Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Melanoma-associated antigen D1

Gene

MAGED1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Involved in the apoptotic response after nerve growth factor (NGF) binding in neuronal cells. Inhibits cell cycle progression, and facilitates NGFR-mediated apoptosis. May act as a regulator of the function of DLX family members. May enhance ubiquitin ligase activity of RING-type zinc finger-containing E3 ubiquitin-protein ligases. Proposed to act through recruitment and/or stabilization of the Ubl-conjugating enzyme (E2) at the E3:substrate complex. Plays a role in the circadian rythm regulation. May act as RORA co-regulator, modulating the expression of core clock genes such as ARNTL/BMAL1 and NFIL3, induced, or NR1D1, repressed.1 Publication

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Tumor antigen

Keywords - Biological processi

Biological rhythms, Ubl conjugation pathway

Enzyme and pathway databases

ReactomeiREACT_13638. NRAGE signals death through JNK.
REACT_22128. Ligand-independent caspase activation via DCC.
SignaLinkiQ9Y5V3.

Names & Taxonomyi

Protein namesi
Recommended name:
Melanoma-associated antigen D1
Alternative name(s):
MAGE tumor antigen CCF
MAGE-D1 antigen
Neurotrophin receptor-interacting MAGE homolog
Gene namesi
Name:MAGED1
Synonyms:NRAGE
ORF Names:PP2250, PRO2292
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome X

Organism-specific databases

HGNCiHGNC:6813. MAGED1.

Subcellular locationi

GO - Cellular componenti

  • chromatin Source: UniProtKB
  • cytoplasm Source: UniProtKB-SubCell
  • nucleus Source: UniProtKB
  • plasma membrane Source: UniProtKB-SubCell
  • protein complex Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA30559.

Polymorphism and mutation databases

BioMutaiMAGED1.
DMDMi62906893.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 778778Melanoma-associated antigen D1PRO_0000156723Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei92 – 921Phosphotyrosine1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ9Y5V3.
PaxDbiQ9Y5V3.
PRIDEiQ9Y5V3.

PTM databases

PhosphoSiteiQ9Y5V3.

Expressioni

Tissue specificityi

Expressed in bone marrow stromal cells from both multiple myeloma patients and healthy donors. Seems to be ubiquitously expressed.

Gene expression databases

BgeeiQ9Y5V3.
CleanExiHS_MAGED1.
GenevisibleiQ9Y5V3. HS.

Interactioni

Subunit structurei

Interacts with DLX5, DLX7 and MSX2 and forms homomultimers. Interacts with UNC5A. Interacts with TRIM28 and PJA1. Interacts with NGFR/p75NTR and RORA.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
AKAP9Q99996-23EBI-716006,EBI-9641546
BAG3O958173EBI-716006,EBI-747185
BHLHE40O145033EBI-716006,EBI-711810
BIRC8Q6PIA03EBI-716006,EBI-2129837
C1orf94Q6P1W53EBI-716006,EBI-946029
CA8P352193EBI-716006,EBI-718700
DAB1O755533EBI-716006,EBI-7875264
EIF4E2O605733EBI-716006,EBI-398610
KPNA2Q6NVW73EBI-716006,EBI-9377406
KRTAP19-5Q3LI723EBI-716006,EBI-1048945
MDFIQ997503EBI-716006,EBI-724076
MEOX2A4D1273EBI-716006,EBI-10172134
PJA1Q8NG274EBI-716006,EBI-714606
PRKAB2O437413EBI-716006,EBI-1053424
RBFOX2O432513EBI-716006,EBI-746056
RBM23Q86U063EBI-716006,EBI-780319
RBPMSQ930623EBI-716006,EBI-740322
RHOXF2Q9BQY43EBI-716006,EBI-372094
SMAP2Q8WU793EBI-716006,EBI-2822515
SNRPCQ5TAL43EBI-716006,EBI-10246938
TFGQ927345EBI-716006,EBI-357061
TTC23Q5W5X93EBI-716006,EBI-6447954
TTC32Q5I0X73EBI-716006,EBI-8636434
ZNF488Q96MN93EBI-716006,EBI-948288

Protein-protein interaction databases

BioGridi114879. 94 interactions.
IntActiQ9Y5V3. 50 interactions.
MINTiMINT-209401.
STRINGi9606.ENSP00000364847.

Structurei

3D structure databases

ProteinModelPortaliQ9Y5V3.
SMRiQ9Y5V3. Positions 465-672.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati296 – 30161
Repeati302 – 30762
Repeati308 – 31363
Repeati332 – 33764
Repeati338 – 34365
Repeati344 – 34966
Repeati350 – 35567
Repeati356 – 36168
Repeati362 – 36769
Repeati368 – 373610
Repeati374 – 379611
Repeati380 – 385612
Repeati386 – 391613
Repeati392 – 397614
Repeati398 – 403615
Repeati404 – 409616
Repeati410 – 415617
Repeati416 – 421618
Repeati422 – 427619
Repeati428 – 432520; approximate
Repeati433 – 438621
Repeati439 – 444622
Domaini471 – 669199MAGEPROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni296 – 44414922 X 6 AA tandem repeats of W-[PQ]-X-P-X-XAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi279 – 452174Pro-richAdd
BLAST

Sequence similaritiesi

Contains 1 MAGE domain.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiNOG310785.
GeneTreeiENSGT00760000118824.
HOVERGENiHBG003714.
InParanoidiQ9Y5V3.
KOiK12464.
OMAiWQNPVIW.
OrthoDBiEOG75F4GM.
PhylomeDBiQ9Y5V3.
TreeFamiTF352132.

Family and domain databases

InterProiIPR030083. MAGED1.
IPR002190. MHD_dom.
[Graphical view]
PANTHERiPTHR11736. PTHR11736. 1 hit.
PTHR11736:SF28. PTHR11736:SF28. 1 hit.
PfamiPF01454. MAGE. 1 hit.
[Graphical view]
PROSITEiPS50838. MAGE. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9Y5V3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAQKMDCGAG LLGFQAEASV EDSALLMQTL MEAIQISEAP PTNQATAAAS
60 70 80 90 100
PQSSQPPTAN EMADIQVSAA AARPKSAFKV QNATTKGPNG VYDFSQAHNA
110 120 130 140 150
KDVPNTQPKA AFKSQNATPK GPNAAYDFSQ AATTGELAAN KSEMAFKAQN
160 170 180 190 200
ATTKVGPNAT YNFSQSLNAN DLANSRPKTP FKAWNDTTKA PTADTQTQNV
210 220 230 240 250
NQAKMATSQA DIETDPGISE PDGATAQTSA DGSQAQNLES RTIIRGKRTR
260 270 280 290 300
KINNLNVEEN SSGDQRRAPL AAGTWRSAPV PVTTQNPPGA PPNVLWQTPL
310 320 330 340 350
AWQNPSGWQN QTARQTPPAR QSPPARQTPP AWQNPVAWQN PVIWPNPVIW
360 370 380 390 400
QNPVIWPNPI VWPGPVVWPN PLAWQNPPGW QTPPGWQTPP GWQGPPDWQG
410 420 430 440 450
PPDWPLPPDW PLPPDWPLPT DWPLPPDWIP ADWPIPPDWQ NLRPSPNLRP
460 470 480 490 500
SPNSRASQNP GAAQPRDVAL LQERANKLVK YLMLKDYTKV PIKRSEMLRD
510 520 530 540 550
IIREYTDVYP EIIERACFVL EKKFGIQLKE IDKEEHLYIL ISTPESLAGI
560 570 580 590 600
LGTTKDTPKL GLLLVILGVI FMNGNRASEA VLWEALRKMG LRPGVRHPLL
610 620 630 640 650
GDLRKLLTYE FVKQKYLDYR RVPNSNPPEY EFLWGLRSYH ETSKMKVLRF
660 670 680 690 700
IAEVQKRDPR DWTAQFMEAA DEALDALDAA AAEAEARAEA RTRMGIGDEA
710 720 730 740 750
VSGPWSWDDI EFELLTWDEE GDFGDPWSRI PFTFWARYHQ NARSRFPQTF
760 770
AGPIIGPGGT ASANFAANFG AIGFFWVE
Length:778
Mass (Da):86,161
Last modified:April 26, 2005 - v3
Checksum:iD818690052D166CE
GO
Isoform 2 (identifier: Q9Y5V3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     15-15: Q → QNPDACRAVCHPLPQPPASTLPLSAFPTLCDPPYSQLRDPPAVLSCYCTPLGASPAP

Note: No experimental confirmation available.
Show »
Length:834
Mass (Da):91,959
Checksum:iCD8E13CE9B35EA7C
GO

Sequence cautioni

The sequence AAD31421.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAG35551.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti119 – 1191P → S in AAG09704 (PubMed:10985348).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti238 – 2381L → M.
Corresponds to variant rs12689461 [ dbSNP | Ensembl ].
VAR_060070

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei15 – 151Q → QNPDACRAVCHPLPQPPAST LPLSAFPTLCDPPYSQLRDP PAVLSCYCTPLGASPAP in isoform 2. 1 PublicationVSP_009286

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF217963 mRNA. Translation: AAG09704.1.
AF258554 mRNA. Translation: AAG23757.1.
AF300328 mRNA. Translation: AAQ14483.1.
AL929410 Genomic DNA. Translation: CAH71560.1.
AL929410 Genomic DNA. Translation: CAH71561.1.
BC014070 mRNA. Translation: AAH14070.1.
BC032473 mRNA. Translation: AAH32473.1.
AF124440 mRNA. Translation: AAD31421.1. Different initiation.
AL133628 mRNA. Translation: CAB63752.1.
AF132205 mRNA. Translation: AAG35551.1. Different initiation.
CCDSiCCDS14337.1. [Q9Y5V3-1]
CCDS35279.1. [Q9Y5V3-2]
PIRiT43464.
RefSeqiNP_001005332.1. NM_001005332.1. [Q9Y5V3-1]
NP_001005333.1. NM_001005333.1. [Q9Y5V3-2]
NP_008917.3. NM_006986.3. [Q9Y5V3-1]
XP_011529137.1. XM_011530835.1. [Q9Y5V3-1]
UniGeneiHs.5258.

Genome annotation databases

EnsembliENST00000326587; ENSP00000325333; ENSG00000179222.
ENST00000375695; ENSP00000364847; ENSG00000179222. [Q9Y5V3-2]
ENST00000375722; ENSP00000364874; ENSG00000179222.
ENST00000375772; ENSP00000364927; ENSG00000179222.
GeneIDi9500.
KEGGihsa:9500.
UCSCiuc004dpm.3. human. [Q9Y5V3-1]
uc004dpn.3. human. [Q9Y5V3-2]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF217963 mRNA. Translation: AAG09704.1.
AF258554 mRNA. Translation: AAG23757.1.
AF300328 mRNA. Translation: AAQ14483.1.
AL929410 Genomic DNA. Translation: CAH71560.1.
AL929410 Genomic DNA. Translation: CAH71561.1.
BC014070 mRNA. Translation: AAH14070.1.
BC032473 mRNA. Translation: AAH32473.1.
AF124440 mRNA. Translation: AAD31421.1. Different initiation.
AL133628 mRNA. Translation: CAB63752.1.
AF132205 mRNA. Translation: AAG35551.1. Different initiation.
CCDSiCCDS14337.1. [Q9Y5V3-1]
CCDS35279.1. [Q9Y5V3-2]
PIRiT43464.
RefSeqiNP_001005332.1. NM_001005332.1. [Q9Y5V3-1]
NP_001005333.1. NM_001005333.1. [Q9Y5V3-2]
NP_008917.3. NM_006986.3. [Q9Y5V3-1]
XP_011529137.1. XM_011530835.1. [Q9Y5V3-1]
UniGeneiHs.5258.

3D structure databases

ProteinModelPortaliQ9Y5V3.
SMRiQ9Y5V3. Positions 465-672.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114879. 94 interactions.
IntActiQ9Y5V3. 50 interactions.
MINTiMINT-209401.
STRINGi9606.ENSP00000364847.

PTM databases

PhosphoSiteiQ9Y5V3.

Polymorphism and mutation databases

BioMutaiMAGED1.
DMDMi62906893.

Proteomic databases

MaxQBiQ9Y5V3.
PaxDbiQ9Y5V3.
PRIDEiQ9Y5V3.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000326587; ENSP00000325333; ENSG00000179222.
ENST00000375695; ENSP00000364847; ENSG00000179222. [Q9Y5V3-2]
ENST00000375722; ENSP00000364874; ENSG00000179222.
ENST00000375772; ENSP00000364927; ENSG00000179222.
GeneIDi9500.
KEGGihsa:9500.
UCSCiuc004dpm.3. human. [Q9Y5V3-1]
uc004dpn.3. human. [Q9Y5V3-2]

Organism-specific databases

CTDi9500.
GeneCardsiGC0XP051562.
HGNCiHGNC:6813. MAGED1.
MIMi300224. gene.
neXtProtiNX_Q9Y5V3.
PharmGKBiPA30559.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG310785.
GeneTreeiENSGT00760000118824.
HOVERGENiHBG003714.
InParanoidiQ9Y5V3.
KOiK12464.
OMAiWQNPVIW.
OrthoDBiEOG75F4GM.
PhylomeDBiQ9Y5V3.
TreeFamiTF352132.

Enzyme and pathway databases

ReactomeiREACT_13638. NRAGE signals death through JNK.
REACT_22128. Ligand-independent caspase activation via DCC.
SignaLinkiQ9Y5V3.

Miscellaneous databases

ChiTaRSiMAGED1. human.
GeneWikiiMAGED1.
GenomeRNAii9500.
NextBioi35594.
PROiQ9Y5V3.
SOURCEiSearch...

Gene expression databases

BgeeiQ9Y5V3.
CleanExiHS_MAGED1.
GenevisibleiQ9Y5V3. HS.

Family and domain databases

InterProiIPR030083. MAGED1.
IPR002190. MHD_dom.
[Graphical view]
PANTHERiPTHR11736. PTHR11736. 1 hit.
PTHR11736:SF28. PTHR11736:SF28. 1 hit.
PfamiPF01454. MAGE. 1 hit.
[Graphical view]
PROSITEiPS50838. MAGE. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "NRAGE, a novel MAGE protein, interacts with the p75 neurotrophin receptor and facilitates nerve growth factor dependent apoptosis."
    Salehi A.H., Roux P.P., Kubu C.J., Zeindler C., Bhakar A., Tannis L.-L., Verdi J.M., Barker P.A.
    Neuron 27:279-288(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "hNRAGE, a human neurotrophin receptor interacting MAGE homologue, regulates p53 transcriptional activity and inhibits cell proliferation."
    Wen C.-J., Xue B., Qin W.-X., Yu M., Zhang M.-Y., Zhao D.-H., Gao X., Gu J.-R., Li C.-J.
    FEBS Lett. 564:171-176(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Placenta.
  3. "Identification and characterization of a new member of the MAGE gene family."
    Chen Y.
    Submitted (AUG-2000) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  4. "The DNA sequence of the human X chromosome."
    Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C.
    , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
    Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Blood and Skin.
  6. "Identification of a new, unorthodox member of the MAGE gene family."
    Pold M., Zhou J., Chen G.L., Hall J.M., Vescio R.A., Berenson J.R.
    Genomics 59:161-167(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 202-778 (ISOFORM 1).
    Tissue: Bone marrow.
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 304-778.
    Tissue: Testis.
  8. "A new melanoma antigen-encoding gene subfamily in human chromosome X."
    Zhang C.G., Xing G.C., Wei H.D., Yu Y.T., He F.C.
    Yi Chuan Xue Bao 28:197-203(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 396-778.
    Tissue: Fetal liver.
  9. "Identification of the translational initiation codon in human MAGED1."
    Kubu C.J., Goldhawk D.G., Barker P.A., Verdi J.M.
    Genomics 70:150-152(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION OF THE TRANSLATIONAL INITIATION CODON.
  10. "Immunoaffinity profiling of tyrosine phosphorylation in cancer cells."
    Rush J., Moritz A., Lee K.A., Guo A., Goss V.L., Spek E.J., Zhang H., Zha X.-M., Polakiewicz R.D., Comb M.J.
    Nat. Biotechnol. 23:94-101(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-92, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  11. "MAGE-RING protein complexes comprise a family of E3 ubiquitin ligases."
    Doyle J.M., Gao J., Wang J., Yang M., Potts P.R.
    Mol. Cell 39:963-974(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH TRIM28 AND PJA1.

Entry informationi

Entry nameiMAGD1_HUMAN
AccessioniPrimary (citable) accession number: Q9Y5V3
Secondary accession number(s): Q5VSH6
, Q8IZ84, Q8WY92, Q9H352, Q9HBT4, Q9UF36
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 24, 2001
Last sequence update: April 26, 2005
Last modified: July 22, 2015
This is version 146 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.