Reviewed,
UniProtKB/Swiss-Prot Q9Y5V3 (MAGD1_HUMAN)
Last modified
January 19, 2010.
Version 89.
History...
Clusters with 100%,
90%,
50% identity |
Documents (5) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Melanoma-associated antigen D1 Alternative name(s): MAGE-D1 antigen Neurotrophin receptor-interacting MAGE homolog MAGE tumor antigen CCF | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 778 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Involved in the apoptotic response after nerve growth factor (NGF) binding in neuronal cells. Binds p75NTR and antagonizes its association with TrkA, inhibits cell cycle progression, and facilitates p75NTR-mediated apoptosis. May act as a regulator of the function of DLX family members. May regulate p53 transcriptional activity and inhibit cell proliferation. Enhances p53 phosphorylation and accumulation. |
| Subunit structure | Interacts with DLX5, DLX7 and MSX2 and forms homomultimers. Interacts with UNC5A By similarity. Interacts with the p75 neurotrophin receptor. |
| Subcellular location | Cytoplasm By similarity. Cell membrane; Peripheral membrane protein By similarity. Note: Expression shifts from the cytoplasm to the plasma membrane upon stimulation with NGF By similarity. |
| Tissue specificity | Expressed in bone marrow stromal cells from both multiple myeloma patients and healthy donors. Seems to be ubiquitously expressed. |
| Sequence similarities | Contains 1 MAGE domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell membrane Cytoplasm Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Repeat |
| Molecular function | Tumor antigen |
| PTM | Phosphoprotein |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Biological process | apoptosis Inferred from Experiment. Source: Reactome induction of apoptosis by extracellular signalsInferred from Experiment. Source: Reactome negative regulation of epithelial cell proliferationInferred from direct assay. Source: UniProtKB regulation of transcription, DNA-dependentTraceable author statement. Source: UniProtKB |
| Cellular component | cytoplasm Inferred from electronic annotation. Source: UniProtKB-SubCell extrinsic to membraneInferred from electronic annotation. Source: UniProtKB-SubCell plasma membraneInferred from electronic annotation. Source: UniProtKB-KW protein complexInferred from direct assay. Source: UniProtKB |
| Molecular function | protein binding Inferred from physical interaction. Source: UniProtKB |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| AKAP8L | Q9ULX6 | 1 | EBI-716006,EBI-357530 | |
| ATXN10 | Q9UBB4 | 1 | EBI-716006,EBI-702390 | |
| BAT3 | P46379 | 1 | EBI-716006,EBI-347552 | |
| CALML5 | Q9NZT1 | 1 | EBI-716006,EBI-1051681 | |
| CCDC59 | Q9P031 | 1 | EBI-716006,EBI-1047110 | |
| COPG | Q9Y678 | 1 | EBI-716006,EBI-1049127 | |
| COPG2 | Q9UBF2 | 1 | EBI-716006,EBI-1045840 | |
| EIF3E | P60228 | 1 | EBI-716006,EBI-347740 | |
| FANCI | Q9NVI1 | 1 | EBI-716006,EBI-1013291 | |
| GCN1L1 | Q92616 | 1 | EBI-716006,EBI-356221 | |
| HEATR2 | Q86Y56 | 1 | EBI-716006,EBI-719966 | |
| HSPB1 | P04792 | 1 | EBI-716006,EBI-352682 | |
| KIAA1967 | Q8N163 | 1 | EBI-716006,EBI-355410 | |
| LRPPRC | P42704 | 1 | EBI-716006,EBI-1050853 | |
| MTHFD1L | Q6UB35 | 1 | EBI-716006,EBI-1046835 | |
| NEDD8 | Q15843 | 1 | EBI-716006,EBI-716247 | |
| NOC2L | Q9Y3T9 | 1 | EBI-716006,EBI-751547 | |
| NUP160 | Q12769 | 1 | EBI-716006,EBI-295715 | |
| NUP205 | Q92621 | 1 | EBI-716006,EBI-1045046 | |
| SLC25A1 | P53007 | 1 | EBI-716006,EBI-359163 | |
| SMC3 | Q9UQE7 | 1 | EBI-716006,EBI-80718 | |
| SPTLC1 | O15269 | 1 | EBI-716006,EBI-1044323 | |
| TELO2 | Q9Y4R8 | 1 | EBI-716006,EBI-1043674 | |
| TIMM50 | Q3ZCQ8 | 1 | EBI-716006,EBI-355175 | |
| UBR5 | O95071 | 1 | EBI-716006,EBI-358329 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9Y5V3-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9Y5V3-2) The sequence of this isoform differs from the canonical sequence as follows: 15-15: Q → QNPDACRAVCHPLPQPPASTLPLSAFPTLCDPPYSQLRDPPAVLSCYCTPLGASPAP | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 778 | 778 | Melanoma-associated antigen D1 | PRO_0000156723 | |||||
Regions | |||||||||
| Repeat | 296 – 301 | 6 | 1 | ||||||
| Repeat | 302 – 307 | 6 | 2 | ||||||
| Repeat | 308 – 313 | 6 | 3 | ||||||
| Repeat | 332 – 337 | 6 | 4 | ||||||
| Repeat | 338 – 343 | 6 | 5 | ||||||
| Repeat | 344 – 349 | 6 | 6 | ||||||
| Repeat | 350 – 355 | 6 | 7 | ||||||
| Repeat | 356 – 361 | 6 | 8 | ||||||
| Repeat | 362 – 367 | 6 | 9 | ||||||
| Repeat | 368 – 373 | 6 | 10 | ||||||
| Repeat | 374 – 379 | 6 | 11 | ||||||
| Repeat | 380 – 385 | 6 | 12 | ||||||
| Repeat | 386 – 391 | 6 | 13 | ||||||
| Repeat | 392 – 397 | 6 | 14 | ||||||
| Repeat | 398 – 403 | 6 | 15 | ||||||
| Repeat | 404 – 409 | 6 | 16 | ||||||
| Repeat | 410 – 415 | 6 | 17 | ||||||
| Repeat | 416 – 421 | 6 | 18 | ||||||
| Repeat | 422 – 427 | 6 | 19 | ||||||
| Repeat | 428 – 432 | 5 | 20; approximate | ||||||
| Repeat | 433 – 438 | 6 | 21 | ||||||
| Repeat | 439 – 444 | 6 | 22 | ||||||
| Domain | 471 – 669 | 199 | MAGE | ||||||
| Region | 296 – 444 | 149 | 22 X 6 AA tandem repeats of W-[PQ]-X-P-X-X | ||||||
| Compositional bias | 279 – 452 | 174 | Pro-rich | ||||||
Amino acid modifications | |||||||||
| Modified residue | 92 | 1 | Phosphotyrosine Ref.10 | ||||||
Natural variations | |||||||||
| Alternative sequence | 15 | 1 | Q → QNPDACRAVCHPLPQPPAST LPLSAFPTLCDPPYSQLRDP PAVLSCYCTPLGASPAP in isoform 2. | VSP_009286 | |||||
| Natural variant | 238 | 1 | L → M: dbSNP rs12689461. | VAR_060070 | |||||
Experimental info | |||||||||
| Sequence conflict | 119 | 1 | P → S in AAG09704. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "NRAGE, a novel MAGE protein, interacts with the p75 neurotrophin receptor and facilitates nerve growth factor dependent apoptosis." Salehi A.H., Roux P.P., Kubu C.J., Zeindler C., Bhakar A., Tannis L.-L., Verdi J.M., Barker P.A. Neuron 27:279-288(2000) [PubMed: 10985348] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "hNRAGE, a human neurotrophin receptor interacting MAGE homologue, regulates p53 transcriptional activity and inhibits cell proliferation." Wen C.-J., Xue B., Qin W.-X., Yu M., Zhang M.-Y., Zhao D.-H., Gao X., Gu J.-R., Li C.-J. FEBS Lett. 564:171-176(2004) [PubMed: 15094062] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Placenta. |
| [3] | "Identification and characterization of a new member of the MAGE gene family." Chen Y. Submitted (AUG-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [4] | "The DNA sequence of the human X chromosome." Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C. Bentley D.R.Nature 434:325-337(2005) [PubMed: 15772651] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Blood and Skin. |
| [6] | "Identification of a new, unorthodox member of the MAGE gene family." Pold M., Zhou J., Chen G.L., Hall J.M., Vescio R.A., Berenson J.R. Genomics 59:161-167(1999) [PubMed: 10409427] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 202-778 (ISOFORM 1). Tissue: Bone marrow. |
| [7] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed: 17974005] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 304-778. Tissue: Testis. |
| [8] | "A new melanoma antigen-encoding gene subfamily in human chromosome X." Zhang C.G., Xing G.C., Wei H.D., Yu Y.T., He F.C. Yi Chuan Xue Bao 28:197-203(2001) [PubMed: 11280991] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 396-778. Tissue: Fetal liver. |
| [9] | "Identification of the translational initiation codon in human MAGED1." Kubu C.J., Goldhawk D.G., Barker P.A., Verdi J.M. Genomics 70:150-152(2000) [PubMed: 11087672] [Abstract] Cited for: IDENTIFICATION OF THE TRANSLATIONAL INITIATION CODON. |
| [10] | "Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer." Rikova K., Guo A., Zeng Q., Possemato A., Yu J., Haack H., Nardone J., Lee K., Reeves C., Li Y., Hu Y., Tan Z., Stokes M., Sullivan L., Mitchell J., Wetzel R., Macneill J., Ren J.M. Comb M.J.Cell 131:1190-1203(2007) [PubMed: 18083107] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-92, MASS SPECTROMETRY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF217963 mRNA. Translation: AAG09704.1. AF258554 mRNA. Translation: AAG23757.1. AF300328 mRNA. Translation: AAQ14483.1. AL929410 Genomic DNA. Translation: CAH71560.1. AL929410 Genomic DNA. Translation: CAH71561.1. BC014070 mRNA. Translation: AAH14070.1. BC032473 mRNA. Translation: AAH32473.1. AF124440 mRNA. Translation: AAD31421.1. Different initiation. AL133628 mRNA. Translation: CAB63752.1. AF132205 mRNA. Translation: AAG35551.1. Different initiation. |
| IPI | IPI00328354. IPI00398845. |
| PIR | T43464. |
| RefSeq | NP_001005332.1. NP_001005333.1. NP_008917.3. |
| UniGene | Hs.5258 |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9Y5V3. 47 interactions. |
| STRING | Q9Y5V3. |
PTM databases | |
| PhosphoSite | Q9Y5V3. |
Proteomic databases | |
| PRIDE | Q9Y5V3. |
Genome annotation databases | |
| Ensembl | ENST00000326587; ENSP00000325333; ENSG00000179222; Homo sapiens. [Genome view] ENST00000375722; ENSP00000364874; ENSG00000179222; Homo sapiens. [Genome view] ENST00000375772; ENSP00000364927; ENSG00000179222; Homo sapiens. [Genome view] |
| GeneID | 9500. |
| KEGG | hsa:9500. |
| UCSC | uc004dpm.1. human. uc004dpn.1. human. |
Organism-specific databases | |
| CTD | 9500. |
| GeneCards | GC0XP051562. |
| H-InvDB | HIX0019123. |
| HGNC | HGNC:6813. MAGED1. |
| HPA | CAB015165. |
| MIM | 300224. gene. |
| PharmGKB | PA30559. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG11910. |
| HOVERGEN | Q9Y5V3. |
| OMA | WPLPPDW. |
| OrthoDB | EOG90S310. |
Enzyme and pathway databases | |
| Pathway_Interaction_DB | trkrpathway. Neurotrophic factor-mediated Trk receptor signaling. p75ntrpathway. p75(NTR)-mediated signaling. |
| Reactome | REACT_11061. Signalling by NGF. |
Gene expression databases | |
| ArrayExpress | Q9Y5V3. |
| Bgee | Q9Y5V3. |
| CleanEx | HS_MAGED1. |
| Genevestigator | Q9Y5V3. |
| GermOnline | ENSG00000179222. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR002190. MAGE. [Graphical view] |
| PANTHER | PTHR11736. MAGE. 1 hit. |
| Pfam | PF01454. MAGE. 1 hit. [Graphical view] |
| PROSITE | PS50838. MAGE. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 35594. |
| SOURCE | Search... |
Entry information
| Entry name | MAGD1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9Y5V3 Secondary accession number(s): Q5VSH6 Q9UF36 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome X Human chromosome X: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


