Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Transcription factor ETV7

Gene

ETV7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Transcriptional repressor; binds to the DNA sequence 5'-CCGGAAGT-3'. Isoform A does not seem to have a repressor activity. Isoform C does not seem to have a repressor activity.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
DNA bindingi224 – 30582ETSPROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

GO - Biological processi

  • cell differentiation Source: GO_Central
  • negative regulation of transcription from RNA polymerase II promoter Source: NTNU_SB
  • organ morphogenesis Source: ProtInc
  • transcription from RNA polymerase II promoter Source: ProtInc
Complete GO annotation...

Keywords - Molecular functioni

Repressor

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Transcription factor ETV7
Alternative name(s):
ETS translocation variant 7
ETS-related protein Tel2
Tel-related Ets factor
Transcription factor Tel-2
Gene namesi
Name:ETV7
Synonyms:TEL2, TELB, TREF
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

HGNCiHGNC:18160. ETV7.

Subcellular locationi

GO - Cellular componenti

  • nucleoplasm Source: HPA
  • nucleus Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134980006.

Polymorphism and mutation databases

BioMutaiETV7.
DMDMi13124589.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 341341Transcription factor ETV7PRO_0000204123Add
BLAST

Proteomic databases

PaxDbiQ9Y603.
PRIDEiQ9Y603.

PTM databases

iPTMnetiQ9Y603.
PhosphoSiteiQ9Y603.

Expressioni

Tissue specificityi

Expressed in hematopoietic tissues.

Gene expression databases

BgeeiENSG00000010030.
GenevisibleiQ9Y603. HS.

Organism-specific databases

HPAiHPA029033.

Interactioni

Protein-protein interaction databases

BioGridi119581. 6 interactions.
IntActiQ9Y603. 4 interactions.
STRINGi9606.ENSP00000341843.

Structurei

3D structure databases

ProteinModelPortaliQ9Y603.
SMRiQ9Y603. Positions 42-117, 224-340.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini33 – 11785PNTPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Belongs to the ETS family.Curated
Contains 1 ETS DNA-binding domain.PROSITE-ProRule annotation
Contains 1 PNT (pointed) domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG3804. Eukaryota.
ENOG4111K4J. LUCA.
GeneTreeiENSGT00760000118996.
HOGENOMiHOG000012982.
HOVERGENiHBG005617.
InParanoidiQ9Y603.
KOiK03211.
OMAiHLHPSPF.
OrthoDBiEOG091G05Q3.
PhylomeDBiQ9Y603.
TreeFamiTF318679.

Family and domain databases

Gene3Di1.10.10.10. 1 hit.
1.10.150.50. 1 hit.
InterProiIPR000418. Ets_dom.
IPR003118. Pointed_dom.
IPR013761. SAM/pointed.
IPR011991. WHTH_DNA-bd_dom.
[Graphical view]
PfamiPF00178. Ets. 1 hit.
PF02198. SAM_PNT. 1 hit.
[Graphical view]
PRINTSiPR00454. ETSDOMAIN.
SMARTiSM00413. ETS. 1 hit.
SM00251. SAM_PNT. 1 hit.
[Graphical view]
SUPFAMiSSF46785. SSF46785. 1 hit.
SSF47769. SSF47769. 1 hit.
PROSITEiPS00346. ETS_DOMAIN_2. 1 hit.
PS50061. ETS_DOMAIN_3. 1 hit.
PS51433. PNT. 1 hit.
[Graphical view]

Sequences (8)i

Sequence statusi: Complete.

This entry describes 8 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform B (identifier: Q9Y603-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQEGELAISP ISPVAAMPPL GTHVQARCEA QINLLGEGGI CKLPGRLRIQ
60 70 80 90 100
PALWSREDVL HWLRWAEQEY SLPCTAEHGF EMNGRALCIL TKDDFRHRAP
110 120 130 140 150
SSGDVLYELL QYIKTQRRAL VCGPFFGGIF RLKTPTQHSP VPPEEVTGPS
160 170 180 190 200
QMDTRRGHLL QPPDPGLTSN FGHLDDPGLA RWTPGKEESL NLCHCAELGC
210 220 230 240 250
RTQGVCSFPA MPQAPIDGRI ADCRLLWDYV YQLLLDTRYE PYIKWEDKDA
260 270 280 290 300
KIFRVVDPNG LARLWGNHKN RVNMTYEKMS RALRHYYKLN IIKKEPGQKL
310 320 330 340
LFRFLKTPGK MVQDKHSHLE PLESQEQDRI EFKDKRPEIS P
Length:341
Mass (Da):38,998
Last modified:November 1, 1999 - v1
Checksum:i941983E83E45EBED
GO
Isoform A (identifier: Q9Y603-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-102: MQEGELAISP...DDFRHRAPSS → MHRGARVRDE...RTGFPLSGNP

Show »
Length:282
Mass (Da):32,435
Checksum:iD922B683DF411B25
GO
Isoform C (identifier: Q9Y603-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-81: Missing.

Show »
Length:260
Mass (Da):30,012
Checksum:i5D3EA756175F8081
GO
Isoform D (identifier: Q9Y603-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     49-103: Missing.

Show »
Length:286
Mass (Da):32,590
Checksum:i897E85CAEC7909EA
GO
Isoform E (identifier: Q9Y603-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     304-341: FLKTPGKMVQDKHSHLEPLESQEQDRIEFKDKRPEISP → NGLQLIFIFIWSFQ

Show »
Length:317
Mass (Da):36,205
Checksum:iE7275D5E5B94FAF0
GO
Isoform F (identifier: Q9Y603-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     49-103: Missing.
     304-341: FLKTPGKMVQDKHSHLEPLESQEQDRIEFKDKRPEISP → NGLQLIFIFIWSFQ

Show »
Length:262
Mass (Da):29,797
Checksum:i2DAAA51DD32252CB
GO
Isoform G (identifier: Q9Y603-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     145-221: Missing.

Show »
Length:264
Mass (Da):30,763
Checksum:iDB80D0C445B70646
GO
Isoform H (identifier: Q9Y603-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-151: Missing.

Show »
Length:190
Mass (Da):22,186
Checksum:iF7A5B7235BA599C3
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti27 – 271R → T in AAF25007 (PubMed:10828014).Curated
Sequence conflicti255 – 2551V → G in AAF25007 (PubMed:10828014).Curated
Sequence conflicti273 – 2731N → D in AAF25007 (PubMed:10828014).Curated
Sequence conflicti311 – 3111M → T in AAF25007 (PubMed:10828014).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti86 – 861A → T.
Corresponds to variant rs9394345 [ dbSNP | Ensembl ].
VAR_059257
Natural varianti138 – 1381H → Y.
Corresponds to variant rs9470262 [ dbSNP | Ensembl ].
VAR_048952
Natural varianti199 – 1991G → S.
Corresponds to variant rs34306145 [ dbSNP | Ensembl ].
VAR_048953
Natural varianti212 – 2121P → L.
Corresponds to variant rs2234079 [ dbSNP | Ensembl ].
VAR_020314
Natural varianti250 – 2501A → V.
Corresponds to variant rs2234080 [ dbSNP | Ensembl ].
VAR_048954

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 151151Missing in isoform H. 1 PublicationVSP_044285Add
BLAST
Alternative sequencei1 – 102102MQEGE…RAPSS → MHRGARVRDERTRPLHPHQG RLPAPCAQLRSGKRTGFPLS GNP in isoform A. 1 PublicationVSP_001473Add
BLAST
Alternative sequencei1 – 8181Missing in isoform C. 1 PublicationVSP_001474Add
BLAST
Alternative sequencei49 – 10355Missing in isoform D and isoform F. 2 PublicationsVSP_001475Add
BLAST
Alternative sequencei145 – 22177Missing in isoform G. 1 PublicationVSP_001476Add
BLAST
Alternative sequencei304 – 34138FLKTP…PEISP → NGLQLIFIFIWSFQ in isoform E and isoform F. 1 PublicationVSP_001477Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF116508 mRNA. Translation: AAD43250.1.
AF116509 mRNA. Translation: AAD43251.1.
AF116510 mRNA. Translation: AAD43252.1.
AF218235 mRNA. Translation: AAF28350.1.
AF218365 mRNA. Translation: AAF44742.1.
AF218366 mRNA. Translation: AAF44743.1.
AF175387 mRNA. Translation: AAF25007.3.
AF147782 mRNA. Translation: AAD33989.1.
AJ276205 mRNA. Translation: CAC17012.1.
AK122796 mRNA. Translation: BAG53734.1.
AK301011 mRNA. Translation: BAG62628.1.
AK303829 mRNA. Translation: BAG64776.1.
Z84484 Genomic DNA. Translation: CAI21615.1.
Z84484 Genomic DNA. Translation: CAI21616.1.
CH471081 Genomic DNA. Translation: EAX03885.1.
CH471081 Genomic DNA. Translation: EAX03888.1.
CH471081 Genomic DNA. Translation: EAX03890.1.
BC035853 mRNA. Translation: AAH35853.1.
CCDSiCCDS4819.1. [Q9Y603-1]
CCDS56422.1. [Q9Y603-8]
CCDS56423.1. [Q9Y603-4]
CCDS56424.1. [Q9Y603-7]
CCDS56425.1. [Q9Y603-5]
CCDS75440.1. [Q9Y603-2]
CCDS75441.1. [Q9Y603-3]
CCDS78131.1. [Q9Y603-6]
RefSeqiNP_001193964.1. NM_001207035.1. [Q9Y603-5]
NP_001193965.1. NM_001207036.1. [Q9Y603-4]
NP_001193966.1. NM_001207037.1. [Q9Y603-2]
NP_001193967.1. NM_001207038.1. [Q9Y603-7]
NP_001193968.1. NM_001207039.1. [Q9Y603-6]
NP_001193969.1. NM_001207040.1. [Q9Y603-3]
NP_001193970.1. NM_001207041.1. [Q9Y603-8]
NP_057219.1. NM_016135.3. [Q9Y603-1]
UniGeneiHs.272398.

Genome annotation databases

EnsembliENST00000339796; ENSP00000342260; ENSG00000010030. [Q9Y603-5]
ENST00000340181; ENSP00000341843; ENSG00000010030. [Q9Y603-1]
ENST00000373737; ENSP00000362842; ENSG00000010030. [Q9Y603-7]
ENST00000373738; ENSP00000362843; ENSG00000010030. [Q9Y603-4]
ENST00000538992; ENSP00000440592; ENSG00000010030. [Q9Y603-8]
ENST00000615781; ENSP00000481885; ENSG00000010030. [Q9Y603-2]
ENST00000620358; ENSP00000484485; ENSG00000010030. [Q9Y603-3]
ENST00000627426; ENSP00000486712; ENSG00000010030. [Q9Y603-6]
GeneIDi51513.
KEGGihsa:51513.
UCSCiuc003olz.3. human. [Q9Y603-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF116508 mRNA. Translation: AAD43250.1.
AF116509 mRNA. Translation: AAD43251.1.
AF116510 mRNA. Translation: AAD43252.1.
AF218235 mRNA. Translation: AAF28350.1.
AF218365 mRNA. Translation: AAF44742.1.
AF218366 mRNA. Translation: AAF44743.1.
AF175387 mRNA. Translation: AAF25007.3.
AF147782 mRNA. Translation: AAD33989.1.
AJ276205 mRNA. Translation: CAC17012.1.
AK122796 mRNA. Translation: BAG53734.1.
AK301011 mRNA. Translation: BAG62628.1.
AK303829 mRNA. Translation: BAG64776.1.
Z84484 Genomic DNA. Translation: CAI21615.1.
Z84484 Genomic DNA. Translation: CAI21616.1.
CH471081 Genomic DNA. Translation: EAX03885.1.
CH471081 Genomic DNA. Translation: EAX03888.1.
CH471081 Genomic DNA. Translation: EAX03890.1.
BC035853 mRNA. Translation: AAH35853.1.
CCDSiCCDS4819.1. [Q9Y603-1]
CCDS56422.1. [Q9Y603-8]
CCDS56423.1. [Q9Y603-4]
CCDS56424.1. [Q9Y603-7]
CCDS56425.1. [Q9Y603-5]
CCDS75440.1. [Q9Y603-2]
CCDS75441.1. [Q9Y603-3]
CCDS78131.1. [Q9Y603-6]
RefSeqiNP_001193964.1. NM_001207035.1. [Q9Y603-5]
NP_001193965.1. NM_001207036.1. [Q9Y603-4]
NP_001193966.1. NM_001207037.1. [Q9Y603-2]
NP_001193967.1. NM_001207038.1. [Q9Y603-7]
NP_001193968.1. NM_001207039.1. [Q9Y603-6]
NP_001193969.1. NM_001207040.1. [Q9Y603-3]
NP_001193970.1. NM_001207041.1. [Q9Y603-8]
NP_057219.1. NM_016135.3. [Q9Y603-1]
UniGeneiHs.272398.

3D structure databases

ProteinModelPortaliQ9Y603.
SMRiQ9Y603. Positions 42-117, 224-340.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119581. 6 interactions.
IntActiQ9Y603. 4 interactions.
STRINGi9606.ENSP00000341843.

PTM databases

iPTMnetiQ9Y603.
PhosphoSiteiQ9Y603.

Polymorphism and mutation databases

BioMutaiETV7.
DMDMi13124589.

Proteomic databases

PaxDbiQ9Y603.
PRIDEiQ9Y603.

Protocols and materials databases

DNASUi51513.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000339796; ENSP00000342260; ENSG00000010030. [Q9Y603-5]
ENST00000340181; ENSP00000341843; ENSG00000010030. [Q9Y603-1]
ENST00000373737; ENSP00000362842; ENSG00000010030. [Q9Y603-7]
ENST00000373738; ENSP00000362843; ENSG00000010030. [Q9Y603-4]
ENST00000538992; ENSP00000440592; ENSG00000010030. [Q9Y603-8]
ENST00000615781; ENSP00000481885; ENSG00000010030. [Q9Y603-2]
ENST00000620358; ENSP00000484485; ENSG00000010030. [Q9Y603-3]
ENST00000627426; ENSP00000486712; ENSG00000010030. [Q9Y603-6]
GeneIDi51513.
KEGGihsa:51513.
UCSCiuc003olz.3. human. [Q9Y603-1]

Organism-specific databases

CTDi51513.
GeneCardsiETV7.
HGNCiHGNC:18160. ETV7.
HPAiHPA029033.
MIMi605255. gene.
neXtProtiNX_Q9Y603.
PharmGKBiPA134980006.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3804. Eukaryota.
ENOG4111K4J. LUCA.
GeneTreeiENSGT00760000118996.
HOGENOMiHOG000012982.
HOVERGENiHBG005617.
InParanoidiQ9Y603.
KOiK03211.
OMAiHLHPSPF.
OrthoDBiEOG091G05Q3.
PhylomeDBiQ9Y603.
TreeFamiTF318679.

Miscellaneous databases

GeneWikiiETV7.
GenomeRNAii51513.
PROiQ9Y603.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000010030.
GenevisibleiQ9Y603. HS.

Family and domain databases

Gene3Di1.10.10.10. 1 hit.
1.10.150.50. 1 hit.
InterProiIPR000418. Ets_dom.
IPR003118. Pointed_dom.
IPR013761. SAM/pointed.
IPR011991. WHTH_DNA-bd_dom.
[Graphical view]
PfamiPF00178. Ets. 1 hit.
PF02198. SAM_PNT. 1 hit.
[Graphical view]
PRINTSiPR00454. ETSDOMAIN.
SMARTiSM00413. ETS. 1 hit.
SM00251. SAM_PNT. 1 hit.
[Graphical view]
SUPFAMiSSF46785. SSF46785. 1 hit.
SSF47769. SSF47769. 1 hit.
PROSITEiPS00346. ETS_DOMAIN_2. 1 hit.
PS50061. ETS_DOMAIN_3. 1 hit.
PS51433. PNT. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiETV7_HUMAN
AccessioniPrimary (citable) accession number: Q9Y603
Secondary accession number(s): B3KVC2
, B4DVB6, B4E1G4, Q5R3L3, Q5R3L4, Q9NZ65, Q9NZ66, Q9NZ68, Q9NZR8, Q9UNJ7, Q9Y5K4, Q9Y604
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 21, 2001
Last sequence update: November 1, 1999
Last modified: September 7, 2016
This is version 151 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.