembl ]. | VAR_018938 | |||||
| Natural variant | 995 | 1 | V → M. Corresponds to variant rs11573591 [ dbSNP | Ensembl ]. | VAR_050466 | |||||
| Natural variant | 1019 | 1 | V → M. Ref.5 Corresponds to variant rs11573591 [ dbSNP | Ensembl ]. | VAR_018939 | |||||
| Natural variant | 1121 | 1 | I → M. Ref.5 Corresponds to variant rs11573598 [ dbSNP | Ensembl ]. | VAR_018940 | |||||
Experimental info | |||||||||
| Sequence conflict | 2 | 1 | T → N in AAD25953. Ref.2 | ||||||
| Sequence conflict | 120 | 1 | R → L in AAD25953. Ref.2 | ||||||
| Sequence conflict | 175 | 1 | R → W in AAC79847. Ref.1 | ||||||
| Sequence conflict | 175 | 1 | R → W in AAQ88919. Ref.4 | ||||||
| Sequence conflict | 175 | 1 | R → W in AAQ89375. Ref.4 | ||||||
| Sequence conflict | 753 | 1 | Q → R in AAD25953. Ref.2 | ||||||
| Sequence conflict | 787 | 1 | N → S in AAD25953. Ref.2 | ||||||
| Sequence conflict | 833 | 1 | P → L in AAD17260. Ref.3 | ||||||
| Sequence conflict | 837 | 1 | S → G in AAD25953. Ref.2 | ||||||
| Sequence conflict | 846 | 1 | D → E in AAD25953. Ref.2 | ||||||
| Sequence conflict | 897 | 1 | L → F in AAD17260. Ref.3 | ||||||
| Sequence conflict | 1203 | 1 | G → GDYKDDDDK in AAQ88919. Ref.4 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Characterization of two patched receptors for the vertebrate hedgehog protein family." Carpenter D., Stone D.M., Brush J., Ryan A., Armanini M., Frantz G., Rosenthal A., de Sauvage F.J. Proc. Natl. Acad. Sci. U.S.A. 95:13630-13634(1998) [PubMed: 9811851] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Isolation and characterization of human patched 2 (PTCH2), a putative tumour suppressor gene in basal cell carcinoma and medulloblastoma on chromosome 1p32." Smyth I., Narang M.A., Evans T., Heimann C., Nakamura Y., Chenevix-Trench G., Pietsch T., Wicking C., Wainwright B.J. Hum. Mol. Genet. 8:291-297(1999) [PubMed: 9931336] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), INVOLVEMENT IN MDB AND BCC. |
| [3] | "PTCH2, a novel human patched gene, undergoing alternative splicing and up-regulated in basal cell carcinomas." Zaphiropoulos P.G., Unden A.B., Rahnama F., Hollingsworth R.E., Toftgard R. Cancer Res. 59:787-792(1999) [PubMed: 10029063] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). |
| [4] | "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. Gray A.M.Genome Res. 13:2265-2270(2003) [PubMed: 12975309] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [5] | NIEHS SNPs program Submitted (OCT-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS GLN-346; LYS-493; TYR-622; MET-988; MET-1019 AND MET-1121. |
| [6] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed: 16710414] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF091501 mRNA. Translation: AAC79847.1. AF087651 mRNA. Translation: AAD25953.1. AF119569 mRNA. Translation: AAD17260.1. AY358555 mRNA. Translation: AAQ88919.1. AY359016 mRNA. Translation: AAQ89375.1. AY438664 Genomic DNA. Translation: AAR05447.1. AL136380, AL592166 Genomic DNA. Translation: CAI23127.1. AL592166, AL136380 Genomic DNA. Translation: CAI13000.1. |
| IPI | IPI00419647. IPI00471943. |
| RefSeq | NP_001159764.1. NM_001166292.1. NP_003729.3. NM_003738.4. |
| UniGene | Hs.591497. |
3D structure databases | |
| ProteinModelPortal | Q9Y6C5. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9Y6C5. 1 interaction. |
| STRING | Q9Y6C5. |
PTM databases | |
| PhosphoSite | Q9Y6C5. |
Polymorphism databases | |
| DMDM | 12643356. |
Proteomic databases | |
| PRIDE | Q9Y6C5. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000372192; ENSP00000361266; ENSG00000117425. |
| GeneID | 8643. |
| KEGG | hsa:8643. |
| UCSC | uc001cms.1. human. |
Organism-specific databases | |
| CTD | 8643. |
| GeneCards | GC01M045286. |
| H-InvDB | HIX0028541. |
| HGNC | HGNC:9586. PTCH2. |
| MIM | 155255. phenotype. 603673. gene. 605462. phenotype. |
| neXtProt | NX_Q9Y6C5. |
| Orphanet | 141276. Commissural facial cleft. |
| PharmGKB | PA33938. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG13554. |
| GeneTree | ENSGT00550000074234. |
| HOGENOM | HBG713504. |
| HOVERGEN | HBG003801. |
| InParanoid | Q9Y6C5. |
| OMA | SSQHVVT. |
| OrthoDB | EOG49CQ6V. |
| PhylomeDB | Q9Y6C5. |
Enzyme and pathway databases | |
| Pathway_Interaction_DB | hedgehog_2pathway. Signaling events mediated by the Hedgehog family. |
| Reactome | REACT_111102. Signal Transduction. |
Gene expression databases | |
| ArrayExpress | Q9Y6C5. |
| Bgee | Q9Y6C5. |
| CleanEx | HS_PTCH2. |
| Genevestigator | Q9Y6C5. |
| GermOnline | ENSG00000117425. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR003392. Patched. IPR000731. SSD. IPR004766. TM_rcpt_patched. [Graphical view] |
| KO | K11101. |
| Pfam | PF02460. Patched. 1 hit. [Graphical view] |
| TIGRFAMs | TIGR00918. 2A060602. 1 hit. |
| PROSITE | PS50156. SSD. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 32403. |
| SOURCE | Search... |
Entry information
| Entry name | PTC2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9Y6C5 Secondary accession number(s): O95341 Q6UX14 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with