Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9Y5V3

- MAGD1_HUMAN

UniProt

Q9Y5V3 - MAGD1_HUMAN

Protein

Melanoma-associated antigen D1

Gene

MAGED1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 138 (01 Oct 2014)
      Sequence version 3 (26 Apr 2005)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Involved in the apoptotic response after nerve growth factor (NGF) binding in neuronal cells. Inhibits cell cycle progression, and facilitates NGFR-mediated apoptosis. May act as a regulator of the function of DLX family members. May enhance ubiquitin ligase activity of RING-type zinc finger-containing E3 ubiquitin-protein ligases. Proposed to act through recruitment and/or stabilization of the Ubl-conjugating enzyme (E2) at the E3:substrate complex. Plays a role in the circadian rythm regulation. May act as RORA co-regulator, modulating the expression of core clock genes such as ARNTL/BMAL1 and NFIL3, induced, or NR1D1, repressed.1 Publication

    GO - Molecular functioni

    1. protein binding Source: UniProtKB
    2. transcription coactivator activity Source: Ensembl

    GO - Biological processi

    1. apoptotic process Source: Reactome
    2. apoptotic signaling pathway Source: Reactome
    3. circadian regulation of gene expression Source: UniProtKB
    4. negative regulation of epithelial cell proliferation Source: UniProtKB
    5. negative regulation of transcription, DNA-templated Source: Ensembl
    6. neurotrophin TRK receptor signaling pathway Source: Reactome
    7. positive regulation of apoptotic process Source: Reactome
    8. positive regulation of apoptotic signaling pathway Source: Ensembl
    9. positive regulation of branching involved in ureteric bud morphogenesis Source: Ensembl
    10. positive regulation of MAP kinase activity Source: Ensembl
    11. positive regulation of transcription, DNA-templated Source: Ensembl
    12. regulation of apoptotic process Source: UniProtKB
    13. regulation of transcription, DNA-templated Source: UniProtKB
    14. regulation of transcription from RNA polymerase II promoter Source: Ensembl

    Keywords - Molecular functioni

    Tumor antigen

    Keywords - Biological processi

    Biological rhythms, Ubl conjugation pathway

    Enzyme and pathway databases

    ReactomeiREACT_13638. NRAGE signals death through JNK.
    REACT_22128. Role of DCC in regulating apoptosis.
    SignaLinkiQ9Y5V3.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Melanoma-associated antigen D1
    Alternative name(s):
    MAGE tumor antigen CCF
    MAGE-D1 antigen
    Neurotrophin receptor-interacting MAGE homolog
    Gene namesi
    Name:MAGED1
    Synonyms:NRAGE
    ORF Names:PP2250, PRO2292
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome X

    Organism-specific databases

    HGNCiHGNC:6813. MAGED1.

    Subcellular locationi

    Cytoplasm By similarity. Cell membrane By similarity; Peripheral membrane protein By similarity. Nucleus By similarity
    Note: Expression shifts from the cytoplasm to the plasma membrane upon stimulation with NGF.By similarity

    GO - Cellular componenti

    1. chromatin Source: UniProtKB
    2. cytoplasm Source: UniProtKB-SubCell
    3. nucleus Source: UniProtKB
    4. plasma membrane Source: UniProtKB-SubCell
    5. protein complex Source: UniProtKB

    Keywords - Cellular componenti

    Cell membrane, Cytoplasm, Membrane, Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA30559.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 778778Melanoma-associated antigen D1PRO_0000156723Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei92 – 921Phosphotyrosine1 Publication

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ9Y5V3.
    PaxDbiQ9Y5V3.
    PRIDEiQ9Y5V3.

    PTM databases

    PhosphoSiteiQ9Y5V3.

    Expressioni

    Tissue specificityi

    Expressed in bone marrow stromal cells from both multiple myeloma patients and healthy donors. Seems to be ubiquitously expressed.

    Gene expression databases

    BgeeiQ9Y5V3.
    CleanExiHS_MAGED1.
    GenevestigatoriQ9Y5V3.

    Organism-specific databases

    HPAiCAB015165.
    HPA043645.

    Interactioni

    Subunit structurei

    Interacts with DLX5, DLX7 and MSX2 and forms homomultimers. Interacts with UNC5A. Interacts with TRIM28 and PJA1. Interacts with NGFR/p75NTR and RORA.1 Publication

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    PJA1Q8NG274EBI-716006,EBI-714606

    Protein-protein interaction databases

    BioGridi114879. 64 interactions.
    IntActiQ9Y5V3. 27 interactions.
    MINTiMINT-209401.
    STRINGi9606.ENSP00000364847.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9Y5V3.
    SMRiQ9Y5V3. Positions 465-672.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Repeati296 – 30161
    Repeati302 – 30762
    Repeati308 – 31363
    Repeati332 – 33764
    Repeati338 – 34365
    Repeati344 – 34966
    Repeati350 – 35567
    Repeati356 – 36168
    Repeati362 – 36769
    Repeati368 – 373610
    Repeati374 – 379611
    Repeati380 – 385612
    Repeati386 – 391613
    Repeati392 – 397614
    Repeati398 – 403615
    Repeati404 – 409616
    Repeati410 – 415617
    Repeati416 – 421618
    Repeati422 – 427619
    Repeati428 – 432520; approximate
    Repeati433 – 438621
    Repeati439 – 444622
    Domaini471 – 669199MAGEPROSITE-ProRule annotationAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni296 – 44414922 X 6 AA tandem repeats of W-[PQ]-X-P-X-XAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi279 – 452174Pro-richAdd
    BLAST

    Sequence similaritiesi

    Contains 1 MAGE domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat

    Phylogenomic databases

    eggNOGiNOG310785.
    HOVERGENiHBG003714.
    KOiK12464.
    OMAiWQNPVIW.
    OrthoDBiEOG75F4GM.
    PhylomeDBiQ9Y5V3.
    TreeFamiTF352132.

    Family and domain databases

    InterProiIPR002190. MAGE.
    [Graphical view]
    PANTHERiPTHR11736. PTHR11736. 1 hit.
    PfamiPF01454. MAGE. 1 hit.
    [Graphical view]
    PROSITEiPS50838. MAGE. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9Y5V3-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAQKMDCGAG LLGFQAEASV EDSALLMQTL MEAIQISEAP PTNQATAAAS    50
    PQSSQPPTAN EMADIQVSAA AARPKSAFKV QNATTKGPNG VYDFSQAHNA 100
    KDVPNTQPKA AFKSQNATPK GPNAAYDFSQ AATTGELAAN KSEMAFKAQN 150
    ATTKVGPNAT YNFSQSLNAN DLANSRPKTP FKAWNDTTKA PTADTQTQNV 200
    NQAKMATSQA DIETDPGISE PDGATAQTSA DGSQAQNLES RTIIRGKRTR 250
    KINNLNVEEN SSGDQRRAPL AAGTWRSAPV PVTTQNPPGA PPNVLWQTPL 300
    AWQNPSGWQN QTARQTPPAR QSPPARQTPP AWQNPVAWQN PVIWPNPVIW 350
    QNPVIWPNPI VWPGPVVWPN PLAWQNPPGW QTPPGWQTPP GWQGPPDWQG 400
    PPDWPLPPDW PLPPDWPLPT DWPLPPDWIP ADWPIPPDWQ NLRPSPNLRP 450
    SPNSRASQNP GAAQPRDVAL LQERANKLVK YLMLKDYTKV PIKRSEMLRD 500
    IIREYTDVYP EIIERACFVL EKKFGIQLKE IDKEEHLYIL ISTPESLAGI 550
    LGTTKDTPKL GLLLVILGVI FMNGNRASEA VLWEALRKMG LRPGVRHPLL 600
    GDLRKLLTYE FVKQKYLDYR RVPNSNPPEY EFLWGLRSYH ETSKMKVLRF 650
    IAEVQKRDPR DWTAQFMEAA DEALDALDAA AAEAEARAEA RTRMGIGDEA 700
    VSGPWSWDDI EFELLTWDEE GDFGDPWSRI PFTFWARYHQ NARSRFPQTF 750
    AGPIIGPGGT ASANFAANFG AIGFFWVE 778
    Length:778
    Mass (Da):86,161
    Last modified:April 26, 2005 - v3
    Checksum:iD818690052D166CE
    GO
    Isoform 2 (identifier: Q9Y5V3-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         15-15: Q → QNPDACRAVCHPLPQPPASTLPLSAFPTLCDPPYSQLRDPPAVLSCYCTPLGASPAP

    Note: No experimental confirmation available.

    Show »
    Length:834
    Mass (Da):91,959
    Checksum:iCD8E13CE9B35EA7C
    GO

    Sequence cautioni

    The sequence AAD31421.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
    The sequence AAG35551.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti119 – 1191P → S in AAG09704. (PubMed:10985348)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti238 – 2381L → M.
    Corresponds to variant rs12689461 [ dbSNP | Ensembl ].
    VAR_060070

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei15 – 151Q → QNPDACRAVCHPLPQPPAST LPLSAFPTLCDPPYSQLRDP PAVLSCYCTPLGASPAP in isoform 2. 1 PublicationVSP_009286

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF217963 mRNA. Translation: AAG09704.1.
    AF258554 mRNA. Translation: AAG23757.1.
    AF300328 mRNA. Translation: AAQ14483.1.
    AL929410 Genomic DNA. Translation: CAH71560.1.
    AL929410 Genomic DNA. Translation: CAH71561.1.
    BC014070 mRNA. Translation: AAH14070.1.
    BC032473 mRNA. Translation: AAH32473.1.
    AF124440 mRNA. Translation: AAD31421.1. Different initiation.
    AL133628 mRNA. Translation: CAB63752.1.
    AF132205 mRNA. Translation: AAG35551.1. Different initiation.
    CCDSiCCDS14337.1. [Q9Y5V3-1]
    CCDS35279.1. [Q9Y5V3-2]
    PIRiT43464.
    RefSeqiNP_001005332.1. NM_001005332.1. [Q9Y5V3-1]
    NP_001005333.1. NM_001005333.1. [Q9Y5V3-2]
    NP_008917.3. NM_006986.3. [Q9Y5V3-1]
    UniGeneiHs.5258.

    Genome annotation databases

    EnsembliENST00000326587; ENSP00000325333; ENSG00000179222. [Q9Y5V3-1]
    ENST00000375695; ENSP00000364847; ENSG00000179222. [Q9Y5V3-2]
    ENST00000375722; ENSP00000364874; ENSG00000179222. [Q9Y5V3-1]
    ENST00000375772; ENSP00000364927; ENSG00000179222. [Q9Y5V3-1]
    GeneIDi9500.
    KEGGihsa:9500.
    UCSCiuc004dpm.3. human. [Q9Y5V3-1]
    uc004dpn.3. human. [Q9Y5V3-2]

    Polymorphism databases

    DMDMi62906893.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF217963 mRNA. Translation: AAG09704.1 .
    AF258554 mRNA. Translation: AAG23757.1 .
    AF300328 mRNA. Translation: AAQ14483.1 .
    AL929410 Genomic DNA. Translation: CAH71560.1 .
    AL929410 Genomic DNA. Translation: CAH71561.1 .
    BC014070 mRNA. Translation: AAH14070.1 .
    BC032473 mRNA. Translation: AAH32473.1 .
    AF124440 mRNA. Translation: AAD31421.1 . Different initiation.
    AL133628 mRNA. Translation: CAB63752.1 .
    AF132205 mRNA. Translation: AAG35551.1 . Different initiation.
    CCDSi CCDS14337.1. [Q9Y5V3-1 ]
    CCDS35279.1. [Q9Y5V3-2 ]
    PIRi T43464.
    RefSeqi NP_001005332.1. NM_001005332.1. [Q9Y5V3-1 ]
    NP_001005333.1. NM_001005333.1. [Q9Y5V3-2 ]
    NP_008917.3. NM_006986.3. [Q9Y5V3-1 ]
    UniGenei Hs.5258.

    3D structure databases

    ProteinModelPortali Q9Y5V3.
    SMRi Q9Y5V3. Positions 465-672.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 114879. 64 interactions.
    IntActi Q9Y5V3. 27 interactions.
    MINTi MINT-209401.
    STRINGi 9606.ENSP00000364847.

    PTM databases

    PhosphoSitei Q9Y5V3.

    Polymorphism databases

    DMDMi 62906893.

    Proteomic databases

    MaxQBi Q9Y5V3.
    PaxDbi Q9Y5V3.
    PRIDEi Q9Y5V3.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000326587 ; ENSP00000325333 ; ENSG00000179222 . [Q9Y5V3-1 ]
    ENST00000375695 ; ENSP00000364847 ; ENSG00000179222 . [Q9Y5V3-2 ]
    ENST00000375722 ; ENSP00000364874 ; ENSG00000179222 . [Q9Y5V3-1 ]
    ENST00000375772 ; ENSP00000364927 ; ENSG00000179222 . [Q9Y5V3-1 ]
    GeneIDi 9500.
    KEGGi hsa:9500.
    UCSCi uc004dpm.3. human. [Q9Y5V3-1 ]
    uc004dpn.3. human. [Q9Y5V3-2 ]

    Organism-specific databases

    CTDi 9500.
    GeneCardsi GC0XP051562.
    HGNCi HGNC:6813. MAGED1.
    HPAi CAB015165.
    HPA043645.
    MIMi 300224. gene.
    neXtProti NX_Q9Y5V3.
    PharmGKBi PA30559.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG310785.
    HOVERGENi HBG003714.
    KOi K12464.
    OMAi WQNPVIW.
    OrthoDBi EOG75F4GM.
    PhylomeDBi Q9Y5V3.
    TreeFami TF352132.

    Enzyme and pathway databases

    Reactomei REACT_13638. NRAGE signals death through JNK.
    REACT_22128. Role of DCC in regulating apoptosis.
    SignaLinki Q9Y5V3.

    Miscellaneous databases

    ChiTaRSi MAGED1. human.
    GeneWikii MAGED1.
    GenomeRNAii 9500.
    NextBioi 35594.
    PROi Q9Y5V3.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q9Y5V3.
    CleanExi HS_MAGED1.
    Genevestigatori Q9Y5V3.

    Family and domain databases

    InterProi IPR002190. MAGE.
    [Graphical view ]
    PANTHERi PTHR11736. PTHR11736. 1 hit.
    Pfami PF01454. MAGE. 1 hit.
    [Graphical view ]
    PROSITEi PS50838. MAGE. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "NRAGE, a novel MAGE protein, interacts with the p75 neurotrophin receptor and facilitates nerve growth factor dependent apoptosis."
      Salehi A.H., Roux P.P., Kubu C.J., Zeindler C., Bhakar A., Tannis L.-L., Verdi J.M., Barker P.A.
      Neuron 27:279-288(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    2. "hNRAGE, a human neurotrophin receptor interacting MAGE homologue, regulates p53 transcriptional activity and inhibits cell proliferation."
      Wen C.-J., Xue B., Qin W.-X., Yu M., Zhang M.-Y., Zhao D.-H., Gao X., Gu J.-R., Li C.-J.
      FEBS Lett. 564:171-176(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Placenta.
    3. "Identification and characterization of a new member of the MAGE gene family."
      Chen Y.
      Submitted (AUG-2000) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    4. "The DNA sequence of the human X chromosome."
      Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C.
      , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
      Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Blood and Skin.
    6. "Identification of a new, unorthodox member of the MAGE gene family."
      Pold M., Zhou J., Chen G.L., Hall J.M., Vescio R.A., Berenson J.R.
      Genomics 59:161-167(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 202-778 (ISOFORM 1).
      Tissue: Bone marrow.
    7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 304-778.
      Tissue: Testis.
    8. "A new melanoma antigen-encoding gene subfamily in human chromosome X."
      Zhang C.G., Xing G.C., Wei H.D., Yu Y.T., He F.C.
      Yi Chuan Xue Bao 28:197-203(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 396-778.
      Tissue: Fetal liver.
    9. "Identification of the translational initiation codon in human MAGED1."
      Kubu C.J., Goldhawk D.G., Barker P.A., Verdi J.M.
      Genomics 70:150-152(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION OF THE TRANSLATIONAL INITIATION CODON.
    10. "Immunoaffinity profiling of tyrosine phosphorylation in cancer cells."
      Rush J., Moritz A., Lee K.A., Guo A., Goss V.L., Spek E.J., Zhang H., Zha X.-M., Polakiewicz R.D., Comb M.J.
      Nat. Biotechnol. 23:94-101(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-92, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    11. "MAGE-RING protein complexes comprise a family of E3 ubiquitin ligases."
      Doyle J.M., Gao J., Wang J., Yang M., Potts P.R.
      Mol. Cell 39:963-974(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH TRIM28 AND PJA1.

    Entry informationi

    Entry nameiMAGD1_HUMAN
    AccessioniPrimary (citable) accession number: Q9Y5V3
    Secondary accession number(s): Q5VSH6
    , Q8IZ84, Q8WY92, Q9H352, Q9HBT4, Q9UF36
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: January 24, 2001
    Last sequence update: April 26, 2005
    Last modified: October 1, 2014
    This is version 138 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome X
      Human chromosome X: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3