Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9Y5V3

- MAGD1_HUMAN

UniProt

Q9Y5V3 - MAGD1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Melanoma-associated antigen D1

Gene

MAGED1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Involved in the apoptotic response after nerve growth factor (NGF) binding in neuronal cells. Inhibits cell cycle progression, and facilitates NGFR-mediated apoptosis. May act as a regulator of the function of DLX family members. May enhance ubiquitin ligase activity of RING-type zinc finger-containing E3 ubiquitin-protein ligases. Proposed to act through recruitment and/or stabilization of the Ubl-conjugating enzyme (E2) at the E3:substrate complex. Plays a role in the circadian rythm regulation. May act as RORA co-regulator, modulating the expression of core clock genes such as ARNTL/BMAL1 and NFIL3, induced, or NR1D1, repressed.1 Publication

GO - Molecular functioni

  1. transcription coactivator activity Source: Ensembl

GO - Biological processi

  1. apoptotic process Source: Reactome
  2. apoptotic signaling pathway Source: Reactome
  3. circadian regulation of gene expression Source: UniProtKB
  4. negative regulation of epithelial cell proliferation Source: UniProtKB
  5. negative regulation of transcription, DNA-templated Source: Ensembl
  6. neurotrophin TRK receptor signaling pathway Source: Reactome
  7. positive regulation of apoptotic process Source: Reactome
  8. positive regulation of apoptotic signaling pathway Source: Ensembl
  9. positive regulation of branching involved in ureteric bud morphogenesis Source: Ensembl
  10. positive regulation of MAP kinase activity Source: Ensembl
  11. positive regulation of transcription, DNA-templated Source: Ensembl
  12. regulation of apoptotic process Source: UniProtKB
  13. regulation of circadian rhythm Source: Ensembl
  14. regulation of transcription, DNA-templated Source: UniProtKB
  15. regulation of transcription from RNA polymerase II promoter Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

Tumor antigen

Keywords - Biological processi

Biological rhythms, Ubl conjugation pathway

Enzyme and pathway databases

ReactomeiREACT_13638. NRAGE signals death through JNK.
REACT_22128. Role of DCC in regulating apoptosis.
SignaLinkiQ9Y5V3.

Names & Taxonomyi

Protein namesi
Recommended name:
Melanoma-associated antigen D1
Alternative name(s):
MAGE tumor antigen CCF
MAGE-D1 antigen
Neurotrophin receptor-interacting MAGE homolog
Gene namesi
Name:MAGED1
Synonyms:NRAGE
ORF Names:PP2250, PRO2292
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome X

Organism-specific databases

HGNCiHGNC:6813. MAGED1.

Subcellular locationi

Cytoplasm By similarity. Cell membrane By similarity; Peripheral membrane protein By similarity. Nucleus By similarity
Note: Expression shifts from the cytoplasm to the plasma membrane upon stimulation with NGF.By similarity

GO - Cellular componenti

  1. chromatin Source: UniProtKB
  2. cytoplasm Source: UniProtKB-KW
  3. nucleus Source: UniProtKB
  4. plasma membrane Source: UniProtKB-KW
  5. protein complex Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA30559.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 778778Melanoma-associated antigen D1PRO_0000156723Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei92 – 921Phosphotyrosine1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ9Y5V3.
PaxDbiQ9Y5V3.
PRIDEiQ9Y5V3.

PTM databases

PhosphoSiteiQ9Y5V3.

Expressioni

Tissue specificityi

Expressed in bone marrow stromal cells from both multiple myeloma patients and healthy donors. Seems to be ubiquitously expressed.

Gene expression databases

BgeeiQ9Y5V3.
CleanExiHS_MAGED1.
GenevestigatoriQ9Y5V3.

Organism-specific databases

HPAiCAB015165.
HPA043645.

Interactioni

Subunit structurei

Interacts with DLX5, DLX7 and MSX2 and forms homomultimers. Interacts with UNC5A. Interacts with TRIM28 and PJA1. Interacts with NGFR/p75NTR and RORA.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
PJA1Q8NG274EBI-716006,EBI-714606

Protein-protein interaction databases

BioGridi114879. 73 interactions.
IntActiQ9Y5V3. 27 interactions.
MINTiMINT-209401.
STRINGi9606.ENSP00000364847.

Structurei

3D structure databases

ProteinModelPortaliQ9Y5V3.
SMRiQ9Y5V3. Positions 465-672.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati296 – 30161
Repeati302 – 30762
Repeati308 – 31363
Repeati332 – 33764
Repeati338 – 34365
Repeati344 – 34966
Repeati350 – 35567
Repeati356 – 36168
Repeati362 – 36769
Repeati368 – 373610
Repeati374 – 379611
Repeati380 – 385612
Repeati386 – 391613
Repeati392 – 397614
Repeati398 – 403615
Repeati404 – 409616
Repeati410 – 415617
Repeati416 – 421618
Repeati422 – 427619
Repeati428 – 432520; approximate
Repeati433 – 438621
Repeati439 – 444622
Domaini471 – 669199MAGEPROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni296 – 44414922 X 6 AA tandem repeats of W-[PQ]-X-P-X-XAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi279 – 452174Pro-richAdd
BLAST

Sequence similaritiesi

Contains 1 MAGE domain.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiNOG310785.
GeneTreeiENSGT00760000118824.
HOVERGENiHBG003714.
InParanoidiQ9Y5V3.
KOiK12464.
OMAiWQNPVIW.
OrthoDBiEOG75F4GM.
PhylomeDBiQ9Y5V3.
TreeFamiTF352132.

Family and domain databases

InterProiIPR002190. MAGE.
[Graphical view]
PANTHERiPTHR11736. PTHR11736. 1 hit.
PfamiPF01454. MAGE. 1 hit.
[Graphical view]
PROSITEiPS50838. MAGE. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9Y5V3-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAQKMDCGAG LLGFQAEASV EDSALLMQTL MEAIQISEAP PTNQATAAAS
60 70 80 90 100
PQSSQPPTAN EMADIQVSAA AARPKSAFKV QNATTKGPNG VYDFSQAHNA
110 120 130 140 150
KDVPNTQPKA AFKSQNATPK GPNAAYDFSQ AATTGELAAN KSEMAFKAQN
160 170 180 190 200
ATTKVGPNAT YNFSQSLNAN DLANSRPKTP FKAWNDTTKA PTADTQTQNV
210 220 230 240 250
NQAKMATSQA DIETDPGISE PDGATAQTSA DGSQAQNLES RTIIRGKRTR
260 270 280 290 300
KINNLNVEEN SSGDQRRAPL AAGTWRSAPV PVTTQNPPGA PPNVLWQTPL
310 320 330 340 350
AWQNPSGWQN QTARQTPPAR QSPPARQTPP AWQNPVAWQN PVIWPNPVIW
360 370 380 390 400
QNPVIWPNPI VWPGPVVWPN PLAWQNPPGW QTPPGWQTPP GWQGPPDWQG
410 420 430 440 450
PPDWPLPPDW PLPPDWPLPT DWPLPPDWIP ADWPIPPDWQ NLRPSPNLRP
460 470 480 490 500
SPNSRASQNP GAAQPRDVAL LQERANKLVK YLMLKDYTKV PIKRSEMLRD
510 520 530 540 550
IIREYTDVYP EIIERACFVL EKKFGIQLKE IDKEEHLYIL ISTPESLAGI
560 570 580 590 600
LGTTKDTPKL GLLLVILGVI FMNGNRASEA VLWEALRKMG LRPGVRHPLL
610 620 630 640 650
GDLRKLLTYE FVKQKYLDYR RVPNSNPPEY EFLWGLRSYH ETSKMKVLRF
660 670 680 690 700
IAEVQKRDPR DWTAQFMEAA DEALDALDAA AAEAEARAEA RTRMGIGDEA
710 720 730 740 750
VSGPWSWDDI EFELLTWDEE GDFGDPWSRI PFTFWARYHQ NARSRFPQTF
760 770
AGPIIGPGGT ASANFAANFG AIGFFWVE
Length:778
Mass (Da):86,161
Last modified:April 26, 2005 - v3
Checksum:iD818690052D166CE
GO
Isoform 2 (identifier: Q9Y5V3-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     15-15: Q → QNPDACRAVCHPLPQPPASTLPLSAFPTLCDPPYSQLRDPPAVLSCYCTPLGASPAP

Note: No experimental confirmation available.

Show »
Length:834
Mass (Da):91,959
Checksum:iCD8E13CE9B35EA7C
GO

Sequence cautioni

The sequence AAD31421.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAG35551.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti119 – 1191P → S in AAG09704. (PubMed:10985348)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti238 – 2381L → M.
Corresponds to variant rs12689461 [ dbSNP | Ensembl ].
VAR_060070

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei15 – 151Q → QNPDACRAVCHPLPQPPAST LPLSAFPTLCDPPYSQLRDP PAVLSCYCTPLGASPAP in isoform 2. 1 PublicationVSP_009286

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF217963 mRNA. Translation: AAG09704.1.
AF258554 mRNA. Translation: AAG23757.1.
AF300328 mRNA. Translation: AAQ14483.1.
AL929410 Genomic DNA. Translation: CAH71560.1.
AL929410 Genomic DNA. Translation: CAH71561.1.
BC014070 mRNA. Translation: AAH14070.1.
BC032473 mRNA. Translation: AAH32473.1.
AF124440 mRNA. Translation: AAD31421.1. Different initiation.
AL133628 mRNA. Translation: CAB63752.1.
AF132205 mRNA. Translation: AAG35551.1. Different initiation.
CCDSiCCDS14337.1. [Q9Y5V3-1]
CCDS35279.1. [Q9Y5V3-2]
PIRiT43464.
RefSeqiNP_001005332.1. NM_001005332.1. [Q9Y5V3-1]
NP_001005333.1. NM_001005333.1. [Q9Y5V3-2]
NP_008917.3. NM_006986.3. [Q9Y5V3-1]
UniGeneiHs.5258.

Genome annotation databases

EnsembliENST00000326587; ENSP00000325333; ENSG00000179222. [Q9Y5V3-1]
ENST00000375695; ENSP00000364847; ENSG00000179222. [Q9Y5V3-2]
ENST00000375722; ENSP00000364874; ENSG00000179222. [Q9Y5V3-1]
ENST00000375772; ENSP00000364927; ENSG00000179222. [Q9Y5V3-1]
GeneIDi9500.
KEGGihsa:9500.
UCSCiuc004dpm.3. human. [Q9Y5V3-1]
uc004dpn.3. human. [Q9Y5V3-2]

Polymorphism databases

DMDMi62906893.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF217963 mRNA. Translation: AAG09704.1 .
AF258554 mRNA. Translation: AAG23757.1 .
AF300328 mRNA. Translation: AAQ14483.1 .
AL929410 Genomic DNA. Translation: CAH71560.1 .
AL929410 Genomic DNA. Translation: CAH71561.1 .
BC014070 mRNA. Translation: AAH14070.1 .
BC032473 mRNA. Translation: AAH32473.1 .
AF124440 mRNA. Translation: AAD31421.1 . Different initiation.
AL133628 mRNA. Translation: CAB63752.1 .
AF132205 mRNA. Translation: AAG35551.1 . Different initiation.
CCDSi CCDS14337.1. [Q9Y5V3-1 ]
CCDS35279.1. [Q9Y5V3-2 ]
PIRi T43464.
RefSeqi NP_001005332.1. NM_001005332.1. [Q9Y5V3-1 ]
NP_001005333.1. NM_001005333.1. [Q9Y5V3-2 ]
NP_008917.3. NM_006986.3. [Q9Y5V3-1 ]
UniGenei Hs.5258.

3D structure databases

ProteinModelPortali Q9Y5V3.
SMRi Q9Y5V3. Positions 465-672.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 114879. 73 interactions.
IntActi Q9Y5V3. 27 interactions.
MINTi MINT-209401.
STRINGi 9606.ENSP00000364847.

PTM databases

PhosphoSitei Q9Y5V3.

Polymorphism databases

DMDMi 62906893.

Proteomic databases

MaxQBi Q9Y5V3.
PaxDbi Q9Y5V3.
PRIDEi Q9Y5V3.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000326587 ; ENSP00000325333 ; ENSG00000179222 . [Q9Y5V3-1 ]
ENST00000375695 ; ENSP00000364847 ; ENSG00000179222 . [Q9Y5V3-2 ]
ENST00000375722 ; ENSP00000364874 ; ENSG00000179222 . [Q9Y5V3-1 ]
ENST00000375772 ; ENSP00000364927 ; ENSG00000179222 . [Q9Y5V3-1 ]
GeneIDi 9500.
KEGGi hsa:9500.
UCSCi uc004dpm.3. human. [Q9Y5V3-1 ]
uc004dpn.3. human. [Q9Y5V3-2 ]

Organism-specific databases

CTDi 9500.
GeneCardsi GC0XP051562.
HGNCi HGNC:6813. MAGED1.
HPAi CAB015165.
HPA043645.
MIMi 300224. gene.
neXtProti NX_Q9Y5V3.
PharmGKBi PA30559.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG310785.
GeneTreei ENSGT00760000118824.
HOVERGENi HBG003714.
InParanoidi Q9Y5V3.
KOi K12464.
OMAi WQNPVIW.
OrthoDBi EOG75F4GM.
PhylomeDBi Q9Y5V3.
TreeFami TF352132.

Enzyme and pathway databases

Reactomei REACT_13638. NRAGE signals death through JNK.
REACT_22128. Role of DCC in regulating apoptosis.
SignaLinki Q9Y5V3.

Miscellaneous databases

ChiTaRSi MAGED1. human.
GeneWikii MAGED1.
GenomeRNAii 9500.
NextBioi 35594.
PROi Q9Y5V3.
SOURCEi Search...

Gene expression databases

Bgeei Q9Y5V3.
CleanExi HS_MAGED1.
Genevestigatori Q9Y5V3.

Family and domain databases

InterProi IPR002190. MAGE.
[Graphical view ]
PANTHERi PTHR11736. PTHR11736. 1 hit.
Pfami PF01454. MAGE. 1 hit.
[Graphical view ]
PROSITEi PS50838. MAGE. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "NRAGE, a novel MAGE protein, interacts with the p75 neurotrophin receptor and facilitates nerve growth factor dependent apoptosis."
    Salehi A.H., Roux P.P., Kubu C.J., Zeindler C., Bhakar A., Tannis L.-L., Verdi J.M., Barker P.A.
    Neuron 27:279-288(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "hNRAGE, a human neurotrophin receptor interacting MAGE homologue, regulates p53 transcriptional activity and inhibits cell proliferation."
    Wen C.-J., Xue B., Qin W.-X., Yu M., Zhang M.-Y., Zhao D.-H., Gao X., Gu J.-R., Li C.-J.
    FEBS Lett. 564:171-176(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Placenta.
  3. "Identification and characterization of a new member of the MAGE gene family."
    Chen Y.
    Submitted (AUG-2000) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  4. "The DNA sequence of the human X chromosome."
    Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C.
    , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
    Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Blood and Skin.
  6. "Identification of a new, unorthodox member of the MAGE gene family."
    Pold M., Zhou J., Chen G.L., Hall J.M., Vescio R.A., Berenson J.R.
    Genomics 59:161-167(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 202-778 (ISOFORM 1).
    Tissue: Bone marrow.
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 304-778.
    Tissue: Testis.
  8. "A new melanoma antigen-encoding gene subfamily in human chromosome X."
    Zhang C.G., Xing G.C., Wei H.D., Yu Y.T., He F.C.
    Yi Chuan Xue Bao 28:197-203(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 396-778.
    Tissue: Fetal liver.
  9. "Identification of the translational initiation codon in human MAGED1."
    Kubu C.J., Goldhawk D.G., Barker P.A., Verdi J.M.
    Genomics 70:150-152(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION OF THE TRANSLATIONAL INITIATION CODON.
  10. "Immunoaffinity profiling of tyrosine phosphorylation in cancer cells."
    Rush J., Moritz A., Lee K.A., Guo A., Goss V.L., Spek E.J., Zhang H., Zha X.-M., Polakiewicz R.D., Comb M.J.
    Nat. Biotechnol. 23:94-101(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-92, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  11. "MAGE-RING protein complexes comprise a family of E3 ubiquitin ligases."
    Doyle J.M., Gao J., Wang J., Yang M., Potts P.R.
    Mol. Cell 39:963-974(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH TRIM28 AND PJA1.

Entry informationi

Entry nameiMAGD1_HUMAN
AccessioniPrimary (citable) accession number: Q9Y5V3
Secondary accession number(s): Q5VSH6
, Q8IZ84, Q8WY92, Q9H352, Q9HBT4, Q9UF36
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 24, 2001
Last sequence update: April 26, 2005
Last modified: October 29, 2014
This is version 139 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3